metagRoot

F434087

General Info

Members	Datasets	Scaffolds	Average Seq Length
398	267	361	273

Family's Representative Sequence

Representative Sequence	3300035398\|Ga0316574_0001322\|Ga0316574_0001322_4611_5525
Length	304
Sequence	MSAIAMRPPYARAARLSDGIRIATAFACYLARVDSFEVNRRNWDERVAIHAASPDYALQNFRDDPRFVSGVVRFDLPRLGDVSGLRCVHLQCHIGTDTVSLARLGASMTGLDFSEPALAVARALATDLGYDIEFVCADLYRAPDVLGKGRFDMVFTGIGALCWLPDVDRWAGVVSDLLVPGGRLFLREGHPVLWALDYDVADRLVIEYPYFETPDPVVEDEEQTYAASEQKLGNSTTHTWNHGLGEVVTALLSNGMRITALEEHQSVPWNPLPGQTVVRDGEWFLAQRPERLPMSYTLQAVKGV

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
3	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
4	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
5	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
6	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
7	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
8	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
9	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
10	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
11	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
12	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
13	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
14	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
15	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
16	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
17	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
18	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
19	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
20	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
21	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
22	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
23	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
24	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
25	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
26	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
27	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
28	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
29	2870628048	Microbacterium thalassium DSM 12511	Isolate	Rhizosphere
30	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
31	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
32	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
33	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
34	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
35	2966921586	Rathayibacter agropyri 617	Isolate	Rhizosphere
36	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
37	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
38	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
39	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
40	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
41	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
42	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
43	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
44	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
45	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
46	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
47	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
48	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
49	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
50	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
51	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
52	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
53	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
54	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
55	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
56	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
57	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
58	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
59	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
60	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
61	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
62	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
63	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
64	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
65	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
66	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
67	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
68	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
69	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
70	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
71	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
72	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
73	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
74	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
75	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
76	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
77	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
78	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
79	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
80	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
81	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
82	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
83	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
84	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
85	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
86	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
87	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
88	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
89	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
90	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
91	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
92	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
93	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
94	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
95	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
96	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
97	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
98	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
99	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
100	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
101	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
102	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
103	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
104	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
105	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
106	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
107	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
108	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
109	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
110	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
111	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
112	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
113	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
114	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
115	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
116	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
117	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
118	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
119	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
120	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
121	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
122	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
123	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
124	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
125	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
126	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
127	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
128	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
129	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
130	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
131	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
132	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
133	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
134	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
135	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
136	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
137	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
182	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
183	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
184	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
185	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
186	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
187	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
188	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
189	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
190	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
191	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
192	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
193	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
194	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
195	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
196	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
197	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
198	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
199	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
200	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
201	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
202	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
203	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
204	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
205	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
206	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
207	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
208	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
209	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
210	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
211	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
212	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
213	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
214	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
215	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
216	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
217	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
218	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
219	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
220	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
221	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
222	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
223	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
224	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
225	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
226	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
227	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
228	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
229	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
230	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
231	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
232	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
233	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
234	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
235	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
236	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
237	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
238	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
239	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
240	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
241	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
242	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
243	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
244	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
245	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
246	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
247	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
248	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
249	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
250	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
253	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
254	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
255	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
256	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
257	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
258	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
259	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
260	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
261	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
262	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
263	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
264	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
265	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
266	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
267	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.7
Metatranscriptomes	0
Isolates	9.3

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.29
Nodule	0.25
Rhizoplane	13.82
Rhizosphere	69.6
Stem	0
Stem Tuber	0
Unclassified	8.04

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_636892	2162886007	Bacteria	1901
2	JGI24746J21847_1006718	3300001977	Bacteria	1774
3	JGI24743J22301_10018031	3300001991	Bacteria	1330
4	JGI24744J21845_10016913	3300002077	Bacteria	1450
5	JGI24744J21845_10025897	3300002077	Bacteria	1141
6	JGI24742J22300_10003630	3300002244	Bacteria	2504
7	JGI25162J39368_1000077	3300002737	Bacteria	120042
8	JGI25163J39215_1000061	3300002771	Bacteria	48656
9	JGI25164J39214_1000054	3300002772	Bacteria	120042
10	JGI25165J46597_1000141	3300003214	Bacteria	120042
11	rootH1_10105108	3300003316	Bacteria	1102
12	rootL2_10176008	3300003322	Bacteria	1300
13	rootL2_10176009	3300003322	Bacteria	1180
14	Ga0065704_10070431	3300005289	Bacteria	25069
15	Ga0065704_10120980	3300005289	Bacteria	1773
16	Ga0070658_10002091	3300005327	Bacteria	16732
17	Ga0070658_10058967	3300005327	Bacteria	3126
18	Ga0070670_100184587	3300005331	Bacteria	1811
19	Ga0068869_100082617	3300005334	Bacteria	2401
20	Ga0068869_100186824	3300005334	Bacteria	1627
21	Ga0070666_10213830	3300005335	Bacteria	1358
22	Ga0070682_100086543	3300005337	Bacteria	2041
23	Ga0070682_100152400	3300005337	Bacteria	1588
24	Ga0070682_100377017	3300005337	Bacteria	1066
25	Ga0068868_100002900	3300005338	Bacteria	11902
26	Ga0068868_100075941	3300005338	Bacteria	2686
27	Ga0070660_100367926	3300005339	Bacteria	1186
28	Ga0070689_100016443	3300005340	Bacteria	5414
29	Ga0070691_10006668	3300005341	Bacteria	5284
30	Ga0070687_100025442	3300005343	Bacteria	2840
31	Ga0070687_100240233	3300005343	Bacteria	1120
32	Ga0070661_100517041	3300005344	Bacteria	957
33	Ga0070692_10326407	3300005345	Bacteria	946
34	Ga0070668_100000137	3300005347	Bacteria	46061
35	Ga0070668_100034675	3300005347	Bacteria	3846
36	Ga0070668_100299279	3300005347	Bacteria	1349
37	Ga0070669_100080831	3300005353	Bacteria	2420
38	Ga0070675_100449491	3300005354	Bacteria	1155
39	Ga0070671_100011869	3300005355	Bacteria	7007
40	Ga0070674_100005980	3300005356	Bacteria	7075
41	Ga0070673_100471780	3300005364	Bacteria	1131
42	Ga0070688_100268426	3300005365	Bacteria	1221
43	Ga0070659_100481829	3300005366	Bacteria	1056
44	Ga0070667_100382550	3300005367	Bacteria	1278
45	Ga0070667_100564516	3300005367	Bacteria	1047
46	Ga0070703_10014571	3300005406	Bacteria	2241
47	Ga0070714_100071688	3300005435	Bacteria	2996
48	Ga0070714_100245227	3300005435	Bacteria	1655
49	Ga0070710_10003872	3300005437	Bacteria	7081
50	Ga0070710_10085824	3300005437	Bacteria	1847
51	Ga0070701_10055043	3300005438	Bacteria	2076
52	Ga0070711_100007865	3300005439	Bacteria	6498
53	Ga0070711_100010188	3300005439	Bacteria	5810
54	Ga0070705_100031080	3300005440	Bacteria	2954
55	Ga0070705_100093567	3300005440	Bacteria	1879
56	Ga0070700_100000909	3300005441	Bacteria	14602
57	Ga0070700_100393910	3300005441	Bacteria	1039
58	Ga0070694_100163659	3300005444	Bacteria	1634
59	Ga0070663_100037662	3300005455	Bacteria	3368
60	Ga0070663_100463533	3300005455	Bacteria	1046
61	Ga0070663_100503975	3300005455	Bacteria	1006
62	Ga0070663_100543519	3300005455	Bacteria	970
63	Ga0070662_100126865	3300005457	Unclassified	1962
64	Ga0070662_100160794	3300005457	Bacteria	1756
65	Ga0068867_100393181	3300005459	Bacteria	1167
66	Ga0070685_10144682	3300005466	Bacteria	1500
67	Ga0070684_100158319	3300005535	Bacteria	2054
68	Ga0070697_100493097	3300005536	Bacteria	1070
69	Ga0070672_100096933	3300005543	Bacteria	2387
70	Ga0070686_100237905	3300005544	Bacteria	1324
71	Ga0070665_100009829	3300005548	Bacteria	9669
72	Ga0070665_100289894	3300005548	Bacteria	1639
73	Ga0070704_100102523	3300005549	Bacteria	2159
74	Ga0068855_100001083	3300005563	Bacteria	33850
75	Ga0068855_100130655	3300005563	Bacteria	2868
76	Ga0068857_100244638	3300005577	Bacteria	1643
77	Ga0068854_100118852	3300005578	Unclassified	2003
78	Ga0070702_100001231	3300005615	Bacteria	10367
79	Ga0070702_100019390	3300005615	Bacteria	3546
80	Ga0070702_100110769	3300005615	Bacteria	1701
81	Ga0068852_100209882	3300005616	Bacteria	1847
82	Ga0068859_100004637	3300005617	Bacteria	14001
83	Ga0068859_100090137	3300005617	Bacteria	3117
84	Ga0068859_100179074	3300005617	Bacteria	2202
85	Ga0068859_100218707	3300005617	Bacteria	1992
86	Ga0068864_100034367	3300005618	Bacteria	4312
87	Ga0068864_100197861	3300005618	Bacteria	1845
88	Ga0068866_10003594	3300005718	Bacteria	6350
89	Ga0068866_10009421	3300005718	Bacteria	4146
90	Ga0068861_100145783	3300005719	Bacteria	1937
91	Ga0068870_10273043	3300005840	Bacteria	1057
92	Ga0068863_100018962	3300005841	Bacteria	6583
93	Ga0068858_100061158	3300005842	Bacteria	3481
94	Ga0068858_100395065	3300005842	Bacteria	1328
95	Ga0068860_100030574	3300005843	Bacteria	5179
96	Ga0068860_100080947	3300005843	Bacteria	3088
97	Ga0068860_100169290	3300005843	Bacteria	2110
98	Ga0068860_100336955	3300005843	Bacteria	1482
99	Ga0068862_100017718	3300005844	Bacteria	5928
100	Ga0068862_100129149	3300005844	Bacteria	2234
101	Ga0068862_100364553	3300005844	Unclassified	1344
102	Ga0068862_100754384	3300005844	Bacteria	947
103	Ga0081455_10055592	3300005937	Bacteria	3366
104	Ga0081540_1005682	3300005983	Bacteria	9268
105	Ga0075363_100001481	3300006048	Bacteria	8938
106	Ga0075363_100003971	3300006048	Bacteria	6393
107	Ga0075363_100111110	3300006048	Bacteria	1523
108	Ga0075363_100128369	3300006048	Bacteria	1421
109	Ga0075364_10002095	3300006051	Bacteria	11138
110	Ga0075364_10021733	3300006051	Bacteria	4045
111	Ga0075364_10061489	3300006051	Bacteria	2464
112	Ga0070716_100011931	3300006173	Bacteria	4389
113	Ga0070712_100001364	3300006175	Bacteria	14811
114	Ga0075362_10034843	3300006177	Bacteria	2196
115	Ga0075369_10003092	3300006186	Bacteria	6026
116	Ga0075369_10012088	3300006186	Bacteria	3405
117	Ga0075369_10035310	3300006186	Bacteria	2124
118	Ga0075370_10030211	3300006353	Bacteria	3022
119	Ga0075428_100006534	3300006844	Bacteria	12964
120	Ga0075428_100620518	3300006844	Bacteria	1154
121	Ga0075430_100193502	3300006846	Bacteria	1690
122	Ga0075431_100354319	3300006847	Bacteria	1475
123	Ga0068865_100013188	3300006881	Bacteria	5218
124	Ga0068865_100034735	3300006881	Bacteria	3385
125	Ga0097620_100004637	3300006931	Bacteria	14001
126	Ga0097620_100090138	3300006931	Bacteria	3117
127	Ga0097620_100179088	3300006931	Bacteria	2202
128	Ga0097620_100218708	3300006931	Bacteria	1992
129	Ga0105244_10021495	3300009036	Bacteria	3568
130	Ga0105240_10549463	3300009093	Bacteria	1278
131	Ga0105245_10235687	3300009098	Bacteria	1772
132	Ga0105245_10448780	3300009098	Bacteria	1298
133	Ga0105247_10005095	3300009101	Bacteria	8327
134	Ga0105247_10028560	3300009101	Bacteria	3376
135	Ga0114129_10041961	3300009147	Bacteria	6442
136	Ga0105243_10000125	3300009148	Bacteria	86522
137	Ga0105243_10015872	3300009148	Bacteria	5696
138	Ga0105243_10157258	3300009148	Bacteria	1956
139	Ga0105242_10014895	3300009176	Bacteria	6026
140	Ga0105249_10121881	3300009553	Bacteria	2479
141	Ga0105249_10136866	3300009553	Bacteria	2345
142	Ga0105239_10239177	3300010375	Unclassified	2038
143	Ga0157371_10000463	3300013102	Bacteria	49682
144	Ga0157371_10090828	3300013102	Bacteria	2163
145	Ga0157370_10089334	3300013104	Bacteria	2894
146	Ga0157370_10384586	3300013104	Bacteria	1292
147	Ga0157374_10088744	3300013296	Bacteria	2945
148	Ga0157374_10112850	3300013296	Unclassified	2616
149	Ga0157374_10242281	3300013296	Bacteria	1773
150	Ga0157378_10085629	3300013297	Bacteria	2855
151	Ga0163162_10242166	3300013306	Bacteria	1935
152	Ga0163162_10262376	3300013306	Bacteria	1859
153	Ga0163162_10352812	3300013306	Bacteria	1604
154	Ga0163162_10597726	3300013306	Bacteria	1230
155	Ga0163162_10692357	3300013306	Bacteria	1141
156	Ga0157372_10000172	3300013307	Bacteria	71944
157	Ga0157375_10003630	3300013308	Bacteria	13384
158	Ga0157375_10406362	3300013308	Bacteria	1528
159	Ga0163163_10033193	3300014325	Bacteria	4991
160	Ga0157380_10067323	3300014326	Bacteria	2883
161	Ga0157380_10073060	3300014326	Bacteria	2780
162	Ga0157380_10152624	3300014326	Bacteria	1999
163	Ga0182008_10008985	3300014497	Bacteria	5414
164	Ga0157379_10095354	3300014968	Bacteria	2669
165	Ga0157376_10150401	3300014969	Bacteria	2099
166	Ga0157376_10318945	3300014969	Bacteria	1477
167	Ga0163161_10003185	3300017792	Bacteria	11553
168	Ga0163161_10279523	3300017792	Bacteria	1309
169	Ga0213875_10020267	3300021388	Bacteria	3191
170	Ga0209760_100054	3300025207	Bacteria	102021
171	Ga0207427_100074	3300025231	Bacteria	153455
172	Ga0209437_100006	3300025233	Bacteria	1042724
173	Ga0209233_1000105	3300025261	Bacteria	272035
174	Ga0209051_1027280	3300025303	Bacteria	2279
175	Ga0207653_10043170	3300025885	Bacteria	1484
176	Ga0207692_10025374	3300025898	Bacteria	2767
177	Ga0207642_10002351	3300025899	Bacteria	5894
178	Ga0207710_10137928	3300025900	Bacteria	1176
179	Ga0207688_10036406	3300025901	Bacteria	2727
180	Ga0207699_10062764	3300025906	Bacteria	2241
181	Ga0207645_10024242	3300025907	Bacteria	3936
182	Ga0207705_10016712	3300025909	Bacteria	5254
183	Ga0207654_10115139	3300025911	Bacteria	1679
184	Ga0207654_10141630	3300025911	Bacteria	1534
185	Ga0207693_10016840	3300025915	Bacteria	5835
186	Ga0207693_10066256	3300025915	Bacteria	2828
187	Ga0207663_10022197	3300025916	Bacteria	3625
188	Ga0207663_10070726	3300025916	Bacteria	2249
189	Ga0207662_10056828	3300025918	Bacteria	2338
190	Ga0207657_10447285	3300025919	Unclassified	1014
191	Ga0207646_10396466	3300025922	Bacteria	1247
192	Ga0207650_10222834	3300025925	Bacteria	1518
193	Ga0207687_10057209	3300025927	Bacteria	2738
194	Ga0207706_10023112	3300025933	Bacteria	5584
195	Ga0207686_10004101	3300025934	Bacteria	7816
196	Ga0207686_10323697	3300025934	Bacteria	1153
197	Ga0207709_10000282	3300025935	Bacteria	58269
198	Ga0207709_10099027	3300025935	Bacteria	1923
199	Ga0207709_10165242	3300025935	Bacteria	1548
200	Ga0207669_10000773	3300025937	Bacteria	13712
201	Ga0207704_10013114	3300025938	Bacteria	4137
202	Ga0207665_10008931	3300025939	Bacteria	6582
203	Ga0207665_10013707	3300025939	Bacteria	5331
204	Ga0207667_10095308	3300025949	Bacteria	3072
205	Ga0207667_10203936	3300025949	Unclassified	2028
206	Ga0207667_10233312	3300025949	Bacteria	1884
207	Ga0207668_10001462	3300025972	Bacteria	13864
208	Ga0207668_10228589	3300025972	Bacteria	1498
209	Ga0207668_10297185	3300025972	Bacteria	1331
210	Ga0207668_10602035	3300025972	Bacteria	957
211	Ga0207640_10010322	3300025981	Bacteria	5257
212	Ga0207658_10003281	3300025986	Bacteria	11491
213	Ga0207658_10314659	3300025986	Bacteria	1353
214	Ga0207677_10026262	3300026023	Bacteria	3649
215	Ga0207703_10318013	3300026035	Bacteria	1425
216	Ga0207678_10107161	3300026067	Unclassified	2384
217	Ga0207708_10000014	3300026075	Bacteria	203569
218	Ga0207708_10014981	3300026075	Bacteria	5810
219	Ga0207641_10009626	3300026088	Bacteria	7965
220	Ga0207648_10072564	3300026089	Bacteria	2999
221	Ga0207648_10188438	3300026089	Bacteria	1827
222	Ga0207676_10023913	3300026095	Bacteria	4515
223	Ga0207674_10223654	3300026116	Bacteria	1830
224	Ga0207675_100012231	3300026118	Bacteria	8015
225	Ga0207683_10000256	3300026121	Bacteria	47418
226	Ga0207683_10012325	3300026121	Bacteria	7298
227	Ga0268266_10022643	3300028379	Bacteria	5349
228	Ga0268265_10095132	3300028380	Bacteria	2391
229	Ga0268265_10243201	3300028380	Bacteria	1589
230	Ga0268264_10062088	3300028381	Bacteria	3137
231	Ga0268264_10306770	3300028381	Bacteria	1496
232	Ga0265338_10052564	3300028800	Bacteria	3653
233	Ga0265327_10036179	3300031251	Bacteria	2717
234	Ga0307509_10004174	3300031507	Bacteria	21103
235	Ga0316576_10004465	3300031727	Bacteria	8397
236	Ga0316576_10029260	3300031727	Bacteria	3892
237	Ga0316576_10370618	3300031727	Bacteria	1064
238	Ga0307516_10055587	3300031730	Bacteria	3863
239	Ga0316583_10011583	3300032133	Bacteria	3179
240	Ga0373962_0027337	3300035242	Bacteria	1543
241	Ga0316574_0001322	3300035398	Bacteria	11615
242	Ga0373931_0170702	3300035691	Bacteria	1281
243	Ga0373935_0215390	3300035692	Bacteria	1332
244	Ga0316582_0195462	3300036647	Bacteria	1379
245	Ga0316584_0205840	3300036712	Bacteria	1450
246	Ga0436365_0720134	3300039437	Bacteria	3822
247	Ga0439466_0018120	3300041411	Bacteria	2528
248	Ga0439466_0029563	3300041411	Bacteria	1884
249	Ga0439465_0016932	3300041413	Bacteria	2274
250	Ga0451789_0711768	3300041443	Bacteria	1077
251	Ga0451793_1566532	3300041452	Bacteria	1098
252	Ga0451833_0374173	3300041491	Bacteria	3171
253	Ga0451837_0484099	3300041494	Bacteria	1817
254	Ga0451853_0837505	3300041512	Bacteria	1619
255	Ga0439456_000024	3300042013	Bacteria	58893
256	Ga0439456_040217	3300042013	Bacteria	1012
257	Ga0439463_002022	3300042016	Bacteria	5263
258	Ga0450904_000010	3300042139	Bacteria	43301
259	Ga0451577_0002082	3300042876	Bacteria	24635
260	Ga0439440_0008393	3300042993	Bacteria	2119
261	Ga0453684_0151765	3300044712	Bacteria	2752
262	Ga0466957_0161697	3300044842	Bacteria	1455
263	Ga0466960_0038710	3300044901	Bacteria	2244
264	Ga0466960_0072494	3300044901	Bacteria	1717
265	Ga0466960_0079425	3300044901	Bacteria	1650
266	Ga0451576_0537240	3300045051	Bacteria	1228
267	Ga0466967_0599419	3300045976	Bacteria	1087
268	Ga0495638_0020343	3300046460	Bacteria	4385
269	Ga0495620_0000037	3300046515	Bacteria	114491
270	Ga0495632_0000376	3300046519	Bacteria	42540
271	Ga0495643_0000049	3300046522	Bacteria	212242
272	Ga0495643_0002114	3300046522	Bacteria	16408
273	Ga0495648_0002549	3300046524	Bacteria	16696
274	Ga0495648_0004207	3300046524	Bacteria	12362
275	Ga0495648_0160316	3300046524	Bacteria	1164
276	Ga0495654_0047331	3300046530	Bacteria	2114
277	Ga0495654_0122576	3300046530	Bacteria	1175
278	Ga0495611_0126075	3300046648	Bacteria	1194
279	Ga0495625_0151933	3300046660	Bacteria	1556
280	Ga0495671_0008424	3300046692	Bacteria	5802
281	Ga0495649_0029782	3300046694	Bacteria	3016
282	Ga0495649_0165208	3300046694	Bacteria	1160
283	Ga0495672_0009816	3300047320	Bacteria	6888
284	Ga0495672_0098163	3300047320	Bacteria	1594
285	Ga0495680_0127854	3300047322	Bacteria	1870
286	Ga0495681_0016130	3300047470	Bacteria	4203
287	Ga0495681_0022506	3300047470	Bacteria	3370
288	Ga0495686_0042045	3300047472	Bacteria	2908
289	Ga0495686_0132496	3300047472	Bacteria	1477
290	Ga0495602_0249084	3300048088	Bacteria	1325
291	Ga0496101_0069690	3300048904	Bacteria	2573
292	Ga0496102_0000079	3300048905	Bacteria	140942
293	Ga0496102_0011576	3300048905	Bacteria	7611
294	Ga0496102_0032658	3300048905	Bacteria	4676
295	Ga0496103_0000034	3300048906	Bacteria	189284
296	Ga0496103_0044128	3300048906	Bacteria	2746
297	Ga0496103_0168423	3300048906	Bacteria	1406
298	Ga0496103_0186811	3300048906	Bacteria	1332
299	Ga0496104_0111062	3300048907	Bacteria	2628
300	Ga0496104_0192602	3300048907	Bacteria	1951
301	Ga0496105_0054808	3300048908	Bacteria	3292
302	Ga0496105_0275685	3300048908	Bacteria	1357
303	Ga0496106_0016043	3300048909	Bacteria	5538
304	Ga0496107_0105984	3300048910	Bacteria	2064
305	Ga0496108_0000691	3300048911	Bacteria	26123
306	Ga0496108_0136390	3300048911	Bacteria	2112
307	Ga0496108_0731508	3300048911	Bacteria	857
308	Ga0496109_0001943	3300048912	Bacteria	17172
309	Ga0496109_0044732	3300048912	Bacteria	4017
310	Ga0496109_0136949	3300048912	Bacteria	2288
311	Ga0496110_0055499	3300048913	Bacteria	3486
312	Ga0496110_0239510	3300048913	Bacteria	1651
313	Ga0496110_0258419	3300048913	Bacteria	1585
314	Ga0496112_0148213	3300048915	Bacteria	2314
315	Ga0496112_0192149	3300048915	Bacteria	2003
316	Ga0496112_0295977	3300048915	Bacteria	1564
317	Ga0496112_0486163	3300048915	Bacteria	1171
318	Ga0496113_0306365	3300048916	Bacteria	1272
319	Ga0496113_0470277	3300048916	Bacteria	1010
320	Ga0496114_0061831	3300048917	Bacteria	3133
321	Ga0496114_0138612	3300048917	Bacteria	2104
322	Ga0496114_0255205	3300048917	Bacteria	1543
323	Ga0496114_0380728	3300048917	Bacteria	1249
324	Ga0496115_0006664	3300048918	Bacteria	8474
325	Ga0496115_0065422	3300048918	Bacteria	2936
326	Ga0496116_0000168	3300048919	Bacteria	132462
327	Ga0496116_0138526	3300048919	Bacteria	1373
328	Ga0496117_0000731	3300048920	Bacteria	51549
329	Ga0496117_0008714	3300048920	Bacteria	9585
330	Ga0496117_0009101	3300048920	Bacteria	9330
331	Ga0496118_0014967	3300048921	Bacteria	7217
332	Ga0496118_0053782	3300048921	Bacteria	3056
333	Ga0496120_0106724	3300048923	Bacteria	1470
334	Ga0496120_0125312	3300048923	Bacteria	1323
335	Ga0496121_0000199	3300048924	Bacteria	132751
336	Ga0496122_0003616	3300048925	Bacteria	20133
337	Ga0496123_0000999	3300048926	Bacteria	43267
338	Ga0496125_0013990	3300048928	Bacteria	7846
339	Ga0496126_0005883	3300048929	Bacteria	13832
340	Ga0496126_0061809	3300048929	Bacteria	3363
341	Ga0496126_0221072	3300048929	Bacteria	1591
342	Ga0501034_0402226	3300049571	Bacteria	1292
343	Ga0501037_0172929	3300049573	Bacteria	1535
344	Ga0501046_0010608	3300049580	Bacteria	7906
345	Ga0501044_0024288	3300049823	Bacteria	6438
346	Ga0501226_000070	3300049853	Bacteria	31761
347	nmdc:mga03683_36636_c1	3300050489	Bacteria	1996
348	nmdc:mga03n38_189157_c1	3300050490	Bacteria	1059
349	nmdc:mga03n38_3762_c1	3300050490	Bacteria	4919
350	nmdc:mga03n38_42280_c1	3300050490	Bacteria	1991
351	nmdc:mga00v17_142327_c1	3300050491	Bacteria	1538
352	nmdc:mga00v17_70660_c1	3300050491	Bacteria	2163
353	nmdc:mga00v17_952_c1	3300050491	Bacteria	15522
354	nmdc:mga0yw44_10581_c1	3300050492	Bacteria	4720
355	nmdc:mga07m45_29145_c1	3300050496	Bacteria	3050
356	nmdc:mga05p37_16428_c1	3300050507	Bacteria	8918
357	nmdc:mga09592_20115_c1	3300050508	Bacteria	5486
358	nmdc:mga06r32_437254_c1	3300050510	Bacteria	1288
359	nmdc:mga0sz30_4246_c1	3300050516	Bacteria	2998
360	Ga0500643_004564	3300053087	Bacteria	6204
361	Ga0500627_0054834	3300053158	Bacteria	1744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048904	Ga0496101_0069690	Ga0496101_0069690_1369_2148	243
2	3300025919	Ga0207657_10447285	Ga0207657_104472851	246
3	3300048915	Ga0496112_0486163	Ga0496112_0486163_123_998	246
4	3300041512	Ga0451853_0837505	Ga0451853_0837505_494_1288	247
5	3300026067	Ga0207678_10107161	Ga0207678_101071612	249
6	3300005353	Ga0070669_100080831	Ga0070669_1000808312	250
7	3300002077	JGI24744J21845_10025897	JGI24744J21845_100258972	252
8	3300028800	Ga0265338_10052564	Ga0265338_100525643	253
9	3300031251	Ga0265327_10036179	Ga0265327_100361793	253
10	3300005440	Ga0070705_100093567	Ga0070705_1000935672	254
11	iso_pu_bacteria	2511231006	2511267991	254
12	iso_pu_bacteria	2554235341	2555671182	254
13	iso_pu_bacteria	2597489887	2597859268	254
14	iso_pu_bacteria	2599185160	2599354658	254
15	iso_pu_bacteria	2599185161	2599359629	254
16	iso_pu_bacteria	2599185162	2599365951	254
17	iso_pu_bacteria	2599185163	2599372741	254
18	iso_pu_bacteria	2599185164	2599379765	254
19	iso_pu_bacteria	2599185165	2599385256	254
20	iso_pu_bacteria	2599185166	2599391600	254
21	iso_pu_bacteria	2599185168	2599403366	254
22	iso_pu_bacteria	2599185181	2599461492	254
23	iso_pu_bacteria	2599185182	2599470035	254
24	iso_pu_bacteria	2599185185	2599482100	254
25	iso_pu_bacteria	2599185186	2599490511	254
26	iso_pu_bacteria	2599185257	2599804184	254
27	iso_pu_bacteria	2599185356	2600214110	254
28	iso_pu_bacteria	2600255313	2601774276	254
29	iso_pu_bacteria	2667528171	2671097239	254
30	iso_pu_bacteria	2671180172	2671770248	254
31	iso_pu_bacteria	2738543020	2739287527	254
32	iso_pu_bacteria	2738543021	2739292840	254
33	iso_pu_bacteria	2811994881	2812370429	254
34	iso_pu_bacteria	2818991464	2819702336	254
35	iso_pu_bacteria	2844665904	2844671723	254
36	iso_pu_bacteria	2870628048	2870629094	254
37	iso_pu_bacteria	2912963787	2912966986	254
38	iso_pu_bacteria	2917070673	2917075041	254
39	iso_pu_bacteria	2923519811	2923524520	254
40	iso_pu_bacteria	2935353572	2935356029	254
41	iso_pu_bacteria	2939651529	2939655513	254
42	iso_pu_bacteria	637000220	637321514	254
43	iso_pu_bacteria	8019769354	8019774477	254
44	iso_pu_bacteria	8057798959	8057803995	254
45	3300005347	Ga0070668_100000137	Ga0070668_10000013721	255
46	3300005617	Ga0068859_100090137	Ga0068859_1000901372	255
47	3300005844	Ga0068862_100754384	Ga0068862_1007543841	255
48	3300006048	Ga0075363_100001481	Ga0075363_1000014816	255
49	3300006931	Ga0097620_100090138	Ga0097620_1000901382	255
50	3300025972	Ga0207668_10001462	Ga0207668_100014622	255
51	3300028381	Ga0268264_10062088	Ga0268264_100620883	255
52	iso_pu_bacteria	2551306166	2552109280	255
53	iso_pu_bacteria	2966921586	2966921957	255
54	3300001977	JGI24746J21847_1006718	JGI24746J21847_10067182	256
55	3300001991	JGI24743J22301_10018031	JGI24743J22301_100180311	256
56	3300002077	JGI24744J21845_10016913	JGI24744J21845_100169132	256
57	3300002244	JGI24742J22300_10003630	JGI24742J22300_100036301	256
58	3300005331	Ga0070670_100184587	Ga0070670_1001845872	256
59	3300005334	Ga0068869_100082617	Ga0068869_1000826171	256
60	3300005334	Ga0068869_100186824	Ga0068869_1001868242	256
61	3300005335	Ga0070666_10213830	Ga0070666_102138302	256
62	3300005337	Ga0070682_100086543	Ga0070682_1000865432	256
63	3300005337	Ga0070682_100152400	Ga0070682_1001524002	256
64	3300005338	Ga0068868_100002900	Ga0068868_10000290010	256
65	3300005338	Ga0068868_100075941	Ga0068868_1000759412	256
66	3300005339	Ga0070660_100367926	Ga0070660_1003679261	256
67	3300005340	Ga0070689_100016443	Ga0070689_1000164433	256
68	3300005341	Ga0070691_10006668	Ga0070691_100066682	256
69	3300005343	Ga0070687_100025442	Ga0070687_1000254422	256
70	3300005343	Ga0070687_100240233	Ga0070687_1002402332	256
71	3300005345	Ga0070692_10326407	Ga0070692_103264071	256
72	3300005347	Ga0070668_100034675	Ga0070668_1000346753	256
73	3300005347	Ga0070668_100299279	Ga0070668_1002992792	256
74	3300005354	Ga0070675_100449491	Ga0070675_1004494912	256
75	3300005355	Ga0070671_100011869	Ga0070671_1000118693	256
76	3300005356	Ga0070674_100005980	Ga0070674_1000059803	256
77	3300005364	Ga0070673_100471780	Ga0070673_1004717801	256
78	3300005365	Ga0070688_100268426	Ga0070688_1002684262	256
79	3300005366	Ga0070659_100481829	Ga0070659_1004818292	256
80	3300005367	Ga0070667_100382550	Ga0070667_1003825503	256
81	3300005367	Ga0070667_100564516	Ga0070667_1005645162	256
82	3300005406	Ga0070703_10014571	Ga0070703_100145712	256
83	3300005437	Ga0070710_10003872	Ga0070710_100038723	256
84	3300005437	Ga0070710_10085824	Ga0070710_100858242	256
85	3300005438	Ga0070701_10055043	Ga0070701_100550432	256
86	3300005439	Ga0070711_100007865	Ga0070711_1000078653	256
87	3300005439	Ga0070711_100010188	Ga0070711_1000101882	256
88	3300005440	Ga0070705_100031080	Ga0070705_1000310802	256
89	3300005441	Ga0070700_100393910	Ga0070700_1003939101	256
90	3300005444	Ga0070694_100163659	Ga0070694_1001636592	256
91	3300005455	Ga0070663_100037662	Ga0070663_1000376621	256
92	3300005455	Ga0070663_100463533	Ga0070663_1004635331	256
93	3300005455	Ga0070663_100503975	Ga0070663_1005039751	256
94	3300005457	Ga0070662_100126865	Ga0070662_1001268652	256
95	3300005457	Ga0070662_100160794	Ga0070662_1001607942	256
96	3300005459	Ga0068867_100393181	Ga0068867_1003931812	256
97	3300005466	Ga0070685_10144682	Ga0070685_101446822	256
98	3300005536	Ga0070697_100493097	Ga0070697_1004930972	256
99	3300005543	Ga0070672_100096933	Ga0070672_1000969332	256
100	3300005544	Ga0070686_100237905	Ga0070686_1002379052	256
101	3300005548	Ga0070665_100009829	Ga0070665_1000098295	256
102	3300005549	Ga0070704_100102523	Ga0070704_1001025232	256
103	3300005563	Ga0068855_100130655	Ga0068855_1001306552	256
104	3300005578	Ga0068854_100118852	Ga0068854_1001188522	256
105	3300005615	Ga0070702_100001231	Ga0070702_1000012313	256
106	3300005615	Ga0070702_100019390	Ga0070702_1000193902	256
107	3300005615	Ga0070702_100110769	Ga0070702_1001107692	256
108	3300005616	Ga0068852_100209882	Ga0068852_1002098822	256
109	3300005617	Ga0068859_100179074	Ga0068859_1001790742	256
110	3300005617	Ga0068859_100218707	Ga0068859_1002187072	256
111	3300005618	Ga0068864_100034367	Ga0068864_1000343672	256
112	3300005618	Ga0068864_100197861	Ga0068864_1001978612	256
113	3300005718	Ga0068866_10003594	Ga0068866_100035943	256
114	3300005718	Ga0068866_10009421	Ga0068866_100094212	256
115	3300005719	Ga0068861_100145783	Ga0068861_1001457832	256
116	3300005840	Ga0068870_10273043	Ga0068870_102730432	256
117	3300005841	Ga0068863_100018962	Ga0068863_1000189625	256
118	3300005842	Ga0068858_100061158	Ga0068858_1000611582	256
119	3300005842	Ga0068858_100395065	Ga0068858_1003950652	256
120	3300005843	Ga0068860_100030574	Ga0068860_1000305742	256
121	3300005843	Ga0068860_100080947	Ga0068860_1000809473	256
122	3300005843	Ga0068860_100336955	Ga0068860_1003369552	256
123	3300005844	Ga0068862_100017718	Ga0068862_1000177183	256
124	3300005844	Ga0068862_100129149	Ga0068862_1001291492	256
125	3300005844	Ga0068862_100364553	Ga0068862_1003645532	256
126	3300005937	Ga0081455_10055592	Ga0081455_100555923	256
127	3300006048	Ga0075363_100128369	Ga0075363_1001283692	256
128	3300006173	Ga0070716_100011931	Ga0070716_1000119312	256
129	3300006175	Ga0070712_100001364	Ga0070712_10000136414	256
130	3300006844	Ga0075428_100006534	Ga0075428_1000065341	256
131	3300006846	Ga0075430_100193502	Ga0075430_1001935022	256
132	3300006881	Ga0068865_100013188	Ga0068865_1000131883	256
133	3300006881	Ga0068865_100034735	Ga0068865_1000347352	256
134	3300006931	Ga0097620_100179088	Ga0097620_1001790883	256
135	3300006931	Ga0097620_100218708	Ga0097620_1002187082	256
136	3300009098	Ga0105245_10235687	Ga0105245_102356872	256
137	3300009098	Ga0105245_10448780	Ga0105245_104487802	256
138	3300009101	Ga0105247_10005095	Ga0105247_100050952	256
139	3300009148	Ga0105243_10015872	Ga0105243_100158722	256
140	3300009176	Ga0105242_10014895	Ga0105242_100148953	256
141	3300009553	Ga0105249_10121881	Ga0105249_101218812	256
142	3300009553	Ga0105249_10136866	Ga0105249_101368662	256
143	3300010375	Ga0105239_10239177	Ga0105239_102391772	256
144	3300013102	Ga0157371_10090828	Ga0157371_100908282	256
145	3300013296	Ga0157374_10088744	Ga0157374_100887442	256
146	3300013296	Ga0157374_10112850	Ga0157374_101128502	256
147	3300013296	Ga0157374_10242281	Ga0157374_102422812	256
148	3300013297	Ga0157378_10085629	Ga0157378_100856292	256
149	3300013306	Ga0163162_10242166	Ga0163162_102421662	256
150	3300013306	Ga0163162_10262376	Ga0163162_102623762	256
151	3300013306	Ga0163162_10597726	Ga0163162_105977262	256
152	3300013306	Ga0163162_10692357	Ga0163162_106923571	256
153	3300013308	Ga0157375_10003630	Ga0157375_1000363012	256
154	3300013308	Ga0157375_10406362	Ga0157375_104063622	256
155	3300014325	Ga0163163_10033193	Ga0163163_100331934	256
156	3300014326	Ga0157380_10067323	Ga0157380_100673233	256
157	3300014326	Ga0157380_10073060	Ga0157380_100730602	256
158	3300014326	Ga0157380_10152624	Ga0157380_101526242	256
159	3300014968	Ga0157379_10095354	Ga0157379_100953542	256
160	3300014969	Ga0157376_10150401	Ga0157376_101504012	256
161	3300017792	Ga0163161_10003185	Ga0163161_100031859	256
162	3300025885	Ga0207653_10043170	Ga0207653_100431702	256
163	3300025898	Ga0207692_10025374	Ga0207692_100253742	256
164	3300025899	Ga0207642_10002351	Ga0207642_100023513	256
165	3300025901	Ga0207688_10036406	Ga0207688_100364062	256
166	3300025906	Ga0207699_10062764	Ga0207699_100627642	256
167	3300025907	Ga0207645_10024242	Ga0207645_100242423	256
168	3300025911	Ga0207654_10115139	Ga0207654_101151392	256
169	3300025911	Ga0207654_10141630	Ga0207654_101416302	256
170	3300025915	Ga0207693_10016840	Ga0207693_100168403	256
171	3300025915	Ga0207693_10066256	Ga0207693_100662562	256
172	3300025916	Ga0207663_10022197	Ga0207663_100221973	256
173	3300025916	Ga0207663_10070726	Ga0207663_100707262	256
174	3300025918	Ga0207662_10056828	Ga0207662_100568282	256
175	3300025925	Ga0207650_10222834	Ga0207650_102228342	256
176	3300025927	Ga0207687_10057209	Ga0207687_100572092	256
177	3300025933	Ga0207706_10023112	Ga0207706_100231123	256
178	3300025934	Ga0207686_10004101	Ga0207686_100041015	256
179	3300025934	Ga0207686_10323697	Ga0207686_103236971	256
180	3300025935	Ga0207709_10165242	Ga0207709_101652422	256
181	3300025937	Ga0207669_10000773	Ga0207669_100007732	256
182	3300025938	Ga0207704_10013114	Ga0207704_100131142	256
183	3300025939	Ga0207665_10008931	Ga0207665_100089313	256
184	3300025939	Ga0207665_10013707	Ga0207665_100137072	256
185	3300025949	Ga0207667_10203936	Ga0207667_102039362	256
186	3300025949	Ga0207667_10233312	Ga0207667_102333122	256
187	3300025972	Ga0207668_10228589	Ga0207668_102285892	256
188	3300025972	Ga0207668_10297185	Ga0207668_102971852	256
189	3300025981	Ga0207640_10010322	Ga0207640_100103223	256
190	3300025986	Ga0207658_10003281	Ga0207658_100032816	256
191	3300025986	Ga0207658_10314659	Ga0207658_103146592	256
192	3300026023	Ga0207677_10026262	Ga0207677_100262622	256
193	3300026035	Ga0207703_10318013	Ga0207703_103180132	256
194	3300026075	Ga0207708_10014981	Ga0207708_100149813	256
195	3300026088	Ga0207641_10009626	Ga0207641_100096263	256
196	3300026089	Ga0207648_10072564	Ga0207648_100725642	256
197	3300026089	Ga0207648_10188438	Ga0207648_101884382	256
198	3300026095	Ga0207676_10023913	Ga0207676_100239134	256
199	3300026118	Ga0207675_100012231	Ga0207675_1000122314	256
200	3300026121	Ga0207683_10000256	Ga0207683_100002565	256
201	3300026121	Ga0207683_10012325	Ga0207683_100123254	256
202	3300028379	Ga0268266_10022643	Ga0268266_100226433	256
203	3300028380	Ga0268265_10095132	Ga0268265_100951322	256
204	3300028380	Ga0268265_10243201	Ga0268265_102432011	256
205	3300028381	Ga0268264_10306770	Ga0268264_103067702	256
206	3300035242	Ga0373962_0027337	Ga0373962_0027337_383_1201	256
207	3300035691	Ga0373931_0170702	Ga0373931_0170702_227_1051	256
208	3300041411	Ga0439466_0018120	Ga0439466_0018120_1502_2320	256
209	3300041413	Ga0439465_0016932	Ga0439465_0016932_984_1805	256
210	3300044901	Ga0466960_0079425	Ga0466960_0079425_508_1332	256
211	3300048905	Ga0496102_0011576	Ga0496102_0011576_4832_5650	256
212	3300048905	Ga0496102_0032658	Ga0496102_0032658_478_1302	256
213	3300048906	Ga0496103_0044128	Ga0496103_0044128_743_1561	256
214	3300048906	Ga0496103_0168423	Ga0496103_0168423_349_1173	256
215	3300048906	Ga0496103_0186811	Ga0496103_0186811_356_1174	256
216	3300048907	Ga0496104_0111062	Ga0496104_0111062_653_1471	256
217	3300048907	Ga0496104_0192602	Ga0496104_0192602_691_1512	256
218	3300048908	Ga0496105_0275685	Ga0496105_0275685_127_945	256
219	3300048909	Ga0496106_0016043	Ga0496106_0016043_4362_5186	256
220	3300048910	Ga0496107_0105984	Ga0496107_0105984_159_983	256
221	3300048911	Ga0496108_0000691	Ga0496108_0000691_6651_7469	256
222	3300048911	Ga0496108_0136390	Ga0496108_0136390_244_1065	256
223	3300048911	Ga0496108_0731508	Ga0496108_0731508_13_843	256
224	3300048912	Ga0496109_0001943	Ga0496109_0001943_3031_3849	256
225	3300048912	Ga0496109_0044732	Ga0496109_0044732_2978_3799	256
226	3300048912	Ga0496109_0136949	Ga0496109_0136949_947_1765	256
227	3300048913	Ga0496110_0239510	Ga0496110_0239510_64_888	256
228	3300048913	Ga0496110_0258419	Ga0496110_0258419_733_1551	256
229	3300048915	Ga0496112_0148213	Ga0496112_0148213_195_1016	256
230	3300048915	Ga0496112_0295977	Ga0496112_0295977_395_1213	256
231	3300048916	Ga0496113_0306365	Ga0496113_0306365_111_929	256
232	3300048916	Ga0496113_0470277	Ga0496113_0470277_69_890	256
233	3300048917	Ga0496114_0138612	Ga0496114_0138612_1170_1988	256
234	3300048917	Ga0496114_0255205	Ga0496114_0255205_442_1266	256
235	3300048918	Ga0496115_0006664	Ga0496115_0006664_1011_1829	256
236	3300049573	Ga0501037_0172929	Ga0501037_0172929_506_1324	256
237	3300049580	Ga0501046_0010608	Ga0501046_0010608_6634_7452	256
238	3300049823	Ga0501044_0024288	Ga0501044_0024288_2597_3415	256
239	3300050490	nmdc:mga03n38_189157_c1	nmdc:mga03n38_189157_c1_67_885	256
240	3300050508	nmdc:mga09592_20115_c1	nmdc:mga09592_20115_c1_2277_3095	256
241	3300003316	rootH1_10105108	rootH1_101051081	257
242	3300003322	rootL2_10176008	rootL2_101760081	257
243	3300003322	rootL2_10176009	rootL2_101760091	257
244	3300005327	Ga0070658_10002091	Ga0070658_100020917	257
245	3300005337	Ga0070682_100377017	Ga0070682_1003770172	257
246	3300005535	Ga0070684_100158319	Ga0070684_1001583192	257
247	3300005548	Ga0070665_100289894	Ga0070665_1002898943	257
248	3300005843	Ga0068860_100169290	Ga0068860_1001692902	257
249	3300005983	Ga0081540_1005682	Ga0081540_10056823	257
250	3300006048	Ga0075363_100003971	Ga0075363_1000039714	257
251	3300006048	Ga0075363_100111110	Ga0075363_1001111102	257
252	3300006051	Ga0075364_10002095	Ga0075364_100020952	257
253	3300006051	Ga0075364_10061489	Ga0075364_100614892	257
254	3300006177	Ga0075362_10034843	Ga0075362_100348432	257
255	3300006186	Ga0075369_10003092	Ga0075369_100030922	257
256	3300006186	Ga0075369_10012088	Ga0075369_100120883	257
257	3300006186	Ga0075369_10035310	Ga0075369_100353102	257
258	3300006353	Ga0075370_10030211	Ga0075370_100302113	257
259	3300009147	Ga0114129_10041961	Ga0114129_100419614	257
260	3300013306	Ga0163162_10352812	Ga0163162_103528122	257
261	3300017792	Ga0163161_10279523	Ga0163161_102795231	257
262	3300025303	Ga0209051_1027280	Ga0209051_10272802	257
263	3300025909	Ga0207705_10016712	Ga0207705_100167122	257
264	3300025972	Ga0207668_10602035	Ga0207668_106020351	257
265	3300031507	Ga0307509_10004174	Ga0307509_1000417420	257
266	3300031727	Ga0316576_10004465	Ga0316576_1000446511	257
267	3300031727	Ga0316576_10370618	Ga0316576_103706182	257
268	3300031730	Ga0307516_10055587	Ga0307516_100555872	257
269	3300035398	Ga0316574_0001322	Ga0316574_0001322_4611_5525	257
270	3300035692	Ga0373935_0215390	Ga0373935_0215390_32_853	257
271	3300036647	Ga0316582_0195462	Ga0316582_0195462_151_972	257
272	3300036712	Ga0316584_0205840	Ga0316584_0205840_458_1345	257
273	3300039437	Ga0436365_0720134	Ga0436365_0720134_1836_2657	257
274	3300041443	Ga0451789_0711768	Ga0451789_0711768_149_976	257
275	3300041452	Ga0451793_1566532	Ga0451793_1566532_174_998	257
276	3300041491	Ga0451833_0374173	Ga0451833_0374173_2269_3093	257
277	3300041494	Ga0451837_0484099	Ga0451837_0484099_58_882	257
278	3300042876	Ga0451577_0002082	Ga0451577_0002082_14776_15678	257
279	3300044712	Ga0453684_0151765	Ga0453684_0151765_1021_1923	257
280	3300044842	Ga0466957_0161697	Ga0466957_0161697_466_1296	257
281	3300044901	Ga0466960_0072494	Ga0466960_0072494_202_1029	257
282	3300045051	Ga0451576_0537240	Ga0451576_0537240_392_1216	257
283	3300045976	Ga0466967_0599419	Ga0466967_0599419_108_935	257
284	3300046460	Ga0495638_0020343	Ga0495638_0020343_2455_3288	257
285	3300046694	Ga0495649_0165208	Ga0495649_0165208_198_1019	257
286	3300047320	Ga0495672_0098163	Ga0495672_0098163_116_937	257
287	3300047472	Ga0495686_0132496	Ga0495686_0132496_570_1403	257
288	3300048915	Ga0496112_0192149	Ga0496112_0192149_295_1116	257
289	3300048917	Ga0496114_0380728	Ga0496114_0380728_83_907	257
290	3300049571	Ga0501034_0402226	Ga0501034_0402226_434_1255	257
291	3300050489	nmdc:mga03683_36636_c1	nmdc:mga03683_36636_c1_702_1523	257
292	3300050490	nmdc:mga03n38_3762_c1	nmdc:mga03n38_3762_c1_2597_3418	257
293	3300050490	nmdc:mga03n38_42280_c1	nmdc:mga03n38_42280_c1_923_1744	257
294	3300050491	nmdc:mga00v17_952_c1	nmdc:mga00v17_952_c1_8376_9197	257
295	3300050492	nmdc:mga0yw44_10581_c1	nmdc:mga0yw44_10581_c1_14_835	257
296	3300050496	nmdc:mga07m45_29145_c1	nmdc:mga07m45_29145_c1_957_1778	257
297	3300050507	nmdc:mga05p37_16428_c1	nmdc:mga05p37_16428_c1_3581_4408	257
298	3300050516	nmdc:mga0sz30_4246_c1	nmdc:mga0sz30_4246_c1_697_1518	257
299	3300053087	Ga0500643_004564	Ga0500643_004564_3174_4007	257
300	3300053158	Ga0500627_0054834	Ga0500627_0054834_878_1711	257
301	iso_pu_bacteria	2738541274	2738704449	257
302	2162886007	SwRhRL2b_contig_636892	SwRhRL2b_0014.00004810	258
303	3300002737	JGI25162J39368_1000077	JGI25162J39368_100007788	258
304	3300002771	JGI25163J39215_1000061	JGI25163J39215_100006113	258
305	3300002772	JGI25164J39214_1000054	JGI25164J39214_100005488	258
306	3300003214	JGI25165J46597_1000141	JGI25165J46597_100014188	258
307	3300005289	Ga0065704_10070431	Ga0065704_1007043128	258
308	3300005289	Ga0065704_10120980	Ga0065704_101209803	258
309	3300005327	Ga0070658_10058967	Ga0070658_100589672	258
310	3300005344	Ga0070661_100517041	Ga0070661_1005170411	258
311	3300005435	Ga0070714_100071688	Ga0070714_1000716882	258
312	3300005435	Ga0070714_100245227	Ga0070714_1002452272	258
313	3300005441	Ga0070700_100000909	Ga0070700_1000009098	258
314	3300005455	Ga0070663_100543519	Ga0070663_1005435191	258
315	3300005563	Ga0068855_100001083	Ga0068855_10000108322	258
316	3300005577	Ga0068857_100244638	Ga0068857_1002446384	258
317	3300005617	Ga0068859_100004637	Ga0068859_1000046379	258
318	3300006051	Ga0075364_10021733	Ga0075364_100217334	258
319	3300006844	Ga0075428_100620518	Ga0075428_1006205182	258
320	3300006847	Ga0075431_100354319	Ga0075431_1003543192	258
321	3300006931	Ga0097620_100004637	Ga0097620_1000046379	258
322	3300009036	Ga0105244_10021495	Ga0105244_100214952	258
323	3300009093	Ga0105240_10549463	Ga0105240_105494632	258
324	3300009101	Ga0105247_10028560	Ga0105247_100285603	258
325	3300009148	Ga0105243_10000125	Ga0105243_1000012533	258
326	3300009148	Ga0105243_10157258	Ga0105243_101572583	258
327	3300013102	Ga0157371_10000463	Ga0157371_1000046333	258
328	3300013104	Ga0157370_10089334	Ga0157370_100893343	258
329	3300013104	Ga0157370_10384586	Ga0157370_103845862	258
330	3300013307	Ga0157372_10000172	Ga0157372_1000017228	258
331	3300014497	Ga0182008_10008985	Ga0182008_100089854	258
332	3300014969	Ga0157376_10318945	Ga0157376_103189452	258
333	3300021388	Ga0213875_10020267	Ga0213875_100202671	258
334	3300025207	Ga0209760_100054	Ga0209760_10005413	258
335	3300025231	Ga0207427_100074	Ga0207427_10007432	258
336	3300025233	Ga0209437_100006	Ga0209437_10000633	258
337	3300025261	Ga0209233_1000105	Ga0209233_100010514	258
338	3300025900	Ga0207710_10137928	Ga0207710_101379281	258
339	3300025922	Ga0207646_10396466	Ga0207646_103964661	258
340	3300025935	Ga0207709_10000282	Ga0207709_100002829	258
341	3300025935	Ga0207709_10099027	Ga0207709_100990273	258
342	3300025949	Ga0207667_10095308	Ga0207667_100953084	258
343	3300026075	Ga0207708_10000014	Ga0207708_100000147	258
344	3300026116	Ga0207674_10223654	Ga0207674_102236541	258
345	3300031727	Ga0316576_10029260	Ga0316576_100292604	258
346	3300032133	Ga0316583_10011583	Ga0316583_100115834	258
347	3300041411	Ga0439466_0029563	Ga0439466_0029563_98_925	258
348	3300042013	Ga0439456_000024	Ga0439456_000024_14013_14840	258
349	3300042013	Ga0439456_040217	Ga0439456_040217_47_874	258
350	3300042016	Ga0439463_002022	Ga0439463_002022_1179_2006	258
351	3300042139	Ga0450904_000010	Ga0450904_000010_27297_28205	258
352	3300042993	Ga0439440_0008393	Ga0439440_0008393_605_1432	258
353	3300044901	Ga0466960_0038710	Ga0466960_0038710_13_837	258
354	3300046515	Ga0495620_0000037	Ga0495620_0000037_16057_16878	258
355	3300046519	Ga0495632_0000376	Ga0495632_0000376_23392_24213	258
356	3300046522	Ga0495643_0000049	Ga0495643_0000049_165068_165889	258
357	3300046522	Ga0495643_0002114	Ga0495643_0002114_10537_11358	258
358	3300046524	Ga0495648_0002549	Ga0495648_0002549_12868_13695	258
359	3300046524	Ga0495648_0004207	Ga0495648_0004207_11233_12054	258
360	3300046524	Ga0495648_0160316	Ga0495648_0160316_65_892	258
361	3300046530	Ga0495654_0047331	Ga0495654_0047331_575_1396	258
362	3300046530	Ga0495654_0122576	Ga0495654_0122576_84_911	258
363	3300046648	Ga0495611_0126075	Ga0495611_0126075_124_948	258
364	3300046660	Ga0495625_0151933	Ga0495625_0151933_725_1546	258
365	3300046692	Ga0495671_0008424	Ga0495671_0008424_2435_3256	258
366	3300046694	Ga0495649_0029782	Ga0495649_0029782_1807_2628	258
367	3300047320	Ga0495672_0009816	Ga0495672_0009816_3274_4101	258
368	3300047322	Ga0495680_0127854	Ga0495680_0127854_464_1294	258
369	3300047470	Ga0495681_0016130	Ga0495681_0016130_2127_2948	258
370	3300047470	Ga0495681_0022506	Ga0495681_0022506_1747_2574	258
371	3300047472	Ga0495686_0042045	Ga0495686_0042045_887_1708	258
372	3300048088	Ga0495602_0249084	Ga0495602_0249084_176_1006	258
373	3300048905	Ga0496102_0000079	Ga0496102_0000079_114168_115004	258
374	3300048906	Ga0496103_0000034	Ga0496103_0000034_153274_154110	258
375	3300048908	Ga0496105_0054808	Ga0496105_0054808_1414_2241	258
376	3300048913	Ga0496110_0055499	Ga0496110_0055499_1856_2683	258
377	3300048917	Ga0496114_0061831	Ga0496114_0061831_1648_2475	258
378	3300048918	Ga0496115_0065422	Ga0496115_0065422_63_890	258
379	3300048919	Ga0496116_0000168	Ga0496116_0000168_34255_35082	258
380	3300048919	Ga0496116_0138526	Ga0496116_0138526_505_1326	258
381	3300048920	Ga0496117_0000731	Ga0496117_0000731_43310_44140	258
382	3300048920	Ga0496117_0008714	Ga0496117_0008714_494_1315	258
383	3300048920	Ga0496117_0009101	Ga0496117_0009101_3978_4805	258
384	3300048921	Ga0496118_0014967	Ga0496118_0014967_1160_1990	258
385	3300048921	Ga0496118_0053782	Ga0496118_0053782_1776_2612	258
386	3300048923	Ga0496120_0106724	Ga0496120_0106724_474_1310	258
387	3300048923	Ga0496120_0125312	Ga0496120_0125312_447_1274	258
388	3300048924	Ga0496121_0000199	Ga0496121_0000199_97454_98281	258
389	3300048925	Ga0496122_0003616	Ga0496122_0003616_1425_2252	258
390	3300048926	Ga0496123_0000999	Ga0496123_0000999_18984_19811	258
391	3300048928	Ga0496125_0013990	Ga0496125_0013990_552_1382	258
392	3300048929	Ga0496126_0005883	Ga0496126_0005883_10527_11357	258
393	3300048929	Ga0496126_0061809	Ga0496126_0061809_1982_2812	258
394	3300048929	Ga0496126_0221072	Ga0496126_0221072_223_1050	258
395	3300049853	Ga0501226_000070	Ga0501226_000070_16878_17750	258
396	3300050491	nmdc:mga00v17_142327_c1	nmdc:mga00v17_142327_c1_121_951	258
397	3300050491	nmdc:mga00v17_70660_c1	nmdc:mga00v17_70660_c1_854_1681	258
398	3300050510	nmdc:mga06r32_437254_c1	nmdc:mga06r32_437254_c1_357_1187	258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

88

186

0.94 PF08242

Methyltransf_12

Methyltransferase domain

88

184

0.91 PF13649

Methyltransf_25

Methyltransferase domain

88

182

0.89 PF13847

Methyltransf_31

Methyltransferase domain

81

238

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3mgg-assembly1.cif.gz_A	crystal structure of methyl transferase from methanosarcina mazei	0.8645	52	160
7wm6-assembly1.cif.gz_B	crystal structure of sah-bound trmm from mycoplasma capricolum	0.8573	55	256
7wm5-assembly1.cif.gz_A-2	crystal structure of apo trmm from mycoplasma capricolum	0.8436	55	256
3cgg-assembly2.cif.gz_B	crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution	0.8341	52	258
3lbf-assembly3.cif.gz_C	crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli	0.8257	53	157

ID	Description	Score	Start	End	Superfamily
af_Q55DF6_53_245_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8996	46	107	3.40.50.150
af_Q50584_122_315_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8948	49	153	3.40.50.150
af_A0A1D6QMW6_179_313_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8786	57	155	3.40.50.150
3mggA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.867	52	155	3.40.50.150
af_P9WIN3_42_264_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8658	46	160	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A7D5UZZ5-F1-model_v4	Methyltransferase type 12 domain-containing protein	0.9928	2	258
AF-A0A7D5UZZ5-F1-model_v4	Methyltransferase type 12 domain-containing protein	0.9852	2	258
AF-A0A852X5Q9-F1-model_v4	SAM-dependent methyltransferase	0.9805	2	258	GO:0008168 GO:0032259
AF-A0A852X5Q9-F1-model_v4	SAM-dependent methyltransferase	0.973	2	258	GO:0008168 GO:0032259
AF-A0A4T0WCR4-F1-model_v4	Putative MFS-type transporter C18.02	0.9723	2	257	GO:0008757 GO:0016020 GO:0022857

Feature Viewer

pLDDT	pTM	Quality
96.36	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F434087

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08241

Methyltransf_11

Methyltransferase domain

88

186

0.94

PF08242

Methyltransf_12

Methyltransferase domain

88

184

0.91

PF13649

Methyltransf_25

Methyltransferase domain

88

182

0.89

PF13847

Methyltransf_31

Methyltransferase domain

81

238

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map