F434322

General Info

Members Datasets Scaffolds Average Seq Length
399 191 798 233

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10033948|Ga0265318_100339482
Length 263
Sequence VTDTGNPLGPAITAPAAGAAXXXPVLRAGRRGTQRLVRIASNTLITAGVLVFIWSIVVWRWEDPFTALYTTWKQHELAQQYRSLQRAYRPVVPVAPAHVKRGTRVPAALAPKTIAADAAAFRRDTHEGEAIGRIVIGRIGLKMVLVNGTAEATLEKGPGRDLQSYMPGQNRLVYIAGHRTTYLAPFSHIDDIRNGDYIRLEMPYATFIYRAVSHEIVPATDLAVLRSPDHELLRLQACHPRFFATHRYIVNAKLVSVERPASA

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
88 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
94 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 12.78
Rhizosphere 86.97
Stem 0
Stem Tuber 0
Unclassified 18.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10033948 3300028577 Bacteria 1968
2 Ga0070658_10019504 3300005327 Bacteria 5430
3 Ga0070658_10020765 3300005327 Bacteria 5262
4 Ga0070658_10021499 3300005327 Bacteria 5171
5 Ga0070683_100025550 3300005329 Bacteria 5305
6 Ga0070680_100138197 3300005336 Bacteria 2042
7 Ga0070680_100163987 3300005336 Unclassified 1868
8 Ga0070680_100222714 3300005336 Unclassified 1592
9 Ga0070680_100277384 3300005336 Unclassified 1420
10 Ga0070660_100285432 3300005339 Bacteria 1351
11 Ga0070660_100324571 3300005339 Bacteria 1265
12 Ga0070661_100410249 3300005344 Bacteria 1072
13 Ga0070669_100541067 3300005353 Bacteria 970
14 Ga0070671_100262682 3300005355 Bacteria 1467
15 Ga0070659_100078428 3300005366 Bacteria 2635
16 Ga0070659_100261508 3300005366 Bacteria 1436
17 Ga0070667_100039557 3300005367 Bacteria 3953
18 Ga0070714_100002635 3300005435 Bacteria 13211
19 Ga0070714_100025632 3300005435 Bacteria 4868
20 Ga0070714_100083322 3300005435 Unclassified 2788
21 Ga0070714_100083477 3300005435 Bacteria 2786
22 Ga0070714_100159914 3300005435 Bacteria 2037
23 Ga0070714_100174550 3300005435 Bacteria 1952
24 Ga0070713_100066710 3300005436 Bacteria 3027
25 Ga0070713_100190542 3300005436 Bacteria 1847
26 Ga0070713_100196176 3300005436 Bacteria 1821
27 Ga0070711_100021887 3300005439 Bacteria 4138
28 Ga0070711_100150926 3300005439 Bacteria 1752
29 Ga0070708_100324222 3300005445 Bacteria 1451
30 Ga0070681_10047349 3300005458 Bacteria 4298
31 Ga0070681_10064303 3300005458 Bacteria 3639
32 Ga0070681_10071752 3300005458 Bacteria 3427
33 Ga0070707_100001744 3300005468 Bacteria 20935
34 Ga0070707_100004262 3300005468 Bacteria 13391
35 Ga0070707_100045720 3300005468 Bacteria 4189
36 Ga0070699_100380798 3300005518 Bacteria 1274
37 Ga0070699_100544746 3300005518 Unclassified 1056
38 Ga0070699_100805876 3300005518 Bacteria 859
39 Ga0070679_100077686 3300005530 Bacteria 3309
40 Ga0070679_100091561 3300005530 Bacteria 3029
41 Ga0070679_100100593 3300005530 Bacteria 2877
42 Ga0070679_100226357 3300005530 Unclassified 1830
43 Ga0070684_100066223 3300005535 Bacteria 3171
44 Ga0070684_100305148 3300005535 Bacteria 1461
45 Ga0070693_100334667 3300005547 Unclassified 1031
46 Ga0070704_100152921 3300005549 Bacteria 1816
47 Ga0068855_100090286 3300005563 Bacteria 3536
48 Ga0068855_100107615 3300005563 Bacteria 3203
49 Ga0068857_100455056 3300005577 Unclassified 1197
50 Ga0081539_10001005 3300005985 Bacteria 52334
51 Ga0070717_10001101 3300006028 Bacteria 18187
52 Ga0070717_10001299 3300006028 Bacteria 17103
53 Ga0070717_10021309 3300006028 Bacteria 5105
54 Ga0070717_10101369 3300006028 Unclassified 2445
55 Ga0070717_10631739 3300006028 Bacteria 972
56 Ga0070712_100009498 3300006175 Bacteria 6130
57 Ga0075431_100080515 3300006847 Bacteria 3363
58 Ga0075433_10028377 3300006852 Bacteria 4757
59 Ga0075434_100007779 3300006871 Bacteria 9921
60 Ga0075434_100350909 3300006871 Unclassified 1496
61 Ga0075436_100003136 3300006914 Bacteria 11336
62 Ga0075435_100176108 3300007076 Bacteria 1806
63 Ga0105240_10067450 3300009093 Bacteria 4434
64 Ga0105240_10181264 3300009093 Bacteria 2485
65 Ga0111539_10162126 3300009094 Bacteria 2615
66 Ga0105245_10092431 3300009098 Bacteria 2786
67 Ga0105245_10322754 3300009098 Unclassified 1522
68 Ga0105245_10544747 3300009098 Unclassified 1182
69 Ga0114129_10000141 3300009147 Bacteria 75420
70 Ga0114129_10084742 3300009147 Bacteria 4399
71 Ga0105246_10253847 3300011119 Unclassified 1397
72 Ga0157373_10043627 3300013100 Bacteria 3204
73 Ga0157373_10089316 3300013100 Bacteria 2170
74 Ga0157373_10177549 3300013100 Bacteria 1499
75 Ga0157370_10059261 3300013104 Bacteria 3638
76 Ga0157369_10002742 3300013105 Bacteria 21036
77 Ga0157369_10012846 3300013105 Bacteria 9495
78 Ga0163162_10204841 3300013306 Bacteria 2102
79 Ga0157372_10563341 3300013307 Bacteria 1328
80 Ga0157375_10688399 3300013308 Bacteria 1177
81 Ga0157376_10250004 3300014969 Bacteria 1655
82 Ga0197907_10252519 3300020069 Bacteria 3173
83 Ga0197907_11084745 3300020069 Unclassified 889
84 Ga0206356_10772932 3300020070 Bacteria 3326
85 Ga0206354_10544619 3300020081 Bacteria 1289
86 Ga0206353_11181121 3300020082 Bacteria 894
87 Ga0207692_10332462 3300025898 Bacteria 932
88 Ga0207705_10162669 3300025909 Bacteria 1677
89 Ga0207684_10096726 3300025910 Bacteria 2520
90 Ga0207707_10114331 3300025912 Bacteria 2359
91 Ga0207707_10164949 3300025912 Bacteria 1936
92 Ga0207707_10345165 3300025912 Bacteria 1283
93 Ga0207695_10144984 3300025913 Bacteria 2320
94 Ga0207693_10009458 3300025915 Bacteria 7940
95 Ga0207693_10040440 3300025915 Bacteria 3672
96 Ga0207663_10048610 3300025916 Bacteria 2626
97 Ga0207663_10329771 3300025916 Bacteria 1149
98 Ga0207660_10242705 3300025917 Unclassified 1420
99 Ga0207657_10003179 3300025919 Bacteria 17568
100 Ga0207657_10003297 3300025919 Bacteria 17254
101 Ga0207657_10092788 3300025919 Unclassified 2516
102 Ga0207652_10107085 3300025921 Unclassified 2475
103 Ga0207652_10212304 3300025921 Bacteria 1743
104 Ga0207646_10002705 3300025922 Bacteria 20781
105 Ga0207646_10007376 3300025922 Bacteria 11190
106 Ga0207646_10008599 3300025922 Bacteria 10203
107 Ga0207687_10359144 3300025927 Bacteria 1188
108 Ga0207700_10045366 3300025928 Bacteria 3243
109 Ga0207664_10003234 3300025929 Bacteria 10822
110 Ga0207664_10006187 3300025929 Bacteria 8213
111 Ga0207664_10029158 3300025929 Bacteria 4201
112 Ga0207664_10039734 3300025929 Unclassified 3654
113 Ga0207664_10098200 3300025929 Bacteria 2414
114 Ga0207664_10288099 3300025929 Bacteria 1443
115 Ga0207664_10717366 3300025929 Unclassified 899
116 Ga0207644_10294532 3300025931 Bacteria 1306
117 Ga0207690_10061240 3300025932 Bacteria 2558
118 Ga0207661_10035801 3300025944 Bacteria 3871
119 Ga0207658_10030582 3300025986 Bacteria 3814
120 Ga0207677_10447146 3300026023 Unclassified 1106
121 Ga0207702_10061391 3300026078 Bacteria 3206
122 Ga0207702_10871786 3300026078 Bacteria 892
123 Ga0207641_10563552 3300026088 Unclassified 1112
124 Ga0207683_10199429 3300026121 Bacteria 1818
125 Ga0265320_10049289 3300031240 Bacteria 2051
126 Ga0307408_100250277 3300031548 Bacteria 1461
127 Ga0265314_10146076 3300031711 Bacteria 1457
128 Ga0307406_10155799 3300031901 Bacteria 1636
129 Ga0373926_0011738 3300035083 Bacteria 2954
130 Ga0373944_0007023 3300035089 Bacteria 3009
131 Ga0373945_0010393 3300035116 Unclassified 3064
132 Ga0373943_0010108 3300035170 Bacteria 4232
133 Ga0373946_0002104 3300035171 Bacteria 6987
134 Ga0373935_0008577 3300035692 Bacteria 6120
135 Ga0373947_0001399 3300035725 Bacteria 14849
136 Ga0373925_0005667 3300037068 Bacteria 9285
137 Ga0395899_0066722 3300037312 Unclassified 2642
138 Ga0395899_0083735 3300037312 Unclassified 2319
139 Ga0395900_0001640 3300037418 Bacteria 26256
140 Ga0395900_0040148 3300037418 Bacteria 4823
141 Ga0395900_0050601 3300037418 Bacteria 4279
142 Ga0395900_0052311 3300037418 Bacteria 4204
143 Ga0395900_0082190 3300037418 Bacteria 3310
144 Ga0395900_0087236 3300037418 Bacteria 3207
145 Ga0395900_0116495 3300037418 Bacteria 2742
146 Ga0395900_0151975 3300037418 Bacteria 2365
147 Ga0395900_0165816 3300037418 Bacteria 2251
148 Ga0395900_0447588 3300037418 Unclassified 1248
149 Ga0395900_0638425 3300037418 Bacteria 1002
150 Ga0395898_0032374 3300037466 Bacteria 5219
151 Ga0395898_0066941 3300037466 Bacteria 3479
152 Ga0395898_0090351 3300037466 Bacteria 2947
153 Ga0395898_0099744 3300037466 Bacteria 2789
154 Ga0395898_0133633 3300037466 Bacteria 2375
155 Ga0395898_0151515 3300037466 Bacteria 2218
156 Ga0395898_0183261 3300037466 Unclassified 2001
157 Ga0395898_0201469 3300037466 Unclassified 1900
158 Ga0395905_0003392 3300037471 Bacteria 17054
159 Ga0395905_0011155 3300037471 Bacteria 8690
160 Ga0395905_0075924 3300037471 Bacteria 3149
161 Ga0395905_0186471 3300037471 Bacteria 1947
162 Ga0395905_0290417 3300037471 Bacteria 1522
163 Ga0395905_0340587 3300037471 Unclassified 1391
164 Ga0395905_0771172 3300037471 Unclassified 864
165 Ga0395901_0001841 3300038443 Bacteria 21913
166 Ga0395901_0026231 3300038443 Bacteria 5982
167 Ga0395901_0046748 3300038443 Bacteria 4496
168 Ga0395901_0056146 3300038443 Bacteria 4096
169 Ga0395901_0077636 3300038443 Bacteria 3466
170 Ga0395901_0320208 3300038443 Unclassified 1605
171 Ga0395901_0358798 3300038443 Bacteria 1503
172 Ga0395901_0469110 3300038443 Unclassified 1285
173 Ga0395901_0469832 3300038443 Unclassified 1284
174 Ga0395901_0587192 3300038443 Bacteria 1125
175 Ga0395901_0652253 3300038443 Bacteria 1056
176 Ga0439439_0011494 3300041406 Bacteria 2131
177 Ga0439461_0002244 3300041410 Bacteria 3073
178 Ga0439466_0033984 3300041411 Bacteria 1730
179 Ga0439431_0002800 3300041997 Bacteria 3843
180 Ga0439433_0007421 3300041999 Bacteria 2367
181 Ga0439449_0020366 3300042007 Unclassified 2486
182 Ga0439457_010829 3300042014 Bacteria 2086
183 Ga0439462_0005261 3300042015 Bacteria 3188
184 Ga0439446_0004570 3300042156 Bacteria 3508
185 Ga0439446_0038363 3300042156 Bacteria 1404
186 Ga0439434_0003542 3300042435 Bacteria 4561
187 Ga0439434_0013555 3300042435 Bacteria 2421
188 Ga0466969_0081085 3300044656 Unclassified 1549
189 Ga0466966_0039101 3300044684 Unclassified 3055
190 Ga0466966_0055020 3300044684 Bacteria 2520
191 Ga0466961_0078726 3300044693 Bacteria 2088
192 Ga0466961_0257936 3300044693 Bacteria 1069
193 Ga0466963_0001916 3300044694 Bacteria 11392
194 Ga0466963_0002069 3300044694 Bacteria 11077
195 Ga0466963_0006098 3300044694 Bacteria 7108
196 Ga0466963_0007925 3300044694 Bacteria 6360
197 Ga0466963_0008292 3300044694 Bacteria 6225
198 Ga0466963_0008399 3300044694 Bacteria 6186
199 Ga0466963_0008414 3300044694 Bacteria 6182
200 Ga0466963_0009258 3300044694 Bacteria 5931
201 Ga0466963_0012541 3300044694 Bacteria 5191
202 Ga0466963_0015202 3300044694 Bacteria 4761
203 Ga0466963_0050132 3300044694 Bacteria 2763
204 Ga0466963_0051583 3300044694 Bacteria 2727
205 Ga0466963_0238090 3300044694 Unclassified 1276
206 Ga0466963_0252071 3300044694 Unclassified 1239
207 Ga0466964_0008528 3300044706 Unclassified 3854
208 Ga0466964_0037664 3300044706 Unclassified 1943
209 Ga0466964_0039583 3300044706 Bacteria 1900
210 Ga0466971_0011086 3300044719 Bacteria 3946
211 Ga0466971_0080351 3300044719 Unclassified 1486
212 Ga0466968_0005318 3300044735 Bacteria 4818
213 Ga0466968_0044723 3300044735 Bacteria 1877
214 Ga0466968_0049728 3300044735 Unclassified 1787
215 Ga0466968_0201310 3300044735 Bacteria 933
216 Ga0466970_0094829 3300044765 Bacteria 1622
217 Ga0466970_0197211 3300044765 Bacteria 1119
218 Ga0466957_0029167 3300044842 Bacteria 3289
219 Ga0466957_0042609 3300044842 Bacteria 2747
220 Ga0466957_0075023 3300044842 Bacteria 2098
221 Ga0466957_0080204 3300044842 Bacteria 2031
222 Ga0466957_0566501 3300044842 Bacteria 793
223 Ga0466960_0005414 3300044901 Bacteria 5056
224 Ga0466959_0006127 3300045049 Bacteria 8309
225 Ga0466959_0062413 3300045049 Unclassified 2708
226 Ga0451576_0308757 3300045051 Bacteria 1655
227 Ga0466958_0001895 3300045836 Bacteria 10231
228 Ga0466958_0010345 3300045836 Bacteria 5224
229 Ga0466958_0028725 3300045836 Bacteria 3299
230 Ga0466958_0148026 3300045836 Bacteria 1480
231 Ga0466958_0528266 3300045836 Bacteria 766
232 Ga0466967_0001257 3300045976 Bacteria 14338
233 Ga0466967_0002836 3300045976 Bacteria 10995
234 Ga0466967_0005113 3300045976 Bacteria 9014
235 Ga0466967_0014830 3300045976 Bacteria 6088
236 Ga0466967_0020481 3300045976 Bacteria 5348
237 Ga0466967_0021024 3300045976 Bacteria 5287
238 Ga0466967_0022188 3300045976 Bacteria 5174
239 Ga0466967_0028728 3300045976 Archaea 4646
240 Ga0466967_0046558 3300045976 Bacteria 3777
241 Ga0466967_0046764 3300045976 Bacteria 3769
242 Ga0466967_0063355 3300045976 Bacteria 3285
243 Ga0466967_0089223 3300045976 Bacteria 2799
244 Ga0466967_0094284 3300045976 Bacteria 2725
245 Ga0466967_0162625 3300045976 Unclassified 2096
246 Ga0466967_0196706 3300045976 Bacteria 1907
247 Ga0466967_0245330 3300045976 Bacteria 1709
248 Ga0466967_0444450 3300045976 Unclassified 1266
249 Ga0495592_0132614 3300046454 Bacteria 1741
250 Ga0495629_0002051 3300046459 Bacteria 15662
251 Ga0495629_0045235 3300046459 Bacteria 3089
252 Ga0495629_0105398 3300046459 Bacteria 1966
253 Ga0495641_0004707 3300046461 Bacteria 9506
254 Ga0495641_0095976 3300046461 Unclassified 1323
255 Ga0495651_0022123 3300046462 Bacteria 4943
256 Ga0495653_0110807 3300046463 Bacteria 1972
257 Ga0495582_0000054 3300046473 Bacteria 57496
258 Ga0495639_0002410 3300046475 Bacteria 8177
259 Ga0495662_0008561 3300046476 Bacteria 5025
260 Ga0495664_0040799 3300046477 Bacteria 2745
261 Ga0495664_0076487 3300046477 Bacteria 2003
262 Ga0495594_0058486 3300046499 Unclassified 2130
263 Ga0495608_0048702 3300046511 Bacteria 2815
264 Ga0495618_0432473 3300046514 Bacteria 801
265 Ga0495628_0292770 3300046516 Bacteria 1206
266 Ga0495630_0091934 3300046517 Unclassified 2293
267 Ga0495630_0197106 3300046517 Unclassified 1536
268 Ga0495666_0068326 3300046526 Unclassified 1692
269 Ga0495652_0205702 3300046529 Bacteria 1490
270 Ga0495665_0001744 3300046531 Bacteria 11691
271 Ga0495665_0256742 3300046531 Bacteria 899
272 Ga0495640_0029777 3300046533 Bacteria 3914
273 Ga0495640_0100043 3300046533 Bacteria 1904
274 Ga0495586_0039966 3300046535 Unclassified 2523
275 Ga0495587_0021121 3300046536 Unclassified 4015
276 Ga0495645_0034343 3300046543 Bacteria 3700
277 Ga0495667_0031495 3300046559 Bacteria 3559
278 Ga0495667_0033896 3300046559 Bacteria 3415
279 Ga0495667_0108079 3300046559 Bacteria 1797
280 Ga0495634_0021287 3300046642 Bacteria 4586
281 Ga0495634_0040951 3300046642 Unclassified 3148
282 Ga0495634_0100202 3300046642 Unclassified 1872
283 Ga0495635_0017999 3300046663 Bacteria 4932
284 Ga0495635_0059719 3300046663 Unclassified 2622
285 Ga0495659_0072349 3300046664 Unclassified 1294
286 Ga0495588_0080693 3300046674 Unclassified 1698
287 Ga0495588_0256398 3300046674 Bacteria 922
288 Ga0495657_0090644 3300046675 Bacteria 1962
289 Ga0495657_0206183 3300046675 Bacteria 1196
290 Ga0495599_0022037 3300046678 Unclassified 3976
291 Ga0495599_0281126 3300046678 Bacteria 1008
292 Ga0495646_0085042 3300046680 Bacteria 1836
293 Ga0495647_0014173 3300046681 Bacteria 2774
294 Ga0495647_0053067 3300046681 Bacteria 1580
295 Ga0495658_0006419 3300046683 Bacteria 5777
296 Ga0495613_0062689 3300046689 Bacteria 2720
297 Ga0495613_0189941 3300046689 Bacteria 1452
298 Ga0495624_0011852 3300046690 Bacteria 5980
299 Ga0495600_0012346 3300046809 Bacteria 5339
300 Ga0495600_0187680 3300046809 Unclassified 1330
301 Ga0495581_0001571 3300047315 Bacteria 12755
302 Ga0495604_0043381 3300047317 Unclassified 3521
303 Ga0495674_0155141 3300047319 Bacteria 1918
304 Ga0495674_0288979 3300047319 Unclassified 1341
305 Ga0495676_0005560 3300047321 Bacteria 11568
306 Ga0495676_0065976 3300047321 Bacteria 2807
307 Ga0495680_0008473 3300047322 Bacteria 9342
308 Ga0495680_0029732 3300047322 Unclassified 4471
309 Ga0495680_0066545 3300047322 Bacteria 2757
310 Ga0495677_0045754 3300047445 Unclassified 1606
311 Ga0495684_0008818 3300047471 Bacteria 7795
312 Ga0495684_0012983 3300047471 Bacteria 6431
313 Ga0495593_0002000 3300047673 Bacteria 12151
314 Ga0495602_0108185 3300048088 Bacteria 2264
315 Ga0495614_0019932 3300048089 Bacteria 2901
316 Ga0496100_0003130 3300048903 Bacteria 8570
317 Ga0496100_0204762 3300048903 Bacteria 1440
318 Ga0496100_0208657 3300048903 Bacteria 1428
319 Ga0496101_0008029 3300048904 Bacteria 6878
320 Ga0496101_0232341 3300048904 Bacteria 1434
321 Ga0496101_0324428 3300048904 Unclassified 1208
322 Ga0496102_0004738 3300048905 Bacteria 11521
323 Ga0496102_0011181 3300048905 Bacteria 7729
324 Ga0496103_0012723 3300048906 Bacteria 4992
325 Ga0496103_0130980 3300048906 Bacteria 1601
326 Ga0496104_0002338 3300048907 Bacteria 16381
327 Ga0496104_0009786 3300048907 Bacteria 8547
328 Ga0496104_0060644 3300048907 Bacteria 3584
329 Ga0496104_0589175 3300048907 Unclassified 1022
330 Ga0496105_0002856 3300048908 Bacteria 12644
331 Ga0496105_0086964 3300048908 Bacteria 2583
332 Ga0496105_0232048 3300048908 Bacteria 1499
333 Ga0496105_0381473 3300048908 Bacteria 1122
334 Ga0496106_0013924 3300048909 Bacteria 5946
335 Ga0496106_0396181 3300048909 Bacteria 1110
336 Ga0496106_0661502 3300048909 Unclassified 834
337 Ga0496107_0002291 3300048910 Bacteria 12358
338 Ga0496107_0033077 3300048910 Bacteria 3699
339 Ga0496107_0166364 3300048910 Bacteria 1635
340 Ga0496108_0013059 3300048911 Bacteria 6769
341 Ga0496108_0072902 3300048911 Bacteria 2899
342 Ga0496109_0005292 3300048912 Bacteria 10782
343 Ga0496109_0019616 3300048912 Bacteria 5965
344 Ga0496109_0139171 3300048912 Bacteria 2269
345 Ga0496109_0834915 3300048912 Bacteria 859
346 Ga0496110_0089848 3300048913 Bacteria 2746
347 Ga0496110_0177106 3300048913 Bacteria 1936
348 Ga0496110_0464692 3300048913 Unclassified 1153
349 Ga0496111_0016503 3300048914 Bacteria 5089
350 Ga0496111_0139861 3300048914 Bacteria 1794
351 Ga0496112_0000205 3300048915 Bacteria 38846
352 Ga0496112_0039139 3300048915 Bacteria 4632
353 Ga0496112_0068797 3300048915 Bacteria 3497
354 Ga0496112_0076246 3300048915 Bacteria 3316
355 Ga0496112_0267911 3300048915 Unclassified 1657
356 Ga0496112_0269363 3300048915 Bacteria 1651
357 Ga0496113_0034984 3300048916 Bacteria 3670
358 Ga0496113_0280149 3300048916 Bacteria 1333
359 Ga0496113_0307077 3300048916 Bacteria 1271
360 Ga0496114_0001209 3300048917 Bacteria 19531
361 Ga0496114_0023544 3300048917 Bacteria 5026
362 Ga0496114_0088533 3300048917 Bacteria 2626
363 Ga0496114_0193446 3300048917 Bacteria 1780
364 Ga0496114_0668677 3300048917 Bacteria 912
365 Ga0496115_0000701 3300048918 Bacteria 24832
366 Ga0496115_0076187 3300048918 Unclassified 2726
367 Ga0501047_0184366 3300049581 Bacteria 1953
368 Ga0501047_0372348 3300049581 Unclassified 1263
369 Ga0501067_0017069 3300049583 Bacteria 4011
370 Ga0501067_0058245 3300049583 Bacteria 2140
371 Ga0501067_0229454 3300049583 Bacteria 1033
372 Ga0501070_0000805 3300049586 Bacteria 28505
373 Ga0501070_0005302 3300049586 Bacteria 10999
374 Ga0501070_0022812 3300049586 Bacteria 5240
375 Ga0501072_0017025 3300049588 Bacteria 5584
376 Ga0501073_0062563 3300049589 Bacteria 2596
377 Ga0501074_0037209 3300049590 Bacteria 3528
378 Ga0501074_0417729 3300049590 Unclassified 951
379 Ga0501079_0054814 3300049741 Bacteria 3075
380 Ga0501080_0151519 3300049742 Bacteria 2143
381 nmdc:mga0yw44_80666_c1 3300050492 Bacteria 2039
382 nmdc:mga05p37_1712_c1 3300050507 Bacteria 25565
383 nmdc:mga06r32_260897_c1 3300050510 Bacteria 1720
384 nmdc:mga08y16_150269_c1 3300050511 Bacteria 2421
385 nmdc:mga0n895_54691_c1 3300050512 Unclassified 3927
386 nmdc:mga0n895_73895_c1 3300050512 Bacteria 3386
387 nmdc:mga0rr50_11516_c1 3300050513 Bacteria 5668
388 nmdc:mga0rr50_139289_c1 3300050513 Unclassified 1950
389 nmdc:mga08x19_13479_c1 3300050514 Bacteria 4944
390 nmdc:mga0a205_29734_c1 3300050515 Bacteria 5229
391 Ga0495601_0080327 3300053077 Bacteria 2092
392 Ga0495612_0126085 3300053078 Bacteria 1104
393 Ga0495595_0010065 3300053084 Unclassified 3923
394 Ga0495619_0002188 3300053085 Bacteria 12946
395 Ga0495619_0007622 3300053085 Bacteria 6852
396 Ga0495619_0016715 3300053085 Bacteria 4643
397 Ga0495619_0046241 3300053085 Bacteria 2861
398 Ga0466962_0061512 3300061719 Unclassified 1792
399 Ga0466962_0105524 3300061719 Bacteria 1354
400 Ga0265318_10033948
401 Ga0070658_10019504
402 Ga0070658_10020765
403 Ga0070658_10021499
404 Ga0070683_100025550
405 Ga0070680_100138197
406 Ga0070680_100163987
407 Ga0070680_100222714
408 Ga0070680_100277384
409 Ga0070660_100285432
410 Ga0070660_100324571
411 Ga0070661_100410249
412 Ga0070669_100541067
413 Ga0070671_100262682
414 Ga0070659_100078428
415 Ga0070659_100261508
416 Ga0070667_100039557
417 Ga0070714_100002635
418 Ga0070714_100025632
419 Ga0070714_100083322
420 Ga0070714_100083477
421 Ga0070714_100159914
422 Ga0070714_100174550
423 Ga0070713_100066710
424 Ga0070713_100190542
425 Ga0070713_100196176
426 Ga0070711_100021887
427 Ga0070711_100150926
428 Ga0070708_100324222
429 Ga0070681_10047349
430 Ga0070681_10064303
431 Ga0070681_10071752
432 Ga0070707_100001744
433 Ga0070707_100004262
434 Ga0070707_100045720
435 Ga0070699_100380798
436 Ga0070699_100544746
437 Ga0070699_100805876
438 Ga0070679_100077686
439 Ga0070679_100091561
440 Ga0070679_100100593
441 Ga0070679_100226357
442 Ga0070684_100066223
443 Ga0070684_100305148
444 Ga0070693_100334667
445 Ga0070704_100152921
446 Ga0068855_100090286
447 Ga0068855_100107615
448 Ga0068857_100455056
449 Ga0081539_10001005
450 Ga0070717_10001101
451 Ga0070717_10001299
452 Ga0070717_10021309
453 Ga0070717_10101369
454 Ga0070717_10631739
455 Ga0070712_100009498
456 Ga0075431_100080515
457 Ga0075433_10028377
458 Ga0075434_100007779
459 Ga0075434_100350909
460 Ga0075436_100003136
461 Ga0075435_100176108
462 Ga0105240_10067450
463 Ga0105240_10181264
464 Ga0111539_10162126
465 Ga0105245_10092431
466 Ga0105245_10322754
467 Ga0105245_10544747
468 Ga0114129_10000141
469 Ga0114129_10084742
470 Ga0105246_10253847
471 Ga0157373_10043627
472 Ga0157373_10089316
473 Ga0157373_10177549
474 Ga0157370_10059261
475 Ga0157369_10002742
476 Ga0157369_10012846
477 Ga0163162_10204841
478 Ga0157372_10563341
479 Ga0157375_10688399
480 Ga0157376_10250004
481 Ga0197907_10252519
482 Ga0197907_11084745
483 Ga0206356_10772932
484 Ga0206354_10544619
485 Ga0206353_11181121
486 Ga0207692_10332462
487 Ga0207705_10162669
488 Ga0207684_10096726
489 Ga0207707_10114331
490 Ga0207707_10164949
491 Ga0207707_10345165
492 Ga0207695_10144984
493 Ga0207693_10009458
494 Ga0207693_10040440
495 Ga0207663_10048610
496 Ga0207663_10329771
497 Ga0207660_10242705
498 Ga0207657_10003179
499 Ga0207657_10003297
500 Ga0207657_10092788
501 Ga0207652_10107085
502 Ga0207652_10212304
503 Ga0207646_10002705
504 Ga0207646_10007376
505 Ga0207646_10008599
506 Ga0207687_10359144
507 Ga0207700_10045366
508 Ga0207664_10003234
509 Ga0207664_10006187
510 Ga0207664_10029158
511 Ga0207664_10039734
512 Ga0207664_10098200
513 Ga0207664_10288099
514 Ga0207664_10717366
515 Ga0207644_10294532
516 Ga0207690_10061240
517 Ga0207661_10035801
518 Ga0207658_10030582
519 Ga0207677_10447146
520 Ga0207702_10061391
521 Ga0207702_10871786
522 Ga0207641_10563552
523 Ga0207683_10199429
524 Ga0265320_10049289
525 Ga0307408_100250277
526 Ga0265314_10146076
527 Ga0307406_10155799
528 Ga0373926_0011738
529 Ga0373944_0007023
530 Ga0373945_0010393
531 Ga0373943_0010108
532 Ga0373946_0002104
533 Ga0373935_0008577
534 Ga0373947_0001399
535 Ga0373925_0005667
536 Ga0395899_0066722
537 Ga0395899_0083735
538 Ga0395900_0001640
539 Ga0395900_0040148
540 Ga0395900_0050601
541 Ga0395900_0052311
542 Ga0395900_0082190
543 Ga0395900_0087236
544 Ga0395900_0116495
545 Ga0395900_0151975
546 Ga0395900_0165816
547 Ga0395900_0447588
548 Ga0395900_0638425
549 Ga0395898_0032374
550 Ga0395898_0066941
551 Ga0395898_0090351
552 Ga0395898_0099744
553 Ga0395898_0133633
554 Ga0395898_0151515
555 Ga0395898_0183261
556 Ga0395898_0201469
557 Ga0395905_0003392
558 Ga0395905_0011155
559 Ga0395905_0075924
560 Ga0395905_0186471
561 Ga0395905_0290417
562 Ga0395905_0340587
563 Ga0395905_0771172
564 Ga0395901_0001841
565 Ga0395901_0026231
566 Ga0395901_0046748
567 Ga0395901_0056146
568 Ga0395901_0077636
569 Ga0395901_0320208
570 Ga0395901_0358798
571 Ga0395901_0469110
572 Ga0395901_0469832
573 Ga0395901_0587192
574 Ga0395901_0652253
575 Ga0439439_0011494
576 Ga0439461_0002244
577 Ga0439466_0033984
578 Ga0439431_0002800
579 Ga0439433_0007421
580 Ga0439449_0020366
581 Ga0439457_010829
582 Ga0439462_0005261
583 Ga0439446_0004570
584 Ga0439446_0038363
585 Ga0439434_0003542
586 Ga0439434_0013555
587 Ga0466969_0081085
588 Ga0466966_0039101
589 Ga0466966_0055020
590 Ga0466961_0078726
591 Ga0466961_0257936
592 Ga0466963_0001916
593 Ga0466963_0002069
594 Ga0466963_0006098
595 Ga0466963_0007925
596 Ga0466963_0008292
597 Ga0466963_0008399
598 Ga0466963_0008414
599 Ga0466963_0009258
600 Ga0466963_0012541
601 Ga0466963_0015202
602 Ga0466963_0050132
603 Ga0466963_0051583
604 Ga0466963_0238090
605 Ga0466963_0252071
606 Ga0466964_0008528
607 Ga0466964_0037664
608 Ga0466964_0039583
609 Ga0466971_0011086
610 Ga0466971_0080351
611 Ga0466968_0005318
612 Ga0466968_0044723
613 Ga0466968_0049728
614 Ga0466968_0201310
615 Ga0466970_0094829
616 Ga0466970_0197211
617 Ga0466957_0029167
618 Ga0466957_0042609
619 Ga0466957_0075023
620 Ga0466957_0080204
621 Ga0466957_0566501
622 Ga0466960_0005414
623 Ga0466959_0006127
624 Ga0466959_0062413
625 Ga0451576_0308757
626 Ga0466958_0001895
627 Ga0466958_0010345
628 Ga0466958_0028725
629 Ga0466958_0148026
630 Ga0466958_0528266
631 Ga0466967_0001257
632 Ga0466967_0002836
633 Ga0466967_0005113
634 Ga0466967_0014830
635 Ga0466967_0020481
636 Ga0466967_0021024
637 Ga0466967_0022188
638 Ga0466967_0028728
639 Ga0466967_0046558
640 Ga0466967_0046764
641 Ga0466967_0063355
642 Ga0466967_0089223
643 Ga0466967_0094284
644 Ga0466967_0162625
645 Ga0466967_0196706
646 Ga0466967_0245330
647 Ga0466967_0444450
648 Ga0495592_0132614
649 Ga0495629_0002051
650 Ga0495629_0045235
651 Ga0495629_0105398
652 Ga0495641_0004707
653 Ga0495641_0095976
654 Ga0495651_0022123
655 Ga0495653_0110807
656 Ga0495582_0000054
657 Ga0495639_0002410
658 Ga0495662_0008561
659 Ga0495664_0040799
660 Ga0495664_0076487
661 Ga0495594_0058486
662 Ga0495608_0048702
663 Ga0495618_0432473
664 Ga0495628_0292770
665 Ga0495630_0091934
666 Ga0495630_0197106
667 Ga0495666_0068326
668 Ga0495652_0205702
669 Ga0495665_0001744
670 Ga0495665_0256742
671 Ga0495640_0029777
672 Ga0495640_0100043
673 Ga0495586_0039966
674 Ga0495587_0021121
675 Ga0495645_0034343
676 Ga0495667_0031495
677 Ga0495667_0033896
678 Ga0495667_0108079
679 Ga0495634_0021287
680 Ga0495634_0040951
681 Ga0495634_0100202
682 Ga0495635_0017999
683 Ga0495635_0059719
684 Ga0495659_0072349
685 Ga0495588_0080693
686 Ga0495588_0256398
687 Ga0495657_0090644
688 Ga0495657_0206183
689 Ga0495599_0022037
690 Ga0495599_0281126
691 Ga0495646_0085042
692 Ga0495647_0014173
693 Ga0495647_0053067
694 Ga0495658_0006419
695 Ga0495613_0062689
696 Ga0495613_0189941
697 Ga0495624_0011852
698 Ga0495600_0012346
699 Ga0495600_0187680
700 Ga0495581_0001571
701 Ga0495604_0043381
702 Ga0495674_0155141
703 Ga0495674_0288979
704 Ga0495676_0005560
705 Ga0495676_0065976
706 Ga0495680_0008473
707 Ga0495680_0029732
708 Ga0495680_0066545
709 Ga0495677_0045754
710 Ga0495684_0008818
711 Ga0495684_0012983
712 Ga0495593_0002000
713 Ga0495602_0108185
714 Ga0495614_0019932
715 Ga0496100_0003130
716 Ga0496100_0204762
717 Ga0496100_0208657
718 Ga0496101_0008029
719 Ga0496101_0232341
720 Ga0496101_0324428
721 Ga0496102_0004738
722 Ga0496102_0011181
723 Ga0496103_0012723
724 Ga0496103_0130980
725 Ga0496104_0002338
726 Ga0496104_0009786
727 Ga0496104_0060644
728 Ga0496104_0589175
729 Ga0496105_0002856
730 Ga0496105_0086964
731 Ga0496105_0232048
732 Ga0496105_0381473
733 Ga0496106_0013924
734 Ga0496106_0396181
735 Ga0496106_0661502
736 Ga0496107_0002291
737 Ga0496107_0033077
738 Ga0496107_0166364
739 Ga0496108_0013059
740 Ga0496108_0072902
741 Ga0496109_0005292
742 Ga0496109_0019616
743 Ga0496109_0139171
744 Ga0496109_0834915
745 Ga0496110_0089848
746 Ga0496110_0177106
747 Ga0496110_0464692
748 Ga0496111_0016503
749 Ga0496111_0139861
750 Ga0496112_0000205
751 Ga0496112_0039139
752 Ga0496112_0068797
753 Ga0496112_0076246
754 Ga0496112_0267911
755 Ga0496112_0269363
756 Ga0496113_0034984
757 Ga0496113_0280149
758 Ga0496113_0307077
759 Ga0496114_0001209
760 Ga0496114_0023544
761 Ga0496114_0088533
762 Ga0496114_0193446
763 Ga0496114_0668677
764 Ga0496115_0000701
765 Ga0496115_0076187
766 Ga0501047_0184366
767 Ga0501047_0372348
768 Ga0501067_0017069
769 Ga0501067_0058245
770 Ga0501067_0229454
771 Ga0501070_0000805
772 Ga0501070_0005302
773 Ga0501070_0022812
774 Ga0501072_0017025
775 Ga0501073_0062563
776 Ga0501074_0037209
777 Ga0501074_0417729
778 Ga0501079_0054814
779 Ga0501080_0151519
780 nmdc:mga0yw44_80666_c1
781 nmdc:mga05p37_1712_c1
782 nmdc:mga06r32_260897_c1
783 nmdc:mga08y16_150269_c1
784 nmdc:mga0n895_54691_c1
785 nmdc:mga0n895_73895_c1
786 nmdc:mga0rr50_11516_c1
787 nmdc:mga0rr50_139289_c1
788 nmdc:mga08x19_13479_c1
789 nmdc:mga0a205_29734_c1
790 Ga0495601_0080327
791 Ga0495612_0126085
792 Ga0495595_0010065
793 Ga0495619_0002188
794 Ga0495619_0007622
795 Ga0495619_0016715
796 Ga0495619_0046241
797 Ga0466962_0061512
798 Ga0466962_0105524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04203

Sortase

Sortase domain

134

255

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cuw-assembly1.cif.gz_A crystal structure of sortase e1 from streptomyces coelicolor with tripeptide in the active site 0.8912 86 221
5utt-assembly4.cif.gz_D srta sortase from actinomyces oris 0.8856 82 218
7cfj-assembly2.cif.gz_B crystal structure of housekeeping sortase srta from lactobacillus rhamnosus gg 0.8788 87 220
4d70-assembly2.cif.gz_B structural, biophysical and biochemical analyses of a clostridium perfringens sortase d5 transpeptidase 0.8665 41 213
5go5-assembly1.cif.gz_A structure of sortase e from streptomyces avermitilis 0.8655 84 221
ID Description Score Start End Superfamily
5cuwA00 Mainly Beta;Beta Barrel;Sortase; Chain: A;;Sortase 0.8912 86 221 2.40.260.10
5uttD00 Mainly Beta;Beta Barrel;Sortase; Chain: A;;Sortase 0.8856 82 218 2.40.260.10
4d70B00 Mainly Beta;Beta Barrel;Sortase; Chain: A;;Sortase 0.8665 41 213 2.40.260.10
5go6A00 Mainly Beta;Beta Barrel;Sortase; Chain: A;;Sortase 0.8623 84 221 2.40.260.10
2ln7A00 Mainly Beta;Beta Barrel;Sortase; Chain: A;;Sortase 0.8462 82 218 2.40.260.10
ID Description Score Start End GO Terms
AF-A0A538G701-F1-model_v4 Class E sortase 0.9826 124 226 GO:0016787
AF-A0A7W1JZQ5-F1-model_v4 Class E sortase 0.9692 82 213 GO:0016787
AF-A0A7W0K5U1-F1-model_v4 Class E sortase 0.9682 87 213 GO:0016787
AF-A0A6J6STP1-F1-model_v4 Unannotated protein 0.9672 87 217 GO:0016787
AF-A0A6J4RIH5-F1-model_v4 Class E sortase 0.9657 82 218 GO:0016787

Map