F434122

General Info

Members Datasets Scaffolds Average Seq Length
398 154 796 487

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0062354|Ga0466970_0062354_14_1561
Length 515
Sequence MSKRKWTGRALSLALCSAALAGCHYSNQSSNQAQSTNASAENPQVEWTSDTEKQLREAIANAPANGLKPELFLKGGEKGAALTDAAVRYASALANGYADPAKLHEVYTIPHPVVDVRSGLQQAIQKGDVKGWLDSLAPQTDEYRALSQAHLHFLQLASKGQFQPVPDGKPIKPGSHDPRMPQVVAALQALGYLNAPAPQQNGQTAQPQQADPPARSNSYSSNLIAAVKKLQGDYGFKQDGIIGGNTLDALNAGPGYRARELAVAMERLRWLPRNPPATRIDVNTAASFLDYWRDGQHVDHRKVVEGEADKPTPQLQAPIVRLVAHPTWTVPKGIGVKELADKSPQWLQDNGFVLKGDQYVQLSGPKNSLGLVKFDMDDKEAIYMHDTPAKALFGLDDRHRSHGCVRVENAIQFATALAQQEGVLDQFQEAMQKGGGXXAQAGDQSSIPGDDETFIKLPDPIPVRLLYQTAFWDGSNVQFRQDVYGWDDNVAKALGLEPGPPQKIEQPESSDEIAP

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.29
Rhizosphere 91.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0062354 3300044765 Bacteria 1998
2 JGI24741J21665_1001922 3300001915 Bacteria 5613
3 JGI24740J21852_10003288 3300001979 Bacteria 7125
4 JGI24739J22299_10003753 3300001989 Bacteria 5800
5 JGI24739J22299_10017645 3300001989 Bacteria 2572
6 JGI24735J21928_10004091 3300002067 Bacteria 4923
7 JGI24744J21845_10000090 3300002077 Bacteria 11904
8 Ga0070658_10022280 3300005327 Bacteria 5083
9 Ga0070658_10057589 3300005327 Bacteria 3161
10 Ga0070658_10094308 3300005327 Bacteria 2469
11 Ga0070658_10148059 3300005327 Bacteria 1964
12 Ga0070676_10044362 3300005328 Bacteria 2587
13 Ga0070683_100013205 3300005329 Bacteria 7194
14 Ga0070683_100050020 3300005329 Bacteria 3867
15 Ga0070683_100146428 3300005329 Bacteria 2238
16 Ga0070683_100157598 3300005329 Bacteria 2153
17 Ga0070690_100020699 3300005330 Bacteria 4009
18 Ga0070690_100022585 3300005330 Bacteria 3850
19 Ga0070670_100000918 3300005331 Bacteria 23133
20 Ga0070670_100027633 3300005331 Bacteria 4880
21 Ga0070666_10001386 3300005335 Bacteria 14676
22 Ga0070666_10037405 3300005335 Bacteria 3226
23 Ga0070680_100001799 3300005336 Bacteria 15731
24 Ga0070680_100075356 3300005336 Bacteria 2777
25 Ga0070682_100008303 3300005337 Bacteria 5853
26 Ga0070682_100024978 3300005337 Bacteria 3562
27 Ga0070682_100034368 3300005337 Bacteria 3087
28 Ga0068868_100002677 3300005338 Bacteria 12353
29 Ga0070660_100004058 3300005339 Bacteria 10100
30 Ga0070660_100018647 3300005339 Bacteria 5074
31 Ga0070660_100040168 3300005339 Bacteria 3559
32 Ga0070660_100050396 3300005339 Bacteria 3203
33 Ga0070660_100069926 3300005339 Bacteria 2738
34 Ga0070660_100105227 3300005339 Bacteria 2239
35 Ga0070661_100012207 3300005344 Bacteria 6006
36 Ga0070661_100032582 3300005344 Bacteria 3772
37 Ga0070661_100054765 3300005344 Bacteria 2921
38 Ga0070661_100067468 3300005344 Bacteria 2629
39 Ga0070669_100040297 3300005353 Bacteria 3395
40 Ga0070675_100022628 3300005354 Bacteria 5022
41 Ga0070675_100035357 3300005354 Bacteria 4059
42 Ga0070671_100000676 3300005355 Bacteria 24424
43 Ga0070671_100011461 3300005355 Bacteria 7127
44 Ga0070674_100002444 3300005356 Bacteria 10282
45 Ga0070674_100024280 3300005356 Bacteria 3933
46 Ga0070674_100040428 3300005356 Bacteria 3155
47 Ga0070673_100007280 3300005364 Bacteria 7287
48 Ga0070673_100022144 3300005364 Bacteria 4621
49 Ga0070673_100050742 3300005364 Bacteria 3245
50 Ga0070673_100053916 3300005364 Bacteria 3161
51 Ga0070673_100061312 3300005364 Bacteria 2984
52 Ga0070659_100006414 3300005366 Bacteria 8494
53 Ga0070659_100030689 3300005366 Bacteria 4160
54 Ga0070659_100195576 3300005366 Bacteria 1663
55 Ga0070667_100001936 3300005367 Bacteria 18367
56 Ga0070667_100002625 3300005367 Bacteria 15568
57 Ga0070709_10052660 3300005434 Bacteria 2559
58 Ga0070714_100068388 3300005435 Bacteria 3064
59 Ga0070713_100013915 3300005436 Bacteria 5957
60 Ga0070663_100006363 3300005455 Bacteria 7095
61 Ga0070663_100030138 3300005455 Bacteria 3714
62 Ga0070663_100035531 3300005455 Bacteria 3458
63 Ga0070663_100096268 3300005455 Bacteria 2201
64 Ga0070678_100029287 3300005456 Bacteria 3768
65 Ga0070678_100053234 3300005456 Bacteria 2942
66 Ga0070678_100066558 3300005456 Bacteria 2678
67 Ga0070662_100001676 3300005457 Bacteria 13628
68 Ga0070662_100013520 3300005457 Bacteria 5431
69 Ga0070662_100021719 3300005457 Bacteria 4386
70 Ga0070681_10024711 3300005458 Bacteria 6044
71 Ga0070681_10060360 3300005458 Bacteria 3769
72 Ga0070681_10094170 3300005458 Bacteria 2944
73 Ga0070681_10163446 3300005458 Bacteria 2150
74 Ga0068867_100027711 3300005459 Bacteria 4075
75 Ga0068867_100105268 3300005459 Bacteria 2160
76 Ga0070679_100008239 3300005530 Bacteria 9802
77 Ga0070679_100098526 3300005530 Bacteria 2911
78 Ga0070679_100127470 3300005530 Bacteria 2527
79 Ga0070679_100149171 3300005530 Bacteria 2316
80 Ga0070679_100168670 3300005530 Bacteria 2162
81 Ga0070684_100011869 3300005535 Bacteria 6955
82 Ga0068853_100035020 3300005539 Bacteria 4263
83 Ga0068853_100049980 3300005539 Bacteria 3596
84 Ga0068853_100073943 3300005539 Bacteria 2973
85 Ga0068853_100074924 3300005539 Bacteria 2953
86 Ga0068853_100081064 3300005539 Bacteria 2841
87 Ga0070672_100042465 3300005543 Bacteria 3501
88 Ga0070672_100065451 3300005543 Bacteria 2875
89 Ga0070696_100010236 3300005546 Bacteria 6277
90 Ga0070693_100055534 3300005547 Bacteria 2282
91 Ga0070665_100004041 3300005548 Bacteria 15429
92 Ga0070665_100005201 3300005548 Bacteria 13459
93 Ga0070665_100079830 3300005548 Bacteria 3277
94 Ga0068855_100041269 3300005563 Bacteria 5470
95 Ga0068855_100045097 3300005563 Bacteria 5215
96 Ga0068855_100053993 3300005563 Bacteria 4726
97 Ga0068855_100067761 3300005563 Bacteria 4157
98 Ga0068855_100090999 3300005563 Bacteria 3519
99 Ga0068855_100204432 3300005563 Bacteria 2222
100 Ga0070664_100001697 3300005564 Bacteria 17648
101 Ga0070664_100004230 3300005564 Bacteria 11545
102 Ga0070664_100023068 3300005564 Bacteria 5136
103 Ga0070664_100052114 3300005564 Bacteria 3465
104 Ga0070664_100072312 3300005564 Bacteria 2957
105 Ga0070664_100101777 3300005564 Bacteria 2499
106 Ga0068857_100016435 3300005577 Bacteria 6483
107 Ga0068857_100027210 3300005577 Bacteria 5043
108 Ga0068857_100032120 3300005577 Bacteria 4641
109 Ga0068854_100009925 3300005578 Bacteria 6160
110 Ga0068854_100067507 3300005578 Bacteria 2605
111 Ga0068856_100011496 3300005614 Bacteria 8593
112 Ga0068856_100033303 3300005614 Bacteria 5044
113 Ga0068856_100070586 3300005614 Bacteria 3456
114 Ga0068852_100017079 3300005616 Bacteria 5684
115 Ga0068852_100030136 3300005616 Bacteria 4463
116 Ga0068852_100031965 3300005616 Bacteria 4352
117 Ga0068852_100041131 3300005616 Bacteria 3904
118 Ga0068852_100060445 3300005616 Bacteria 3289
119 Ga0068852_100061981 3300005616 Bacteria 3251
120 Ga0068852_100268311 3300005616 Bacteria 1641
121 Ga0068859_100218522 3300005617 Bacteria 1993
122 Ga0068864_100030728 3300005618 Bacteria 4554
123 Ga0068864_100032798 3300005618 Bacteria 4414
124 Ga0068866_10015164 3300005718 Bacteria 3420
125 Ga0068861_100022347 3300005719 Bacteria 4555
126 Ga0068861_100027632 3300005719 Bacteria 4135
127 Ga0068851_10079854 3300005834 Bacteria 1707
128 Ga0068863_100002226 3300005841 Bacteria 19245
129 Ga0068863_100033902 3300005841 Bacteria 4864
130 Ga0068863_100045974 3300005841 Bacteria 4143
131 Ga0068858_100005291 3300005842 Bacteria 12652
132 Ga0068858_100015784 3300005842 Bacteria 7104
133 Ga0068858_100095926 3300005842 Bacteria 2763
134 Ga0068860_100027779 3300005843 Bacteria 5449
135 Ga0068860_100078558 3300005843 Bacteria 3138
136 Ga0097621_100133453 3300006237 Bacteria 2115
137 Ga0097620_100218493 3300006931 Bacteria 1993
138 Ga0105240_10258447 3300009093 Bacteria 2010
139 Ga0105240_10293173 3300009093 Bacteria 1864
140 Ga0105245_10061906 3300009098 Bacteria 3375
141 Ga0105243_10026337 3300009148 Bacteria 4451
142 Ga0105248_10000442 3300009177 Bacteria 47089
143 Ga0105248_10007604 3300009177 Bacteria 11903
144 Ga0105248_10010047 3300009177 Bacteria 10424
145 Ga0105248_10010751 3300009177 Bacteria 10102
146 Ga0105237_10078137 3300009545 Bacteria 3299
147 Ga0105238_10072099 3300009551 Bacteria 3451
148 Ga0105238_10107535 3300009551 Bacteria 2770
149 Ga0105239_10210965 3300010375 Bacteria 2177
150 Ga0105246_10071568 3300011119 Bacteria 2442
151 Ga0157373_10013218 3300013100 Bacteria 6061
152 Ga0157373_10040084 3300013100 Bacteria 3352
153 Ga0157373_10043223 3300013100 Bacteria 3219
154 Ga0157373_10092163 3300013100 Bacteria 2134
155 Ga0157371_10006234 3300013102 Bacteria 9885
156 Ga0157371_10017116 3300013102 Bacteria 5393
157 Ga0157371_10043540 3300013102 Bacteria 3198
158 Ga0157371_10045416 3300013102 Bacteria 3126
159 Ga0157371_10080986 3300013102 Bacteria 2299
160 Ga0157370_10028591 3300013104 Bacteria 5481
161 Ga0157370_10073870 3300013104 Bacteria 3217
162 Ga0157370_10082374 3300013104 Bacteria 3026
163 Ga0157369_10026426 3300013105 Bacteria 6438
164 Ga0157369_10055722 3300013105 Bacteria 4267
165 Ga0157369_10087884 3300013105 Bacteria 3318
166 Ga0157369_10196307 3300013105 Bacteria 2119
167 Ga0157374_10004192 3300013296 Bacteria 12111
168 Ga0157374_10027645 3300013296 Bacteria 5121
169 Ga0157374_10068276 3300013296 Bacteria 3344
170 Ga0157378_10039928 3300013297 Bacteria 4162
171 Ga0157378_10086067 3300013297 Bacteria 2849
172 Ga0157378_10153892 3300013297 Bacteria 2144
173 Ga0157378_10270510 3300013297 Bacteria 1634
174 Ga0163162_10000908 3300013306 Bacteria 27533
175 Ga0157372_10058279 3300013307 Bacteria 4317
176 Ga0157372_10210370 3300013307 Bacteria 2254
177 Ga0157375_10006897 3300013308 Bacteria 9910
178 Ga0157375_10012692 3300013308 Bacteria 7479
179 Ga0163163_10134756 3300014325 Bacteria 2510
180 Ga0157379_10160781 3300014968 Bacteria 2027
181 Ga0213876_10009447 3300021384 Bacteria 5249
182 Ga0207697_10004216 3300025315 Bacteria 6908
183 Ga0207682_10011974 3300025893 Bacteria 3387
184 Ga0207680_10014096 3300025903 Bacteria 4124
185 Ga0207647_10005210 3300025904 Bacteria 9567
186 Ga0207647_10008782 3300025904 Bacteria 7213
187 Ga0207647_10038690 3300025904 Bacteria 3015
188 Ga0207647_10044797 3300025904 Bacteria 2763
189 Ga0207645_10022873 3300025907 Bacteria 4063
190 Ga0207643_10053046 3300025908 Bacteria 2303
191 Ga0207705_10001873 3300025909 Bacteria 16506
192 Ga0207705_10010950 3300025909 Bacteria 6585
193 Ga0207705_10015385 3300025909 Bacteria 5489
194 Ga0207705_10025371 3300025909 Bacteria 4232
195 Ga0207705_10037882 3300025909 Bacteria 3450
196 Ga0207705_10088878 3300025909 Bacteria 2260
197 Ga0207705_10111710 3300025909 Bacteria 2020
198 Ga0207707_10014621 3300025912 Bacteria 6838
199 Ga0207707_10071676 3300025912 Bacteria 3020
200 Ga0207695_10003427 3300025913 Bacteria 22376
201 Ga0207695_10155503 3300025913 Bacteria 2222
202 Ga0207671_10040986 3300025914 Bacteria 3427
203 Ga0207660_10001238 3300025917 Bacteria 17092
204 Ga0207660_10010433 3300025917 Bacteria 6031
205 Ga0207660_10046998 3300025917 Bacteria 3049
206 Ga0207657_10003154 3300025919 Bacteria 17626
207 Ga0207657_10004321 3300025919 Bacteria 15058
208 Ga0207657_10004489 3300025919 Bacteria 14750
209 Ga0207657_10009468 3300025919 Bacteria 9786
210 Ga0207657_10015690 3300025919 Bacteria 7327
211 Ga0207657_10016856 3300025919 Bacteria 7031
212 Ga0207657_10029165 3300025919 Bacteria 5027
213 Ga0207657_10037325 3300025919 Bacteria 4340
214 Ga0207657_10037648 3300025919 Bacteria 4316
215 Ga0207657_10057992 3300025919 Bacteria 3334
216 Ga0207649_10026356 3300025920 Bacteria 3400
217 Ga0207649_10029524 3300025920 Bacteria 3238
218 Ga0207649_10054232 3300025920 Bacteria 2494
219 Ga0207652_10002668 3300025921 Bacteria 14968
220 Ga0207652_10012448 3300025921 Bacteria 6875
221 Ga0207652_10026126 3300025921 Bacteria 4860
222 Ga0207652_10031763 3300025921 Bacteria 4435
223 Ga0207652_10090810 3300025921 Bacteria 2684
224 Ga0207694_10028223 3300025924 Bacteria 4278
225 Ga0207650_10002564 3300025925 Bacteria 12586
226 Ga0207659_10116040 3300025926 Bacteria 2043
227 Ga0207664_10013063 3300025929 Bacteria 5952
228 Ga0207664_10019267 3300025929 Bacteria 5040
229 Ga0207644_10001341 3300025931 Bacteria 15808
230 Ga0207644_10008244 3300025931 Bacteria 6826
231 Ga0207644_10009584 3300025931 Bacteria 6358
232 Ga0207644_10014599 3300025931 Bacteria 5259
233 Ga0207644_10092512 3300025931 Bacteria 2256
234 Ga0207690_10008270 3300025932 Bacteria 6171
235 Ga0207690_10019919 3300025932 Bacteria 4136
236 Ga0207690_10024896 3300025932 Bacteria 3752
237 Ga0207706_10006433 3300025933 Bacteria 10909
238 Ga0207706_10007350 3300025933 Bacteria 10184
239 Ga0207706_10009037 3300025933 Bacteria 9169
240 Ga0207706_10013743 3300025933 Bacteria 7347
241 Ga0207706_10020718 3300025933 Bacteria 5907
242 Ga0207706_10095307 3300025933 Bacteria 2618
243 Ga0207669_10016244 3300025937 Bacteria 3777
244 Ga0207691_10004927 3300025940 Bacteria 12883
245 Ga0207691_10015275 3300025940 Bacteria 7305
246 Ga0207691_10145256 3300025940 Bacteria 2088
247 Ga0207711_10000372 3300025941 Bacteria 47656
248 Ga0207711_10010605 3300025941 Bacteria 7663
249 Ga0207711_10015440 3300025941 Bacteria 6338
250 Ga0207711_10025269 3300025941 Bacteria 4983
251 Ga0207711_10075832 3300025941 Bacteria 2927
252 Ga0207661_10056408 3300025944 Bacteria 3153
253 Ga0207679_10016038 3300025945 Bacteria 4966
254 Ga0207679_10020445 3300025945 Bacteria 4467
255 Ga0207679_10024863 3300025945 Bacteria 4111
256 Ga0207679_10054387 3300025945 Bacteria 2947
257 Ga0207667_10024706 3300025949 Bacteria 6591
258 Ga0207667_10049860 3300025949 Bacteria 4419
259 Ga0207667_10067318 3300025949 Bacteria 3731
260 Ga0207667_10075901 3300025949 Bacteria 3489
261 Ga0207667_10081139 3300025949 Bacteria 3360
262 Ga0207667_10127845 3300025949 Bacteria 2617
263 Ga0207667_10153233 3300025949 Bacteria 2372
264 Ga0207651_10019246 3300025960 Bacteria 4085
265 Ga0207651_10098708 3300025960 Bacteria 2160
266 Ga0207640_10032066 3300025981 Bacteria 3255
267 Ga0207640_10033312 3300025981 Bacteria 3204
268 Ga0207658_10001383 3300025986 Bacteria 18942
269 Ga0207658_10003993 3300025986 Bacteria 10333
270 Ga0207658_10058601 3300025986 Bacteria 2866
271 Ga0207677_10003123 3300026023 Bacteria 8741
272 Ga0207677_10032965 3300026023 Bacteria 3335
273 Ga0207703_10000774 3300026035 Bacteria 31453
274 Ga0207703_10003333 3300026035 Bacteria 13485
275 Ga0207703_10007253 3300026035 Bacteria 8815
276 Ga0207639_10027862 3300026041 Bacteria 4119
277 Ga0207639_10036406 3300026041 Bacteria 3647
278 Ga0207639_10044881 3300026041 Bacteria 3326
279 Ga0207639_10103773 3300026041 Bacteria 2304
280 Ga0207678_10000961 3300026067 Bacteria 26351
281 Ga0207678_10001639 3300026067 Bacteria 20519
282 Ga0207678_10011057 3300026067 Bacteria 7929
283 Ga0207678_10016563 3300026067 Bacteria 6472
284 Ga0207678_10020183 3300026067 Bacteria 5850
285 Ga0207678_10026156 3300026067 Bacteria 5092
286 Ga0207678_10035701 3300026067 Bacteria 4328
287 Ga0207678_10041752 3300026067 Bacteria 3976
288 Ga0207678_10144365 3300026067 Bacteria 2031
289 Ga0207702_10024422 3300026078 Bacteria 5015
290 Ga0207702_10026936 3300026078 Bacteria 4774
291 Ga0207641_10002963 3300026088 Bacteria 15358
292 Ga0207641_10040725 3300026088 Bacteria 3891
293 Ga0207641_10109192 3300026088 Bacteria 2450
294 Ga0207648_10002161 3300026089 Bacteria 21368
295 Ga0207648_10039478 3300026089 Bacteria 4150
296 Ga0207648_10051110 3300026089 Bacteria 3613
297 Ga0207676_10008127 3300026095 Bacteria 7458
298 Ga0207676_10011644 3300026095 Bacteria 6289
299 Ga0207676_10022134 3300026095 Bacteria 4673
300 Ga0207674_10003514 3300026116 Bacteria 19141
301 Ga0207674_10010227 3300026116 Bacteria 10658
302 Ga0207674_10020677 3300026116 Bacteria 7103
303 Ga0207674_10097831 3300026116 Bacteria 2918
304 Ga0207674_10104691 3300026116 Bacteria 2808
305 Ga0207675_100099337 3300026118 Bacteria 2741
306 Ga0207683_10002064 3300026121 Bacteria 17765
307 Ga0207683_10004910 3300026121 Bacteria 11502
308 Ga0207698_10006152 3300026142 Bacteria 7472
309 Ga0207698_10016809 3300026142 Bacteria 4944
310 Ga0207698_10021203 3300026142 Bacteria 4488
311 Ga0207698_10024980 3300026142 Bacteria 4200
312 Ga0207698_10055402 3300026142 Bacteria 3056
313 Ga0207698_10112124 3300026142 Bacteria 2288
314 Ga0207698_10165940 3300026142 Bacteria 1938
315 Ga0268266_10007027 3300028379 Bacteria 10218
316 Ga0268266_10095344 3300028379 Bacteria 2613
317 Ga0268264_10059972 3300028381 Bacteria 3189
318 Ga0373944_0014469 3300035089 Bacteria 2202
319 Ga0373943_0018939 3300035170 Bacteria 3165
320 Ga0373935_0001587 3300035692 Bacteria 12668
321 Ga0373927_0023769 3300035695 Bacteria 4012
322 Ga0373925_0006023 3300037068 Bacteria 8975
323 Ga0395899_0009774 3300037312 Bacteria 7360
324 Ga0395899_0053027 3300037312 Bacteria 3004
325 Ga0395899_0059876 3300037312 Bacteria 2807
326 Ga0395899_0084592 3300037312 Bacteria 2306
327 Ga0395900_0005499 3300037418 Bacteria 13260
328 Ga0395900_0040471 3300037418 Bacteria 4803
329 Ga0395900_0044196 3300037418 Bacteria 4591
330 Ga0395900_0064993 3300037418 Bacteria 3747
331 Ga0395900_0068886 3300037418 Bacteria 3636
332 Ga0395900_0070547 3300037418 Bacteria 3592
333 Ga0395900_0072961 3300037418 Bacteria 3528
334 Ga0395900_0120645 3300037418 Bacteria 2690
335 Ga0395900_0234846 3300037418 Bacteria 1842
336 Ga0395898_0011647 3300037466 Bacteria 9123
337 Ga0395898_0055417 3300037466 Bacteria 3866
338 Ga0395898_0062570 3300037466 Bacteria 3614
339 Ga0395898_0122561 3300037466 Bacteria 2491
340 Ga0395898_0175255 3300037466 Bacteria 2050
341 Ga0395905_0015344 3300037471 Bacteria 7282
342 Ga0395905_0057188 3300037471 Bacteria 3648
343 Ga0395905_0100787 3300037471 Bacteria 2712
344 Ga0395905_0164189 3300037471 Bacteria 2087
345 Ga0395905_0249365 3300037471 Bacteria 1658
346 Ga0436364_0560527 3300037853 Bacteria 17622
347 Ga0395901_0000203 3300038443 Bacteria 74605
348 Ga0395901_0010109 3300038443 Bacteria 9559
349 Ga0395901_0012342 3300038443 Bacteria 8667
350 Ga0395901_0043430 3300038443 Bacteria 4662
351 Ga0395901_0048466 3300038443 Bacteria 4412
352 Ga0395901_0104372 3300038443 Bacteria 2975
353 Ga0436365_1666025 3300039437 Bacteria 5097
354 Ga0466966_0009118 3300044684 Bacteria 6570
355 Ga0466963_0008776 3300044694 Bacteria 6071
356 Ga0466963_0082244 3300044694 Bacteria 2182
357 Ga0466970_0038485 3300044765 Bacteria 2537
358 Ga0466957_0019390 3300044842 Bacteria 4000
359 Ga0466957_0022149 3300044842 Bacteria 3746
360 Ga0466960_0010336 3300044901 Bacteria 3873
361 Ga0466959_0043409 3300045049 Bacteria 3314
362 Ga0466958_0036334 3300045836 Bacteria 2948
363 Ga0466967_0003913 3300045976 Bacteria 9887
364 Ga0466967_0061398 3300045976 Bacteria 3334
365 Ga0466967_0126642 3300045976 Bacteria 2366
366 Ga0495669_0001406 3300046684 Bacteria 9900
367 Ga0495669_0053266 3300046684 Bacteria 1819
368 Ga0495670_0029668 3300046691 Bacteria 2716
369 Ga0496100_0066406 3300048903 Bacteria 2392
370 Ga0496101_0009761 3300048904 Bacteria 6319
371 Ga0496101_0034659 3300048904 Bacteria 3567
372 Ga0496102_0033905 3300048905 Bacteria 4591
373 Ga0496104_0083566 3300048907 Bacteria 3045
374 Ga0496106_0022404 3300048909 Bacteria 4692
375 Ga0496106_0023263 3300048909 Bacteria 4603
376 Ga0496106_0085140 3300048909 Bacteria 2434
377 Ga0496107_0001208 3300048910 Bacteria 15733
378 Ga0496107_0003676 3300048910 Bacteria 10310
379 Ga0496107_0025970 3300048910 Bacteria 4151
380 Ga0496108_0000578 3300048911 Bacteria 28619
381 Ga0496108_0003798 3300048911 Bacteria 12091
382 Ga0496109_0000926 3300048912 Bacteria 24417
383 Ga0496109_0014626 3300048912 Bacteria 6828
384 Ga0496109_0017695 3300048912 Bacteria 6251
385 Ga0496110_0002565 3300048913 Bacteria 13655
386 Ga0496110_0014653 3300048913 Bacteria 6516
387 Ga0496110_0017630 3300048913 Bacteria 5969
388 Ga0496111_0000678 3300048914 Bacteria 17911
389 Ga0496111_0003354 3300048914 Bacteria 9901
390 Ga0496111_0012972 3300048914 Bacteria 5657
391 Ga0496112_0001077 3300048915 Bacteria 20194
392 Ga0496112_0015336 3300048915 Bacteria 7146
393 Ga0496113_0007217 3300048916 Bacteria 7123
394 Ga0496113_0007523 3300048916 Bacteria 7019
395 Ga0496113_0016009 3300048916 Bacteria 5172
396 Ga0496114_0000006 3300048917 Bacteria 472921
397 Ga0496114_0004678 3300048917 Bacteria 10643
398 Ga0466962_0007281 3300061719 Bacteria 5305
399 Ga0466970_0062354
400 JGI24741J21665_1001922
401 JGI24740J21852_10003288
402 JGI24739J22299_10003753
403 JGI24739J22299_10017645
404 JGI24735J21928_10004091
405 JGI24744J21845_10000090
406 Ga0070658_10022280
407 Ga0070658_10057589
408 Ga0070658_10094308
409 Ga0070658_10148059
410 Ga0070676_10044362
411 Ga0070683_100013205
412 Ga0070683_100050020
413 Ga0070683_100146428
414 Ga0070683_100157598
415 Ga0070690_100020699
416 Ga0070690_100022585
417 Ga0070670_100000918
418 Ga0070670_100027633
419 Ga0070666_10001386
420 Ga0070666_10037405
421 Ga0070680_100001799
422 Ga0070680_100075356
423 Ga0070682_100008303
424 Ga0070682_100024978
425 Ga0070682_100034368
426 Ga0068868_100002677
427 Ga0070660_100004058
428 Ga0070660_100018647
429 Ga0070660_100040168
430 Ga0070660_100050396
431 Ga0070660_100069926
432 Ga0070660_100105227
433 Ga0070661_100012207
434 Ga0070661_100032582
435 Ga0070661_100054765
436 Ga0070661_100067468
437 Ga0070669_100040297
438 Ga0070675_100022628
439 Ga0070675_100035357
440 Ga0070671_100000676
441 Ga0070671_100011461
442 Ga0070674_100002444
443 Ga0070674_100024280
444 Ga0070674_100040428
445 Ga0070673_100007280
446 Ga0070673_100022144
447 Ga0070673_100050742
448 Ga0070673_100053916
449 Ga0070673_100061312
450 Ga0070659_100006414
451 Ga0070659_100030689
452 Ga0070659_100195576
453 Ga0070667_100001936
454 Ga0070667_100002625
455 Ga0070709_10052660
456 Ga0070714_100068388
457 Ga0070713_100013915
458 Ga0070663_100006363
459 Ga0070663_100030138
460 Ga0070663_100035531
461 Ga0070663_100096268
462 Ga0070678_100029287
463 Ga0070678_100053234
464 Ga0070678_100066558
465 Ga0070662_100001676
466 Ga0070662_100013520
467 Ga0070662_100021719
468 Ga0070681_10024711
469 Ga0070681_10060360
470 Ga0070681_10094170
471 Ga0070681_10163446
472 Ga0068867_100027711
473 Ga0068867_100105268
474 Ga0070679_100008239
475 Ga0070679_100098526
476 Ga0070679_100127470
477 Ga0070679_100149171
478 Ga0070679_100168670
479 Ga0070684_100011869
480 Ga0068853_100035020
481 Ga0068853_100049980
482 Ga0068853_100073943
483 Ga0068853_100074924
484 Ga0068853_100081064
485 Ga0070672_100042465
486 Ga0070672_100065451
487 Ga0070696_100010236
488 Ga0070693_100055534
489 Ga0070665_100004041
490 Ga0070665_100005201
491 Ga0070665_100079830
492 Ga0068855_100041269
493 Ga0068855_100045097
494 Ga0068855_100053993
495 Ga0068855_100067761
496 Ga0068855_100090999
497 Ga0068855_100204432
498 Ga0070664_100001697
499 Ga0070664_100004230
500 Ga0070664_100023068
501 Ga0070664_100052114
502 Ga0070664_100072312
503 Ga0070664_100101777
504 Ga0068857_100016435
505 Ga0068857_100027210
506 Ga0068857_100032120
507 Ga0068854_100009925
508 Ga0068854_100067507
509 Ga0068856_100011496
510 Ga0068856_100033303
511 Ga0068856_100070586
512 Ga0068852_100017079
513 Ga0068852_100030136
514 Ga0068852_100031965
515 Ga0068852_100041131
516 Ga0068852_100060445
517 Ga0068852_100061981
518 Ga0068852_100268311
519 Ga0068859_100218522
520 Ga0068864_100030728
521 Ga0068864_100032798
522 Ga0068866_10015164
523 Ga0068861_100022347
524 Ga0068861_100027632
525 Ga0068851_10079854
526 Ga0068863_100002226
527 Ga0068863_100033902
528 Ga0068863_100045974
529 Ga0068858_100005291
530 Ga0068858_100015784
531 Ga0068858_100095926
532 Ga0068860_100027779
533 Ga0068860_100078558
534 Ga0097621_100133453
535 Ga0097620_100218493
536 Ga0105240_10258447
537 Ga0105240_10293173
538 Ga0105245_10061906
539 Ga0105243_10026337
540 Ga0105248_10000442
541 Ga0105248_10007604
542 Ga0105248_10010047
543 Ga0105248_10010751
544 Ga0105237_10078137
545 Ga0105238_10072099
546 Ga0105238_10107535
547 Ga0105239_10210965
548 Ga0105246_10071568
549 Ga0157373_10013218
550 Ga0157373_10040084
551 Ga0157373_10043223
552 Ga0157373_10092163
553 Ga0157371_10006234
554 Ga0157371_10017116
555 Ga0157371_10043540
556 Ga0157371_10045416
557 Ga0157371_10080986
558 Ga0157370_10028591
559 Ga0157370_10073870
560 Ga0157370_10082374
561 Ga0157369_10026426
562 Ga0157369_10055722
563 Ga0157369_10087884
564 Ga0157369_10196307
565 Ga0157374_10004192
566 Ga0157374_10027645
567 Ga0157374_10068276
568 Ga0157378_10039928
569 Ga0157378_10086067
570 Ga0157378_10153892
571 Ga0157378_10270510
572 Ga0163162_10000908
573 Ga0157372_10058279
574 Ga0157372_10210370
575 Ga0157375_10006897
576 Ga0157375_10012692
577 Ga0163163_10134756
578 Ga0157379_10160781
579 Ga0213876_10009447
580 Ga0207697_10004216
581 Ga0207682_10011974
582 Ga0207680_10014096
583 Ga0207647_10005210
584 Ga0207647_10008782
585 Ga0207647_10038690
586 Ga0207647_10044797
587 Ga0207645_10022873
588 Ga0207643_10053046
589 Ga0207705_10001873
590 Ga0207705_10010950
591 Ga0207705_10015385
592 Ga0207705_10025371
593 Ga0207705_10037882
594 Ga0207705_10088878
595 Ga0207705_10111710
596 Ga0207707_10014621
597 Ga0207707_10071676
598 Ga0207695_10003427
599 Ga0207695_10155503
600 Ga0207671_10040986
601 Ga0207660_10001238
602 Ga0207660_10010433
603 Ga0207660_10046998
604 Ga0207657_10003154
605 Ga0207657_10004321
606 Ga0207657_10004489
607 Ga0207657_10009468
608 Ga0207657_10015690
609 Ga0207657_10016856
610 Ga0207657_10029165
611 Ga0207657_10037325
612 Ga0207657_10037648
613 Ga0207657_10057992
614 Ga0207649_10026356
615 Ga0207649_10029524
616 Ga0207649_10054232
617 Ga0207652_10002668
618 Ga0207652_10012448
619 Ga0207652_10026126
620 Ga0207652_10031763
621 Ga0207652_10090810
622 Ga0207694_10028223
623 Ga0207650_10002564
624 Ga0207659_10116040
625 Ga0207664_10013063
626 Ga0207664_10019267
627 Ga0207644_10001341
628 Ga0207644_10008244
629 Ga0207644_10009584
630 Ga0207644_10014599
631 Ga0207644_10092512
632 Ga0207690_10008270
633 Ga0207690_10019919
634 Ga0207690_10024896
635 Ga0207706_10006433
636 Ga0207706_10007350
637 Ga0207706_10009037
638 Ga0207706_10013743
639 Ga0207706_10020718
640 Ga0207706_10095307
641 Ga0207669_10016244
642 Ga0207691_10004927
643 Ga0207691_10015275
644 Ga0207691_10145256
645 Ga0207711_10000372
646 Ga0207711_10010605
647 Ga0207711_10015440
648 Ga0207711_10025269
649 Ga0207711_10075832
650 Ga0207661_10056408
651 Ga0207679_10016038
652 Ga0207679_10020445
653 Ga0207679_10024863
654 Ga0207679_10054387
655 Ga0207667_10024706
656 Ga0207667_10049860
657 Ga0207667_10067318
658 Ga0207667_10075901
659 Ga0207667_10081139
660 Ga0207667_10127845
661 Ga0207667_10153233
662 Ga0207651_10019246
663 Ga0207651_10098708
664 Ga0207640_10032066
665 Ga0207640_10033312
666 Ga0207658_10001383
667 Ga0207658_10003993
668 Ga0207658_10058601
669 Ga0207677_10003123
670 Ga0207677_10032965
671 Ga0207703_10000774
672 Ga0207703_10003333
673 Ga0207703_10007253
674 Ga0207639_10027862
675 Ga0207639_10036406
676 Ga0207639_10044881
677 Ga0207639_10103773
678 Ga0207678_10000961
679 Ga0207678_10001639
680 Ga0207678_10011057
681 Ga0207678_10016563
682 Ga0207678_10020183
683 Ga0207678_10026156
684 Ga0207678_10035701
685 Ga0207678_10041752
686 Ga0207678_10144365
687 Ga0207702_10024422
688 Ga0207702_10026936
689 Ga0207641_10002963
690 Ga0207641_10040725
691 Ga0207641_10109192
692 Ga0207648_10002161
693 Ga0207648_10039478
694 Ga0207648_10051110
695 Ga0207676_10008127
696 Ga0207676_10011644
697 Ga0207676_10022134
698 Ga0207674_10003514
699 Ga0207674_10010227
700 Ga0207674_10020677
701 Ga0207674_10097831
702 Ga0207674_10104691
703 Ga0207675_100099337
704 Ga0207683_10002064
705 Ga0207683_10004910
706 Ga0207698_10006152
707 Ga0207698_10016809
708 Ga0207698_10021203
709 Ga0207698_10024980
710 Ga0207698_10055402
711 Ga0207698_10112124
712 Ga0207698_10165940
713 Ga0268266_10007027
714 Ga0268266_10095344
715 Ga0268264_10059972
716 Ga0373944_0014469
717 Ga0373943_0018939
718 Ga0373935_0001587
719 Ga0373927_0023769
720 Ga0373925_0006023
721 Ga0395899_0009774
722 Ga0395899_0053027
723 Ga0395899_0059876
724 Ga0395899_0084592
725 Ga0395900_0005499
726 Ga0395900_0040471
727 Ga0395900_0044196
728 Ga0395900_0064993
729 Ga0395900_0068886
730 Ga0395900_0070547
731 Ga0395900_0072961
732 Ga0395900_0120645
733 Ga0395900_0234846
734 Ga0395898_0011647
735 Ga0395898_0055417
736 Ga0395898_0062570
737 Ga0395898_0122561
738 Ga0395898_0175255
739 Ga0395905_0015344
740 Ga0395905_0057188
741 Ga0395905_0100787
742 Ga0395905_0164189
743 Ga0395905_0249365
744 Ga0436364_0560527
745 Ga0395901_0000203
746 Ga0395901_0010109
747 Ga0395901_0012342
748 Ga0395901_0043430
749 Ga0395901_0048466
750 Ga0395901_0104372
751 Ga0436365_1666025
752 Ga0466966_0009118
753 Ga0466963_0008776
754 Ga0466963_0082244
755 Ga0466970_0038485
756 Ga0466957_0019390
757 Ga0466957_0022149
758 Ga0466960_0010336
759 Ga0466959_0043409
760 Ga0466958_0036334
761 Ga0466967_0003913
762 Ga0466967_0061398
763 Ga0466967_0126642
764 Ga0495669_0001406
765 Ga0495669_0053266
766 Ga0495670_0029668
767 Ga0496100_0066406
768 Ga0496101_0009761
769 Ga0496101_0034659
770 Ga0496102_0033905
771 Ga0496104_0083566
772 Ga0496106_0022404
773 Ga0496106_0023263
774 Ga0496106_0085140
775 Ga0496107_0001208
776 Ga0496107_0003676
777 Ga0496107_0025970
778 Ga0496108_0000578
779 Ga0496108_0003798
780 Ga0496109_0000926
781 Ga0496109_0014626
782 Ga0496109_0017695
783 Ga0496110_0002565
784 Ga0496110_0014653
785 Ga0496110_0017630
786 Ga0496111_0000678
787 Ga0496111_0003354
788 Ga0496111_0012972
789 Ga0496112_0001077
790 Ga0496112_0015336
791 Ga0496113_0007217
792 Ga0496113_0007523
793 Ga0496113_0016009
794 Ga0496114_0000006
795 Ga0496114_0004678
796 Ga0466962_0007281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

277

424

0.84

PF20142

Scaffold

Scaffold domain

39

149

0.84

PF01471

PG_binding_1

Putative peptidoglycan binding domain

176

250

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tv7-assembly2.cif.gz_B 2.05 angstrom resolution crystal structure of peptidoglycan-binding protein from clostridioides difficile in complex with glutamine hydroxamate. 0.9003 167 245
6tci-assembly1.cif.gz_A the crystal structure of sleb n-terminal domain 0.8948 165 248
4c2g-assembly1.cif.gz_A-2 crystal structure of ctpb(s309a) in complex with a peptide having a val-pro-ala c-terminus 0.8812 160 250
6tci-assembly1.cif.gz_A the crystal structure of sleb n-terminal domain 0.8501 165 248
4c2f-assembly1.cif.gz_A crystal structure of the ctpb r168a mutant present in an active conformation 0.8363 151 252
ID Description Score Start End Superfamily
1eakD01 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.9086 216 244 1.10.101.10
af_A0A1D6HJU4_37_261_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8824 169 234 3.40.390.10
af_I1N5Y3_46_297_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.863 169 242 3.40.390.10
af_Q94LQ4_46_318_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8554 170 242 3.40.390.10
4lpqA01 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.8388 164 246 1.10.101.10
ID Description Score Start End GO Terms
AF-A0A553FTE7-F1-model_v4 L,D-transpeptidase family protein 0.8889 222 473 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A258C6A8-F1-model_v4 deleted 0.8825 202 473
AF-A0A4P6W652-F1-model_v4 deleted 0.8818 46 472
AF-A0A2M9PCF6-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.8767 218 473 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A7K4ERR0-F1-model_v4 deleted 0.8758 45 473

Map