F434307

General Info

Members Datasets Scaffolds Average Seq Length
399 244 798 209

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10802037|Ga0207664_108020372
Length 193
Sequence MPDANARRPVGNLLGLAVLSYLSQRPLHPYELGRLLQERGDARSIKFNQGTLYAVVGQLVRAGLIAAVETKREGARPERTVYAITAAGREEMRAWLRELVAEPVHEHPRFVAALSLIAALQRDETRKLMDETLAAGVHPLFQVEEEYRLDQLDTEIAFVERFVERIADPVLGWGEMWAQAHREGGDADGELPA

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
242 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
243 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
244 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 7.52
Rhizosphere 91.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10802037 3300025929 Bacteria 847
2 JGI25406J46586_10024085 3300003203 Bacteria 2393
3 JGI25406J46586_10080369 3300003203 Bacteria 1001
4 JGI25407J50210_10007019 3300003373 Bacteria 2818
5 JGI25407J50210_10009906 3300003373 Bacteria 2420
6 JGI25407J50210_10029818 3300003373 Bacteria 1414
7 JGI25407J50210_10031571 3300003373 Bacteria 1371
8 Ga0070658_10003466 3300005327 Bacteria 12965
9 Ga0070658_10778584 3300005327 Bacteria 831
10 Ga0070683_100002360 3300005329 Bacteria 14991
11 Ga0070683_100144490 3300005329 Bacteria 2254
12 Ga0070683_100173489 3300005329 Bacteria 2047
13 Ga0070683_100218676 3300005329 Bacteria 1810
14 Ga0070683_100346975 3300005329 Bacteria 1414
15 Ga0070683_100775215 3300005329 Bacteria 919
16 Ga0068869_100002751 3300005334 Bacteria 10646
17 Ga0068869_100110214 3300005334 Bacteria 2093
18 Ga0070680_100040904 3300005336 Bacteria 3757
19 Ga0070680_100112632 3300005336 Bacteria 2266
20 Ga0070680_100211755 3300005336 Bacteria 1635
21 Ga0070682_100015055 3300005337 Bacteria 4478
22 Ga0070682_100421911 3300005337 Bacteria 1014
23 Ga0068868_100018731 3300005338 Bacteria 5179
24 Ga0068868_100030258 3300005338 Bacteria 4151
25 Ga0070660_100153942 3300005339 Bacteria 1850
26 Ga0070660_100298617 3300005339 Bacteria 1320
27 Ga0070661_100009280 3300005344 Bacteria 6803
28 Ga0070661_100051849 3300005344 Bacteria 3003
29 Ga0070692_10004582 3300005345 Bacteria 5788
30 Ga0070668_100161024 3300005347 Bacteria 1821
31 Ga0070669_100110973 3300005353 Bacteria 2081
32 Ga0070675_100001828 3300005354 Bacteria 15744
33 Ga0070675_100290440 3300005354 Bacteria 1439
34 Ga0070673_100618533 3300005364 Bacteria 989
35 Ga0070659_100017344 3300005366 Bacteria 5415
36 Ga0070659_100287967 3300005366 Bacteria 1367
37 Ga0070709_10013681 3300005434 Bacteria 4568
38 Ga0070709_10056034 3300005434 Bacteria 2491
39 Ga0070709_10441220 3300005434 Bacteria 979
40 Ga0070714_100008032 3300005435 Bacteria 8226
41 Ga0070714_100039081 3300005435 Bacteria 3993
42 Ga0070714_100348593 3300005435 Bacteria 1390
43 Ga0070713_100031021 3300005436 Bacteria 4252
44 Ga0070713_100053761 3300005436 Bacteria 3338
45 Ga0070710_10002685 3300005437 Bacteria 8454
46 Ga0070710_10053648 3300005437 Bacteria 2272
47 Ga0070700_100002167 3300005441 Bacteria 9962
48 Ga0070694_100548864 3300005444 Bacteria 925
49 Ga0070708_100153798 3300005445 Bacteria 2140
50 Ga0070663_100015592 3300005455 Bacteria 4911
51 Ga0070663_100167054 3300005455 Bacteria 1698
52 Ga0070678_100011755 3300005456 Bacteria 5414
53 Ga0070662_100196238 3300005457 Bacteria 1599
54 Ga0070681_10058053 3300005458 Bacteria 3850
55 Ga0070681_10188427 3300005458 Bacteria 1983
56 Ga0070681_10251686 3300005458 Bacteria 1679
57 Ga0068867_100093341 3300005459 Bacteria 2287
58 Ga0070706_100008709 3300005467 Bacteria 9458
59 Ga0070706_100018596 3300005467 Bacteria 6407
60 Ga0070706_100101607 3300005467 Bacteria 2672
61 Ga0070698_100080888 3300005471 Bacteria 3243
62 Ga0070698_100283544 3300005471 Bacteria 1588
63 Ga0070679_100058746 3300005530 Bacteria 3833
64 Ga0070684_100008536 3300005535 Bacteria 8017
65 Ga0070684_100086546 3300005535 Bacteria 2781
66 Ga0070684_100424168 3300005535 Bacteria 1228
67 Ga0070696_100091062 3300005546 Bacteria 2171
68 Ga0070665_100138448 3300005548 Bacteria 2437
69 Ga0070665_101230741 3300005548 Bacteria 759
70 Ga0068855_100238260 3300005563 Bacteria 2034
71 Ga0068855_100498116 3300005563 Bacteria 1324
72 Ga0070664_100042887 3300005564 Bacteria 3817
73 Ga0070664_100077465 3300005564 Bacteria 2858
74 Ga0068857_100233745 3300005577 Bacteria 1682
75 Ga0068854_100379025 3300005578 Bacteria 1165
76 Ga0068856_100034735 3300005614 Bacteria 4939
77 Ga0068856_100126387 3300005614 Bacteria 2560
78 Ga0070702_100017942 3300005615 Bacteria 3661
79 Ga0068852_100587127 3300005616 Bacteria 1117
80 Ga0068859_100000054 3300005617 Bacteria 123173
81 Ga0068864_100082924 3300005618 Bacteria 2814
82 Ga0068863_100049749 3300005841 Bacteria 3974
83 Ga0068858_100073427 3300005842 Bacteria 3175
84 Ga0068858_100198180 3300005842 Bacteria 1898
85 Ga0068862_100000037 3300005844 Bacteria 172796
86 Ga0068862_100020487 3300005844 Bacteria 5524
87 Ga0081538_10001024 3300005981 Bacteria 29834
88 Ga0081538_10001406 3300005981 Bacteria 24724
89 Ga0081538_10005039 3300005981 Bacteria 12023
90 Ga0081538_10005567 3300005981 Bacteria 11304
91 Ga0081538_10008986 3300005981 Bacteria 8395
92 Ga0081538_10019043 3300005981 Bacteria 5124
93 Ga0081538_10047099 3300005981 Bacteria 2648
94 Ga0081540_1001532 3300005983 Bacteria 19840
95 Ga0081540_1006497 3300005983 Bacteria 8498
96 Ga0081539_10001393 3300005985 Bacteria 41656
97 Ga0070717_10002201 3300006028 Bacteria 13706
98 Ga0070717_10010096 3300006028 Bacteria 7110
99 Ga0070717_10155410 3300006028 Bacteria 1981
100 Ga0070715_10009438 3300006163 Bacteria 3439
101 Ga0070715_10014780 3300006163 Bacteria 2898
102 Ga0070716_100001735 3300006173 Bacteria 9833
103 Ga0070716_100031779 3300006173 Bacteria 2874
104 Ga0070712_100100501 3300006175 Bacteria 2137
105 Ga0070712_100367897 3300006175 Bacteria 1181
106 Ga0068871_100028335 3300006358 Bacteria 4390
107 Ga0075428_100244801 3300006844 Bacteria 1934
108 Ga0075430_100152652 3300006846 Bacteria 1923
109 Ga0075430_100164091 3300006846 Bacteria 1849
110 Ga0075433_10039522 3300006852 Bacteria 4080
111 Ga0075434_100004335 3300006871 Bacteria 12759
112 Ga0075434_100311718 3300006871 Bacteria 1594
113 Ga0075436_100011251 3300006914 Bacteria 6137
114 Ga0075436_100015413 3300006914 Bacteria 5234
115 Ga0097620_100000054 3300006931 Bacteria 123173
116 Ga0075435_100007623 3300007076 Bacteria 7727
117 Ga0105251_10078068 3300009011 Bacteria 1534
118 Ga0111539_10414680 3300009094 Bacteria 1568
119 Ga0105245_10003598 3300009098 Bacteria 13832
120 Ga0105245_10036439 3300009098 Bacteria 4369
121 Ga0105247_10018461 3300009101 Bacteria 4183
122 Ga0114129_10096233 3300009147 Bacteria 4099
123 Ga0114129_10268902 3300009147 Bacteria 2281
124 Ga0105243_10217823 3300009148 Bacteria 1685
125 Ga0105248_10057558 3300009177 Bacteria 4364
126 Ga0105248_10068480 3300009177 Bacteria 3984
127 Ga0105248_10089540 3300009177 Bacteria 3464
128 Ga0105237_10078574 3300009545 Bacteria 3289
129 Ga0105237_10315629 3300009545 Bacteria 1566
130 Ga0105237_10648446 3300009545 Bacteria 1062
131 Ga0105238_10181747 3300009551 Bacteria 2080
132 Ga0105249_10032215 3300009553 Bacteria 4741
133 Ga0105239_10061549 3300010375 Bacteria 4120
134 Ga0105239_10313651 3300010375 Bacteria 1768
135 Ga0105246_10022874 3300011119 Bacteria 4039
136 Ga0157373_10100752 3300013100 Bacteria 2033
137 Ga0157370_10176182 3300013104 Bacteria 1988
138 Ga0157370_10183252 3300013104 Bacteria 1945
139 Ga0157369_10063090 3300013105 Bacteria 3993
140 Ga0157369_10154990 3300013105 Bacteria 2420
141 Ga0157374_10078149 3300013296 Bacteria 3133
142 Ga0157374_11154618 3300013296 Bacteria 795
143 Ga0157378_10046807 3300013297 Bacteria 3844
144 Ga0163162_10195789 3300013306 Bacteria 2150
145 Ga0163162_10269960 3300013306 Bacteria 1833
146 Ga0157372_10131304 3300013307 Bacteria 2882
147 Ga0157375_10245263 3300013308 Bacteria 1951
148 Ga0163163_10108097 3300014325 Bacteria 2808
149 Ga0157380_11334149 3300014326 Bacteria 766
150 Ga0157377_10060405 3300014745 Bacteria 2164
151 Ga0157379_10061398 3300014968 Bacteria 3361
152 Ga0157376_10098629 3300014969 Bacteria 2547
153 Ga0206354_10793260 3300020081 Bacteria 1912
154 Ga0206354_11715082 3300020081 Bacteria 851
155 Ga0206353_10163467 3300020082 Bacteria 1434
156 Ga0206353_11983337 3300020082 Bacteria 1449
157 Ga0207692_10026221 3300025898 Bacteria 2732
158 Ga0207692_10028493 3300025898 Bacteria 2642
159 Ga0207680_10092956 3300025903 Bacteria 1923
160 Ga0207685_10034019 3300025905 Bacteria 1848
161 Ga0207699_10008843 3300025906 Bacteria 4989
162 Ga0207699_10042085 3300025906 Bacteria 2643
163 Ga0207705_10063943 3300025909 Bacteria 2659
164 Ga0207684_10007497 3300025910 Bacteria 9820
165 Ga0207684_10022041 3300025910 Bacteria 5440
166 Ga0207684_10209766 3300025910 Bacteria 1680
167 Ga0207671_10258592 3300025914 Bacteria 1370
168 Ga0207671_10337225 3300025914 Bacteria 1194
169 Ga0207693_10038186 3300025915 Bacteria 3782
170 Ga0207693_10114247 3300025915 Bacteria 2119
171 Ga0207663_10008941 3300025916 Bacteria 5269
172 Ga0207663_10231153 3300025916 Bacteria 1351
173 Ga0207660_10096871 3300025917 Bacteria 2197
174 Ga0207657_10198835 3300025919 Bacteria 1614
175 Ga0207657_10211746 3300025919 Bacteria 1555
176 Ga0207649_10024798 3300025920 Bacteria 3490
177 Ga0207649_10153431 3300025920 Bacteria 1589
178 Ga0207652_10042953 3300025921 Bacteria 3849
179 Ga0207652_10193952 3300025921 Bacteria 1827
180 Ga0207681_10072425 3300025923 Bacteria 2407
181 Ga0207694_10635974 3300025924 Bacteria 898
182 Ga0207659_10255474 3300025926 Bacteria 1423
183 Ga0207659_10857870 3300025926 Bacteria 781
184 Ga0207687_10055857 3300025927 Bacteria 2768
185 Ga0207700_10094942 3300025928 Bacteria 2364
186 Ga0207700_10485276 3300025928 Bacteria 1092
187 Ga0207664_10001767 3300025929 Bacteria 14246
188 Ga0207664_10010435 3300025929 Bacteria 6558
189 Ga0207664_10034833 3300025929 Bacteria 3880
190 Ga0207644_10312253 3300025931 Bacteria 1269
191 Ga0207690_10147642 3300025932 Bacteria 1740
192 Ga0207690_10244621 3300025932 Bacteria 1383
193 Ga0207690_10324993 3300025932 Bacteria 1210
194 Ga0207706_10221819 3300025933 Bacteria 1655
195 Ga0207665_10014360 3300025939 Bacteria 5214
196 Ga0207665_10062687 3300025939 Bacteria 2523
197 Ga0207711_10032856 3300025941 Bacteria 4389
198 Ga0207711_10050453 3300025941 Bacteria 3562
199 Ga0207711_10129780 3300025941 Bacteria 2259
200 Ga0207689_10007228 3300025942 Bacteria 9751
201 Ga0207661_10082093 3300025944 Bacteria 2664
202 Ga0207661_10092979 3300025944 Bacteria 2515
203 Ga0207661_10315537 3300025944 Bacteria 1404
204 Ga0207679_10075190 3300025945 Bacteria 2562
205 Ga0207679_10095865 3300025945 Bacteria 2307
206 Ga0207679_10253443 3300025945 Bacteria 1497
207 Ga0207667_10429157 3300025949 Bacteria 1344
208 Ga0207667_10584630 3300025949 Bacteria 1127
209 Ga0207667_10702838 3300025949 Bacteria 1013
210 Ga0207712_10006145 3300025961 Bacteria 7571
211 Ga0207668_10324277 3300025972 Bacteria 1279
212 Ga0207640_10138940 3300025981 Bacteria 1768
213 Ga0207658_10463317 3300025986 Bacteria 1124
214 Ga0207677_10020826 3300026023 Bacteria 3993
215 Ga0207677_10098768 3300026023 Bacteria 2142
216 Ga0207677_10339769 3300026023 Bacteria 1254
217 Ga0207703_10053784 3300026035 Bacteria 3272
218 Ga0207703_10072560 3300026035 Bacteria 2846
219 Ga0207678_10012480 3300026067 Bacteria 7461
220 Ga0207678_10166412 3300026067 Bacteria 1883
221 Ga0207678_10315016 3300026067 Bacteria 1345
222 Ga0207708_10003994 3300026075 Bacteria 10852
223 Ga0207702_10035104 3300026078 Bacteria 4193
224 Ga0207702_10071517 3300026078 Bacteria 2987
225 Ga0207648_10121273 3300026089 Bacteria 2299
226 Ga0207676_10059002 3300026095 Bacteria 3029
227 Ga0207674_10093706 3300026116 Bacteria 2991
228 Ga0207675_100101298 3300026118 Bacteria 2714
229 Ga0207683_10018171 3300026121 Bacteria 5997
230 Ga0207428_10008448 3300027907 Bacteria 9296
231 Ga0268266_10156452 3300028379 Bacteria 2059
232 Ga0268265_10000008 3300028380 Bacteria 417328
233 Ga0268265_10065558 3300028380 Bacteria 2803
234 Ga0307513_10160572 3300031456 Bacteria 2141
235 Ga0307406_10569157 3300031901 Bacteria 930
236 Ga0307406_10748897 3300031901 Bacteria 820
237 Ga0307415_100360105 3300032126 Bacteria 1228
238 Ga0307415_100619057 3300032126 Bacteria 966
239 Ga0307507_10000998 3300033179 Bacteria 62959
240 Ga0373958_0037666 3300034819 Bacteria 977
241 Ga0373934_0084131 3300035086 Bacteria 1279
242 Ga0373949_0051590 3300035090 Bacteria 1038
243 Ga0373923_0047057 3300035111 Bacteria 1796
244 Ga0373936_0007903 3300035113 Bacteria 3995
245 Ga0373936_0126127 3300035113 Bacteria 1097
246 Ga0373941_0032749 3300035115 Bacteria 1558
247 Ga0373945_0031781 3300035116 Bacteria 1867
248 Ga0373953_0044574 3300035117 Bacteria 1773
249 Ga0373954_0162058 3300035118 Bacteria 1094
250 Ga0373956_0105150 3300035119 Bacteria 1311
251 Ga0373957_0000762 3300035120 Bacteria 8357
252 Ga0373943_0116059 3300035170 Bacteria 1418
253 Ga0373924_0016148 3300035410 Bacteria 2848
254 Ga0373931_0290681 3300035691 Bacteria 1006
255 Ga0373935_0011620 3300035692 Bacteria 5289
256 Ga0373935_0079277 3300035692 Bacteria 2131
257 Ga0373935_0207761 3300035692 Bacteria 1356
258 Ga0373927_0077433 3300035695 Bacteria 2154
259 Ga0373927_0245583 3300035695 Bacteria 1177
260 Ga0373927_0498432 3300035695 Bacteria 805
261 Ga0373933_0225599 3300035724 Bacteria 1203
262 Ga0373947_0146497 3300035725 Bacteria 1518
263 Ga0373947_0533263 3300035725 Bacteria 799
264 Ga0373925_0114915 3300037068 Bacteria 2083
265 Ga0373925_0122050 3300037068 Bacteria 2023
266 Ga0373925_0147137 3300037068 Bacteria 1847
267 Ga0395900_0009985 3300037418 Bacteria 9716
268 Ga0395900_0142448 3300037418 Bacteria 2454
269 Ga0395900_0386889 3300037418 Bacteria 1366
270 Ga0395900_0794304 3300037418 Bacteria 875
271 Ga0395898_0389377 3300037466 Bacteria 1329
272 Ga0395901_0488380 3300038443 Bacteria 1255
273 Ga0439460_0147385 3300042461 Bacteria 784
274 Ga0466963_0199319 3300044694 Bacteria 1400
275 Ga0466967_0137045 3300045976 Bacteria 2277
276 Ga0466967_1069540 3300045976 Bacteria 804
277 Ga0495592_0133397 3300046454 Bacteria 1734
278 Ga0495603_0105659 3300046455 Bacteria 1643
279 Ga0495629_0020748 3300046459 Bacteria 4690
280 Ga0495629_0040025 3300046459 Bacteria 3297
281 Ga0495641_0057293 3300046461 Bacteria 1765
282 Ga0495651_0290043 3300046462 Bacteria 1101
283 Ga0495653_0054075 3300046463 Bacteria 3069
284 Ga0495653_0416741 3300046463 Bacteria 850
285 Ga0495580_0109664 3300046472 Bacteria 1916
286 Ga0495580_0609415 3300046472 Bacteria 721
287 Ga0495582_0038890 3300046473 Bacteria 2618
288 Ga0495582_0260642 3300046473 Bacteria 994
289 Ga0495639_0038569 3300046475 Bacteria 2146
290 Ga0495662_0012414 3300046476 Bacteria 4157
291 Ga0495662_0149192 3300046476 Bacteria 1151
292 Ga0495664_0018000 3300046477 Bacteria 4041
293 Ga0495664_0077414 3300046477 Bacteria 1991
294 Ga0495584_0232128 3300046491 Bacteria 938
295 Ga0495608_0040658 3300046511 Bacteria 3114
296 Ga0495618_0041153 3300046514 Bacteria 2909
297 Ga0495628_0046544 3300046516 Bacteria 3444
298 Ga0495628_0565232 3300046516 Bacteria 815
299 Ga0495630_0044628 3300046517 Bacteria 3312
300 Ga0495630_0079616 3300046517 Bacteria 2471
301 Ga0495630_0186239 3300046517 Bacteria 1584
302 Ga0495652_0088792 3300046529 Bacteria 2532
303 Ga0495665_0012874 3300046531 Bacteria 4527
304 Ga0495665_0131030 3300046531 Bacteria 1312
305 Ga0495640_0011651 3300046533 Bacteria 6751
306 Ga0495640_0036808 3300046533 Bacteria 3455
307 Ga0495586_0141482 3300046535 Bacteria 1350
308 Ga0495587_0146855 3300046536 Bacteria 1344
309 Ga0495645_0042767 3300046543 Bacteria 3303
310 Ga0495645_0045481 3300046543 Bacteria 3203
311 Ga0495645_0135319 3300046543 Bacteria 1724
312 Ga0495645_0291040 3300046543 Bacteria 1071
313 Ga0495667_0149742 3300046559 Bacteria 1502
314 Ga0495634_0012444 3300046642 Bacteria 6156
315 Ga0495634_0111282 3300046642 Bacteria 1760
316 Ga0495635_0038886 3300046663 Bacteria 3293
317 Ga0495635_0043339 3300046663 Bacteria 3105
318 Ga0495599_0009315 3300046678 Bacteria 5997
319 Ga0495623_0017490 3300046679 Bacteria 4632
320 Ga0495646_0107494 3300046680 Bacteria 1591
321 Ga0495647_0023608 3300046681 Bacteria 2231
322 Ga0495658_0015412 3300046683 Bacteria 3920
323 Ga0495658_0027786 3300046683 Bacteria 3048
324 Ga0495624_0117852 3300046690 Bacteria 1631
325 Ga0495600_0063319 3300046809 Bacteria 2416
326 Ga0495600_0369241 3300046809 Bacteria 896
327 Ga0495581_0017512 3300047315 Bacteria 4162
328 Ga0495581_0028317 3300047315 Bacteria 3247
329 Ga0495604_0085805 3300047317 Bacteria 2348
330 Ga0495674_0046678 3300047319 Bacteria 3844
331 Ga0495674_0048079 3300047319 Bacteria 3777
332 Ga0495676_0172103 3300047321 Bacteria 1523
333 Ga0495680_0021726 3300047322 Bacteria 5366
334 Ga0495680_0127639 3300047322 Bacteria 1871
335 Ga0495680_0319214 3300047322 Bacteria 1087
336 Ga0495680_0439157 3300047322 Bacteria 895
337 Ga0495675_0010139 3300047444 Bacteria 5876
338 Ga0495684_0034352 3300047471 Bacteria 3890
339 Ga0495684_0486955 3300047471 Bacteria 850
340 Ga0495593_0009160 3300047673 Bacteria 5740
341 Ga0495593_0009169 3300047673 Bacteria 5736
342 Ga0495602_0159823 3300048088 Bacteria 1760
343 Ga0495614_0021848 3300048089 Bacteria 2763
344 Ga0496100_0059984 3300048903 Bacteria 2502
345 Ga0496100_0244471 3300048903 Bacteria 1325
346 Ga0496101_0255375 3300048904 Bacteria 1366
347 Ga0496102_0051128 3300048905 Bacteria 3765
348 Ga0496102_0075427 3300048905 Bacteria 3100
349 Ga0496103_0085860 3300048906 Bacteria 1983
350 Ga0496104_0005830 3300048907 Bacteria 10790
351 Ga0496104_0131369 3300048907 Bacteria 2405
352 Ga0496105_0005881 3300048908 Bacteria 9354
353 Ga0496105_0078431 3300048908 Bacteria 2727
354 Ga0496106_0030605 3300048909 Bacteria 4012
355 Ga0496106_0068490 3300048909 Bacteria 2707
356 Ga0496107_0046018 3300048910 Bacteria 3140
357 Ga0496107_0156262 3300048910 Bacteria 1689
358 Ga0496108_0011334 3300048911 Bacteria 7245
359 Ga0496108_0085749 3300048911 Bacteria 2673
360 Ga0496109_0054609 3300048912 Bacteria 3644
361 Ga0496109_0117793 3300048912 Bacteria 2472
362 Ga0496109_0400775 3300048912 Bacteria 1296
363 Ga0496110_0113794 3300048913 Bacteria 2434
364 Ga0496111_0118135 3300048914 Bacteria 1957
365 Ga0496112_0041993 3300048915 Bacteria 4474
366 Ga0496112_0236708 3300048915 Bacteria 1779
367 Ga0496112_0571431 3300048915 Bacteria 1063
368 Ga0496113_0090710 3300048916 Bacteria 2354
369 Ga0496113_0138676 3300048916 Bacteria 1912
370 Ga0496113_0174375 3300048916 Bacteria 1704
371 Ga0496114_0434910 3300048917 Bacteria 1162
372 Ga0496115_0120306 3300048918 Bacteria 2160
373 Ga0496115_0126802 3300048918 Bacteria 2103
374 Ga0496126_0560465 3300048929 Bacteria 905
375 Ga0501031_0192210 3300049568 Bacteria 1333
376 Ga0501032_0062948 3300049569 Bacteria 2485
377 Ga0501038_0218745 3300049574 Bacteria 1520
378 Ga0501039_0080413 3300049575 Bacteria 2536
379 Ga0501048_0179728 3300049582 Bacteria 1500
380 Ga0501080_0233689 3300049742 Bacteria 1680
381 Ga0501044_0017225 3300049823 Bacteria 7749
382 nmdc:mga05p37_329726_c1 3300050507 Bacteria 1803
383 nmdc:mga05p37_4754_c1 3300050507 Bacteria 15871
384 nmdc:mga0qj67_486872_c1 3300050509 Bacteria 992
385 nmdc:mga08y16_278595_c1 3300050511 Bacteria 1725
386 nmdc:mga0n895_17507_c1 3300050512 Bacteria 6606
387 nmdc:mga0n895_287010_c1 3300050512 Bacteria 1668
388 nmdc:mga0rr50_3729_c1 3300050513 Bacteria 8827
389 nmdc:mga08x19_290590_c1 3300050514 Bacteria 1134
390 nmdc:mga0a205_104152_c1 3300050515 Bacteria 2736
391 Ga0495601_0064311 3300053077 Bacteria 2332
392 Ga0495612_0052699 3300053078 Bacteria 1674
393 Ga0495595_0002768 3300053084 Bacteria 6892
394 Ga0495619_0066558 3300053085 Bacteria 2404
395 Ga0500588_0001135 3300053146 Bacteria 4883
396 Ga0500633_0216323 3300053160 Bacteria 716
397 2515856937 2515154155 Bacteria 7985436
398 2676475033 2675903058 Bacteria 6822861
399 2827630797 2827628540 Bacteria 6858585
400 Ga0207664_10802037
401 JGI25406J46586_10024085
402 JGI25406J46586_10080369
403 JGI25407J50210_10007019
404 JGI25407J50210_10009906
405 JGI25407J50210_10029818
406 JGI25407J50210_10031571
407 Ga0070658_10003466
408 Ga0070658_10778584
409 Ga0070683_100002360
410 Ga0070683_100144490
411 Ga0070683_100173489
412 Ga0070683_100218676
413 Ga0070683_100346975
414 Ga0070683_100775215
415 Ga0068869_100002751
416 Ga0068869_100110214
417 Ga0070680_100040904
418 Ga0070680_100112632
419 Ga0070680_100211755
420 Ga0070682_100015055
421 Ga0070682_100421911
422 Ga0068868_100018731
423 Ga0068868_100030258
424 Ga0070660_100153942
425 Ga0070660_100298617
426 Ga0070661_100009280
427 Ga0070661_100051849
428 Ga0070692_10004582
429 Ga0070668_100161024
430 Ga0070669_100110973
431 Ga0070675_100001828
432 Ga0070675_100290440
433 Ga0070673_100618533
434 Ga0070659_100017344
435 Ga0070659_100287967
436 Ga0070709_10013681
437 Ga0070709_10056034
438 Ga0070709_10441220
439 Ga0070714_100008032
440 Ga0070714_100039081
441 Ga0070714_100348593
442 Ga0070713_100031021
443 Ga0070713_100053761
444 Ga0070710_10002685
445 Ga0070710_10053648
446 Ga0070700_100002167
447 Ga0070694_100548864
448 Ga0070708_100153798
449 Ga0070663_100015592
450 Ga0070663_100167054
451 Ga0070678_100011755
452 Ga0070662_100196238
453 Ga0070681_10058053
454 Ga0070681_10188427
455 Ga0070681_10251686
456 Ga0068867_100093341
457 Ga0070706_100008709
458 Ga0070706_100018596
459 Ga0070706_100101607
460 Ga0070698_100080888
461 Ga0070698_100283544
462 Ga0070679_100058746
463 Ga0070684_100008536
464 Ga0070684_100086546
465 Ga0070684_100424168
466 Ga0070696_100091062
467 Ga0070665_100138448
468 Ga0070665_101230741
469 Ga0068855_100238260
470 Ga0068855_100498116
471 Ga0070664_100042887
472 Ga0070664_100077465
473 Ga0068857_100233745
474 Ga0068854_100379025
475 Ga0068856_100034735
476 Ga0068856_100126387
477 Ga0070702_100017942
478 Ga0068852_100587127
479 Ga0068859_100000054
480 Ga0068864_100082924
481 Ga0068863_100049749
482 Ga0068858_100073427
483 Ga0068858_100198180
484 Ga0068862_100000037
485 Ga0068862_100020487
486 Ga0081538_10001024
487 Ga0081538_10001406
488 Ga0081538_10005039
489 Ga0081538_10005567
490 Ga0081538_10008986
491 Ga0081538_10019043
492 Ga0081538_10047099
493 Ga0081540_1001532
494 Ga0081540_1006497
495 Ga0081539_10001393
496 Ga0070717_10002201
497 Ga0070717_10010096
498 Ga0070717_10155410
499 Ga0070715_10009438
500 Ga0070715_10014780
501 Ga0070716_100001735
502 Ga0070716_100031779
503 Ga0070712_100100501
504 Ga0070712_100367897
505 Ga0068871_100028335
506 Ga0075428_100244801
507 Ga0075430_100152652
508 Ga0075430_100164091
509 Ga0075433_10039522
510 Ga0075434_100004335
511 Ga0075434_100311718
512 Ga0075436_100011251
513 Ga0075436_100015413
514 Ga0097620_100000054
515 Ga0075435_100007623
516 Ga0105251_10078068
517 Ga0111539_10414680
518 Ga0105245_10003598
519 Ga0105245_10036439
520 Ga0105247_10018461
521 Ga0114129_10096233
522 Ga0114129_10268902
523 Ga0105243_10217823
524 Ga0105248_10057558
525 Ga0105248_10068480
526 Ga0105248_10089540
527 Ga0105237_10078574
528 Ga0105237_10315629
529 Ga0105237_10648446
530 Ga0105238_10181747
531 Ga0105249_10032215
532 Ga0105239_10061549
533 Ga0105239_10313651
534 Ga0105246_10022874
535 Ga0157373_10100752
536 Ga0157370_10176182
537 Ga0157370_10183252
538 Ga0157369_10063090
539 Ga0157369_10154990
540 Ga0157374_10078149
541 Ga0157374_11154618
542 Ga0157378_10046807
543 Ga0163162_10195789
544 Ga0163162_10269960
545 Ga0157372_10131304
546 Ga0157375_10245263
547 Ga0163163_10108097
548 Ga0157380_11334149
549 Ga0157377_10060405
550 Ga0157379_10061398
551 Ga0157376_10098629
552 Ga0206354_10793260
553 Ga0206354_11715082
554 Ga0206353_10163467
555 Ga0206353_11983337
556 Ga0207692_10026221
557 Ga0207692_10028493
558 Ga0207680_10092956
559 Ga0207685_10034019
560 Ga0207699_10008843
561 Ga0207699_10042085
562 Ga0207705_10063943
563 Ga0207684_10007497
564 Ga0207684_10022041
565 Ga0207684_10209766
566 Ga0207671_10258592
567 Ga0207671_10337225
568 Ga0207693_10038186
569 Ga0207693_10114247
570 Ga0207663_10008941
571 Ga0207663_10231153
572 Ga0207660_10096871
573 Ga0207657_10198835
574 Ga0207657_10211746
575 Ga0207649_10024798
576 Ga0207649_10153431
577 Ga0207652_10042953
578 Ga0207652_10193952
579 Ga0207681_10072425
580 Ga0207694_10635974
581 Ga0207659_10255474
582 Ga0207659_10857870
583 Ga0207687_10055857
584 Ga0207700_10094942
585 Ga0207700_10485276
586 Ga0207664_10001767
587 Ga0207664_10010435
588 Ga0207664_10034833
589 Ga0207644_10312253
590 Ga0207690_10147642
591 Ga0207690_10244621
592 Ga0207690_10324993
593 Ga0207706_10221819
594 Ga0207665_10014360
595 Ga0207665_10062687
596 Ga0207711_10032856
597 Ga0207711_10050453
598 Ga0207711_10129780
599 Ga0207689_10007228
600 Ga0207661_10082093
601 Ga0207661_10092979
602 Ga0207661_10315537
603 Ga0207679_10075190
604 Ga0207679_10095865
605 Ga0207679_10253443
606 Ga0207667_10429157
607 Ga0207667_10584630
608 Ga0207667_10702838
609 Ga0207712_10006145
610 Ga0207668_10324277
611 Ga0207640_10138940
612 Ga0207658_10463317
613 Ga0207677_10020826
614 Ga0207677_10098768
615 Ga0207677_10339769
616 Ga0207703_10053784
617 Ga0207703_10072560
618 Ga0207678_10012480
619 Ga0207678_10166412
620 Ga0207678_10315016
621 Ga0207708_10003994
622 Ga0207702_10035104
623 Ga0207702_10071517
624 Ga0207648_10121273
625 Ga0207676_10059002
626 Ga0207674_10093706
627 Ga0207675_100101298
628 Ga0207683_10018171
629 Ga0207428_10008448
630 Ga0268266_10156452
631 Ga0268265_10000008
632 Ga0268265_10065558
633 Ga0307513_10160572
634 Ga0307406_10569157
635 Ga0307406_10748897
636 Ga0307415_100360105
637 Ga0307415_100619057
638 Ga0307507_10000998
639 Ga0373958_0037666
640 Ga0373934_0084131
641 Ga0373949_0051590
642 Ga0373923_0047057
643 Ga0373936_0007903
644 Ga0373936_0126127
645 Ga0373941_0032749
646 Ga0373945_0031781
647 Ga0373953_0044574
648 Ga0373954_0162058
649 Ga0373956_0105150
650 Ga0373957_0000762
651 Ga0373943_0116059
652 Ga0373924_0016148
653 Ga0373931_0290681
654 Ga0373935_0011620
655 Ga0373935_0079277
656 Ga0373935_0207761
657 Ga0373927_0077433
658 Ga0373927_0245583
659 Ga0373927_0498432
660 Ga0373933_0225599
661 Ga0373947_0146497
662 Ga0373947_0533263
663 Ga0373925_0114915
664 Ga0373925_0122050
665 Ga0373925_0147137
666 Ga0395900_0009985
667 Ga0395900_0142448
668 Ga0395900_0386889
669 Ga0395900_0794304
670 Ga0395898_0389377
671 Ga0395901_0488380
672 Ga0439460_0147385
673 Ga0466963_0199319
674 Ga0466967_0137045
675 Ga0466967_1069540
676 Ga0495592_0133397
677 Ga0495603_0105659
678 Ga0495629_0020748
679 Ga0495629_0040025
680 Ga0495641_0057293
681 Ga0495651_0290043
682 Ga0495653_0054075
683 Ga0495653_0416741
684 Ga0495580_0109664
685 Ga0495580_0609415
686 Ga0495582_0038890
687 Ga0495582_0260642
688 Ga0495639_0038569
689 Ga0495662_0012414
690 Ga0495662_0149192
691 Ga0495664_0018000
692 Ga0495664_0077414
693 Ga0495584_0232128
694 Ga0495608_0040658
695 Ga0495618_0041153
696 Ga0495628_0046544
697 Ga0495628_0565232
698 Ga0495630_0044628
699 Ga0495630_0079616
700 Ga0495630_0186239
701 Ga0495652_0088792
702 Ga0495665_0012874
703 Ga0495665_0131030
704 Ga0495640_0011651
705 Ga0495640_0036808
706 Ga0495586_0141482
707 Ga0495587_0146855
708 Ga0495645_0042767
709 Ga0495645_0045481
710 Ga0495645_0135319
711 Ga0495645_0291040
712 Ga0495667_0149742
713 Ga0495634_0012444
714 Ga0495634_0111282
715 Ga0495635_0038886
716 Ga0495635_0043339
717 Ga0495599_0009315
718 Ga0495623_0017490
719 Ga0495646_0107494
720 Ga0495647_0023608
721 Ga0495658_0015412
722 Ga0495658_0027786
723 Ga0495624_0117852
724 Ga0495600_0063319
725 Ga0495600_0369241
726 Ga0495581_0017512
727 Ga0495581_0028317
728 Ga0495604_0085805
729 Ga0495674_0046678
730 Ga0495674_0048079
731 Ga0495676_0172103
732 Ga0495680_0021726
733 Ga0495680_0127639
734 Ga0495680_0319214
735 Ga0495680_0439157
736 Ga0495675_0010139
737 Ga0495684_0034352
738 Ga0495684_0486955
739 Ga0495593_0009160
740 Ga0495593_0009169
741 Ga0495602_0159823
742 Ga0495614_0021848
743 Ga0496100_0059984
744 Ga0496100_0244471
745 Ga0496101_0255375
746 Ga0496102_0051128
747 Ga0496102_0075427
748 Ga0496103_0085860
749 Ga0496104_0005830
750 Ga0496104_0131369
751 Ga0496105_0005881
752 Ga0496105_0078431
753 Ga0496106_0030605
754 Ga0496106_0068490
755 Ga0496107_0046018
756 Ga0496107_0156262
757 Ga0496108_0011334
758 Ga0496108_0085749
759 Ga0496109_0054609
760 Ga0496109_0117793
761 Ga0496109_0400775
762 Ga0496110_0113794
763 Ga0496111_0118135
764 Ga0496112_0041993
765 Ga0496112_0236708
766 Ga0496112_0571431
767 Ga0496113_0090710
768 Ga0496113_0138676
769 Ga0496113_0174375
770 Ga0496114_0434910
771 Ga0496115_0120306
772 Ga0496115_0126802
773 Ga0496126_0560465
774 Ga0501031_0192210
775 Ga0501032_0062948
776 Ga0501038_0218745
777 Ga0501039_0080413
778 Ga0501048_0179728
779 Ga0501080_0233689
780 Ga0501044_0017225
781 nmdc:mga05p37_329726_c1
782 nmdc:mga05p37_4754_c1
783 nmdc:mga0qj67_486872_c1
784 nmdc:mga08y16_278595_c1
785 nmdc:mga0n895_17507_c1
786 nmdc:mga0n895_287010_c1
787 nmdc:mga0rr50_3729_c1
788 nmdc:mga08x19_290590_c1
789 nmdc:mga0a205_104152_c1
790 Ga0495601_0064311
791 Ga0495612_0052699
792 Ga0495595_0002768
793 Ga0495619_0066558
794 Ga0500588_0001135
795 Ga0500633_0216323
796 2515856937
797 2676475033
798 2827630797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

18

94

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ejo-assembly1.cif.gz_A-2 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9237 11 95
8cws-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9207 126 176
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9057 10 97
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9013 11 95
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8862 10 97
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8985 10 96 1.10.10.10
af_Q69ZQ2_38_95_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8969 123 178 1.10.287.660
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8884 11 102 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8816 10 98 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8767 6 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A661UUA2-F1-model_v4 PadR family transcriptional regulator 0.9362 8 178
AF-A0A7X9PCC3-F1-model_v4 PadR family transcriptional regulator 0.9359 8 102
AF-A0A3D2WWC1-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9312 8 179
AF-A0A535Z3J4-F1-model_v4 PadR family transcriptional regulator 0.931 4 85
AF-A0A6N7I2G7-F1-model_v4 PadR family transcriptional regulator 0.9253 1 192

Map