F434083

General Info

Members Datasets Scaffolds Average Seq Length
398 241 796 205

Family's Representative Sequence

Representative Sequence 3300035114|Ga0373939_0021070|Ga0373939_0021070_151_894
Length 247
Sequence MPLQNRVTPFGEFIATSARGILMGNRGGRLHDAQRKLGARRWASKQWICCWLEFKGRHRDVWGDSYTELFFLDEVTAFAVGHRPCFECRREEAARFAKLFSGTDPNSARSHASGNPESQSQRYEILALGPRFRGHEWIAGKRAIAAAMDKLLHAERLDGKGKRLHRRLIDGLPDGAMIAREGEAYAVRGNRLLPWTPAGYGAAVPRPRGMAVDVLTPPSILAVLSAGYRPLWHASADAAGRRNFALD

Samples

Sample ID Description Type Environment
1 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 0
Rhizoplane 5.78
Rhizosphere 85.18
Stem 0
Stem Tuber 0
Unclassified 15.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373939_0021070 3300035114 Bacteria 1780
2 JGI25153J46596_10009294 3300003215 Bacteria 4594
3 Ga0065712_10088792 3300005290 Unclassified 2477
4 Ga0070658_10009737 3300005327 Bacteria 7718
5 Ga0070683_100579644 3300005329 Bacteria 1073
6 Ga0070690_100094780 3300005330 Unclassified 1970
7 Ga0070670_100006191 3300005331 Bacteria 10116
8 Ga0070680_100007994 3300005336 Bacteria 8075
9 Ga0070680_100086831 3300005336 Bacteria 2586
10 Ga0068868_100083117 3300005338 Bacteria 2570
11 Ga0070691_10028211 3300005341 Bacteria 2622
12 Ga0070687_100606335 3300005343 Bacteria 753
13 Ga0070661_100075301 3300005344 Bacteria 2487
14 Ga0070668_100670931 3300005347 Bacteria 912
15 Ga0070673_100311881 3300005364 Unclassified 1388
16 Ga0070673_100839198 3300005364 Bacteria 850
17 Ga0070659_100242584 3300005366 Unclassified 1492
18 Ga0070714_100019407 3300005435 Bacteria 5538
19 Ga0070714_100082248 3300005435 Unclassified 2805
20 Ga0070714_100217852 3300005435 Bacteria 1753
21 Ga0070713_100179866 3300005436 Unclassified 1900
22 Ga0070713_100348246 3300005436 Bacteria 1374
23 Ga0070713_100476573 3300005436 Bacteria 1175
24 Ga0070711_100311153 3300005439 Unclassified 1255
25 Ga0070705_100083620 3300005440 Bacteria 1967
26 Ga0070705_100564741 3300005440 Unclassified 875
27 Ga0070694_100023467 3300005444 Bacteria 3968
28 Ga0070708_100455163 3300005445 Bacteria 1207
29 Ga0070663_100039179 3300005455 Bacteria 3310
30 Ga0070678_100132719 3300005456 Unclassified 1981
31 Ga0070662_100004931 3300005457 Bacteria 8482
32 Ga0070662_100110112 3300005457 Bacteria 2097
33 Ga0070681_10049026 3300005458 Bacteria 4218
34 Ga0070681_10054713 3300005458 Bacteria 3976
35 Ga0070681_10064707 3300005458 Bacteria 3627
36 Ga0070681_10199354 3300005458 Bacteria 1920
37 Ga0068867_100292226 3300005459 Bacteria 1340
38 Ga0070707_100571185 3300005468 Unclassified 1093
39 Ga0070699_100457224 3300005518 Bacteria 1158
40 Ga0070679_100132074 3300005530 Unclassified 2477
41 Ga0070679_100397305 3300005530 Bacteria 1324
42 Ga0070679_101036825 3300005530 Bacteria 764
43 Ga0070695_100332450 3300005545 Bacteria 1133
44 Ga0070695_100500259 3300005545 Unclassified 940
45 Ga0070693_100375185 3300005547 Bacteria 980
46 Ga0070704_100361057 3300005549 Bacteria 1229
47 Ga0068855_100076905 3300005563 Bacteria 3873
48 Ga0068855_100588719 3300005563 Bacteria 1201
49 Ga0068855_101382121 3300005563 Bacteria 726
50 Ga0070664_100299524 3300005564 Unclassified 1453
51 Ga0068857_100318837 3300005577 Bacteria 1435
52 Ga0068856_100172367 3300005614 Unclassified 2176
53 Ga0070702_100717790 3300005615 Bacteria 764
54 Ga0068859_100972077 3300005617 Bacteria 932
55 Ga0068866_10242209 3300005718 Bacteria 1099
56 Ga0068861_100414875 3300005719 Bacteria 1198
57 Ga0068858_100178268 3300005842 Unclassified 2006
58 Ga0068860_100446681 3300005843 Bacteria 1285
59 Ga0068860_100573457 3300005843 Bacteria 1132
60 Ga0070717_10084083 3300006028 Bacteria 2677
61 Ga0075365_10111115 3300006038 Bacteria 1883
62 Ga0075368_10065352 3300006042 Bacteria 1461
63 Ga0075363_100072469 3300006048 Bacteria 1873
64 Ga0075363_100077270 3300006048 Unclassified 1816
65 Ga0075363_100126822 3300006048 Bacteria 1429
66 Ga0075364_10542893 3300006051 Unclassified 795
67 Ga0070715_10048545 3300006163 Bacteria 1815
68 Ga0075362_10010918 3300006177 Bacteria 3563
69 Ga0075362_10317572 3300006177 Bacteria 775
70 Ga0075367_10089126 3300006178 Bacteria 1875
71 Ga0075367_10182255 3300006178 Bacteria 1309
72 Ga0075367_10448610 3300006178 Bacteria 817
73 Ga0075369_10028769 3300006186 Bacteria 2331
74 Ga0075366_10072333 3300006195 Bacteria 2054
75 Ga0097621_100138258 3300006237 Unclassified 2080
76 Ga0097621_100302270 3300006237 Bacteria 1413
77 Ga0075370_10249200 3300006353 Bacteria 1052
78 Ga0068871_100303657 3300006358 Unclassified 1401
79 Ga0097620_100972072 3300006931 Bacteria 932
80 Ga0099794_10259328 3300007265 Bacteria 897
81 Ga0105240_10931920 3300009093 Bacteria 933
82 Ga0105245_10181868 3300009098 Unclassified 2009
83 Ga0105245_11697678 3300009098 Bacteria 684
84 Ga0105242_10019180 3300009176 Bacteria 5358
85 Ga0105248_10182640 3300009177 Bacteria 2364
86 Ga0105248_10193555 3300009177 Bacteria 2291
87 Ga0105248_11000818 3300009177 Bacteria 944
88 Ga0105237_10121953 3300009545 Unclassified 2601
89 Ga0105237_10473890 3300009545 Bacteria 1258
90 Ga0105238_10079541 3300009551 Bacteria 3268
91 Ga0157370_10120088 3300013104 Bacteria 2454
92 Ga0157378_10096369 3300013297 Bacteria 2696
93 Ga0163162_10099346 3300013306 Bacteria 3001
94 Ga0163162_10573320 3300013306 Bacteria 1256
95 Ga0157375_10173417 3300013308 Unclassified 2305
96 Ga0163163_11435438 3300014325 Unclassified 752
97 Ga0157379_10063147 3300014968 Bacteria 3312
98 Ga0157379_10459903 3300014968 Bacteria 1176
99 Ga0157376_10144776 3300014969 Bacteria 2136
100 Ga0213874_10017706 3300021377 Bacteria 1915
101 Ga0209758_1000772 3300025297 Bacteria 45993
102 Ga0207685_10024235 3300025905 Unclassified 2078
103 Ga0207705_10008036 3300025909 Bacteria 7734
104 Ga0207707_10061863 3300025912 Bacteria 3258
105 Ga0207707_10111203 3300025912 Bacteria 2395
106 Ga0207707_10204837 3300025912 Bacteria 1719
107 Ga0207707_10245546 3300025912 Bacteria 1555
108 Ga0207707_10536523 3300025912 Bacteria 995
109 Ga0207671_10351379 3300025914 Bacteria 1169
110 Ga0207693_10035384 3300025915 Bacteria 3938
111 Ga0207693_10177722 3300025915 Unclassified 1675
112 Ga0207663_10158809 3300025916 Unclassified 1593
113 Ga0207660_10191841 3300025917 Bacteria 1591
114 Ga0207660_10320103 3300025917 Bacteria 1238
115 Ga0207649_10175916 3300025920 Unclassified 1494
116 Ga0207652_10046940 3300025921 Bacteria 3688
117 Ga0207652_10053861 3300025921 Bacteria 3456
118 Ga0207652_10118827 3300025921 Bacteria 2350
119 Ga0207687_10125564 3300025927 Bacteria 1926
120 Ga0207687_10321005 3300025927 Unclassified 1254
121 Ga0207700_10053038 3300025928 Bacteria 3036
122 Ga0207700_10337523 3300025928 Unclassified 1309
123 Ga0207664_10137443 3300025929 Unclassified 2064
124 Ga0207690_10148852 3300025932 Unclassified 1734
125 Ga0207706_10081044 3300025933 Bacteria 2852
126 Ga0207706_10081581 3300025933 Bacteria 2842
127 Ga0207709_10089560 3300025935 Bacteria 2007
128 Ga0207669_10034071 3300025937 Bacteria 2882
129 Ga0207704_10154142 3300025938 Bacteria 1626
130 Ga0207665_10086997 3300025939 Unclassified 2159
131 Ga0207691_10139739 3300025940 Bacteria 2135
132 Ga0207691_10533273 3300025940 Unclassified 996
133 Ga0207711_10034256 3300025941 Bacteria 4301
134 Ga0207679_10033200 3300025945 Bacteria 3630
135 Ga0207679_10309891 3300025945 Bacteria 1363
136 Ga0207667_10358892 3300025949 Bacteria 1486
137 Ga0207668_10697635 3300025972 Bacteria 892
138 Ga0207703_10368727 3300026035 Unclassified 1326
139 Ga0207678_10189922 3300026067 Unclassified 1755
140 Ga0207678_10228260 3300026067 Bacteria 1594
141 Ga0207702_11008902 3300026078 Bacteria 826
142 Ga0207675_100490142 3300026118 Bacteria 1222
143 Ga0207683_10002930 3300026121 Bacteria 14877
144 Ga0209813_10100503 3300027866 Bacteria 983
145 Ga0268266_10099205 3300028379 Bacteria 2564
146 Ga0268265_11028944 3300028380 Bacteria 815
147 Ga0268264_10086253 3300028381 Bacteria 2697
148 Ga0265760_10025754 3300031090 Bacteria 1719
149 Ga0265330_10098495 3300031235 Unclassified 1252
150 Ga0265332_10048824 3300031238 Bacteria 1820
151 Ga0265325_10003249 3300031241 Bacteria 10694
152 Ga0265325_10017700 3300031241 Bacteria 3957
153 Ga0265325_10081927 3300031241 Unclassified 1602
154 Ga0265329_10021899 3300031242 Bacteria 2142
155 Ga0265339_10006395 3300031249 Bacteria 7737
156 Ga0265331_10023490 3300031250 Bacteria 3132
157 Ga0265316_10167913 3300031344 Bacteria 1638
158 Ga0307408_100371829 3300031548 Bacteria 1219
159 Ga0265313_10004421 3300031595 Bacteria 10830
160 Ga0265313_10016641 3300031595 Bacteria 4219
161 Ga0265313_10020522 3300031595 Bacteria 3643
162 Ga0265314_10005898 3300031711 Bacteria 10954
163 Ga0265314_10036730 3300031711 Bacteria 3556
164 Ga0265314_10051521 3300031711 Bacteria 2867
165 Ga0265342_10000348 3300031712 Bacteria 51971
166 Ga0265342_10219741 3300031712 Bacteria 1024
167 Ga0307412_10447048 3300031911 Bacteria 1064
168 Ga0373950_0005867 3300034818 Bacteria 1850
169 Ga0373934_0005467 3300035086 Bacteria 4702
170 Ga0373934_0287843 3300035086 Bacteria 681
171 Ga0373940_0063864 3300035088 Bacteria 1059
172 Ga0373932_0017733 3300035112 Unclassified 1832
173 Ga0373941_0000127 3300035115 Bacteria 13252
174 Ga0373941_0091376 3300035115 Bacteria 1045
175 Ga0373945_0065840 3300035116 Bacteria 1361
176 Ga0373953_0007362 3300035117 Bacteria 3683
177 Ga0373954_0005195 3300035118 Bacteria 5624
178 Ga0373954_0013930 3300035118 Bacteria 3584
179 Ga0373956_0004015 3300035119 Bacteria 5912
180 Ga0373957_0005302 3300035120 Bacteria 3990
181 Ga0373943_0428239 3300035170 Unclassified 766
182 Ga0373955_0015696 3300035172 Bacteria 3714
183 Ga0373962_0134496 3300035242 Bacteria 798
184 Ga0373924_0002141 3300035410 Bacteria 6611
185 Ga0373931_0383890 3300035691 Bacteria 886
186 Ga0373935_0018433 3300035692 Bacteria 4245
187 Ga0373935_0259961 3300035692 Unclassified 1217
188 Ga0373927_0408376 3300035695 Bacteria 896
189 Ga0373927_0494305 3300035695 Unclassified 808
190 Ga0373933_0146677 3300035724 Unclassified 1492
191 Ga0373933_0158005 3300035724 Bacteria 1439
192 Ga0373947_0051623 3300035725 Bacteria 2474
193 Ga0373947_0711846 3300035725 Bacteria 685
194 Ga0373937_0001465 3300036401 Bacteria 19748
195 Ga0373937_0184004 3300036401 Bacteria 1962
196 Ga0373925_0053780 3300037068 Bacteria 3011
197 Ga0373925_0068055 3300037068 Bacteria 2686
198 Ga0436363_0025657 3300039450 Bacteria 3302
199 Ga0466957_0037514 3300044842 Bacteria 2918
200 Ga0466958_0537415 3300045836 Bacteria 759
201 Ga0495592_0080662 3300046454 Unclassified 2353
202 Ga0495603_0442382 3300046455 Bacteria 744
203 Ga0495629_0129055 3300046459 Bacteria 1761
204 Ga0495638_0073488 3300046460 Bacteria 2087
205 Ga0495651_0001857 3300046462 Bacteria 16336
206 Ga0495651_0238953 3300046462 Bacteria 1247
207 Ga0495651_0312786 3300046462 Bacteria 1050
208 Ga0495653_0008003 3300046463 Bacteria 8656
209 Ga0495653_0094570 3300046463 Bacteria 2177
210 Ga0495582_0084945 3300046473 Unclassified 1760
211 Ga0495662_0220764 3300046476 Unclassified 934
212 Ga0495664_0056525 3300046477 Bacteria 2334
213 Ga0495594_0095598 3300046499 Bacteria 1669
214 Ga0495608_0001353 3300046511 Bacteria 17459
215 Ga0495618_0002672 3300046514 Bacteria 11360
216 Ga0495628_0377517 3300046516 Unclassified 1038
217 Ga0495630_0581646 3300046517 Unclassified 858
218 Ga0495652_0036863 3300046529 Bacteria 4246
219 Ga0495652_0050044 3300046529 Plasmid 3575
220 Ga0495640_0030796 3300046533 Bacteria 3837
221 Ga0495640_0191042 3300046533 Bacteria 1301
222 Ga0495586_0002589 3300046535 Bacteria 9783
223 Ga0495586_0393207 3300046535 Bacteria 798
224 Ga0495587_0026489 3300046536 Bacteria 3535
225 Ga0495587_0064998 3300046536 Bacteria 2131
226 Ga0495645_0049694 3300046543 Bacteria 3053
227 Ga0495622_0010714 3300046557 Bacteria 4231
228 Ga0495667_0001195 3300046559 Bacteria 16946
229 Ga0495667_0024697 3300046559 Bacteria 4048
230 Ga0495634_0215731 3300046642 Unclassified 1186
231 Ga0495635_0007948 3300046663 Bacteria 7410
232 Ga0495635_0253306 3300046663 Bacteria 1186
233 Ga0495635_0382392 3300046663 Bacteria 937
234 Ga0495588_0007837 3300046674 Bacteria 4877
235 Ga0495657_0022860 3300046675 Bacteria 4473
236 Ga0495657_0024002 3300046675 Bacteria 4350
237 Ga0495599_0061173 3300046678 Unclassified 2353
238 Ga0495599_0113381 3300046678 Bacteria 1687
239 Ga0495623_0001587 3300046679 Bacteria 15316
240 Ga0495646_0005460 3300046680 Bacteria 8037
241 Ga0495624_0021906 3300046690 Bacteria 4232
242 Ga0495624_0106229 3300046690 Bacteria 1727
243 Ga0495624_0260567 3300046690 Bacteria 1048
244 Ga0495600_0009343 3300046809 Bacteria 6055
245 Ga0495600_0183107 3300046809 Bacteria 1350
246 Ga0495581_0007500 3300047315 Bacteria 6309
247 Ga0495581_0136721 3300047315 Bacteria 1429
248 Ga0495604_0092463 3300047317 Unclassified 2240
249 Ga0495604_0566513 3300047317 Bacteria 731
250 Ga0495674_0031850 3300047319 Bacteria 4784
251 Ga0495674_0116680 3300047319 Bacteria 2258
252 Ga0495674_0128551 3300047319 Unclassified 2136
253 Ga0495680_0004460 3300047322 Bacteria 13384
254 Ga0495675_0000639 3300047444 Bacteria 22286
255 Ga0495684_0039706 3300047471 Bacteria 3608
256 Ga0495684_0120290 3300047471 Bacteria 1978
257 Ga0495593_0083298 3300047673 Unclassified 1653
258 Ga0495593_0099839 3300047673 Bacteria 1489
259 Ga0495602_0045156 3300048088 Bacteria 3989
260 Ga0495602_0056284 3300048088 Bacteria 3459
261 Ga0495602_0070791 3300048088 Bacteria 2982
262 Ga0496101_0188625 3300048904 Unclassified 1590
263 Ga0496101_0192513 3300048904 Bacteria 1574
264 Ga0496102_0022335 3300048905 Bacteria 5606
265 Ga0496102_0032067 3300048905 Bacteria 4719
266 Ga0496102_0347100 3300048905 Bacteria 1397
267 Ga0496102_0348180 3300048905 Bacteria 1395
268 Ga0496103_0312756 3300048906 Bacteria 1010
269 Ga0496105_0035784 3300048908 Bacteria 4089
270 Ga0496106_0104244 3300048909 Bacteria 2202
271 Ga0496106_0131868 3300048909 Bacteria 1960
272 Ga0496106_0244245 3300048909 Bacteria 1435
273 Ga0496106_0361292 3300048909 Bacteria 1166
274 Ga0496107_0005084 3300048910 Bacteria 8966
275 Ga0496108_0032837 3300048911 Bacteria 4311
276 Ga0496109_1005473 3300048912 Unclassified 771
277 Ga0496110_0257521 3300048913 Unclassified 1588
278 Ga0496112_0119139 3300048915 Unclassified 2610
279 Ga0496113_0386514 3300048916 Unclassified 1123
280 Ga0496114_0110726 3300048917 Unclassified 2352
281 Ga0496114_0255365 3300048917 Bacteria 1543
282 Ga0496115_0038891 3300048918 Bacteria 3777
283 Ga0496115_0098116 3300048918 Bacteria 2399
284 Ga0496115_0263784 3300048918 Bacteria 1416
285 Ga0501031_0040207 3300049568 Bacteria 3052
286 Ga0501031_0430876 3300049568 Bacteria 852
287 Ga0501032_0067720 3300049569 Bacteria 2384
288 Ga0501032_0156215 3300049569 Bacteria 1498
289 Ga0501033_0087870 3300049570 Bacteria 2274
290 Ga0501033_0113978 3300049570 Bacteria 1965
291 Ga0501034_0000230 3300049571 Bacteria 105001
292 Ga0501034_0100778 3300049571 Bacteria 2882
293 Ga0501034_0283579 3300049571 Bacteria 1596
294 Ga0501034_0298385 3300049571 Bacteria 1548
295 Ga0501034_0303696 3300049571 Bacteria 1532
296 Ga0501034_0366832 3300049571 Bacteria 1366
297 Ga0501034_0390012 3300049571 Bacteria 1316
298 Ga0501036_0151433 3300049572 Bacteria 1956
299 Ga0501037_0180989 3300049573 Bacteria 1495
300 Ga0501037_0220303 3300049573 Bacteria 1335
301 Ga0501038_0264052 3300049574 Bacteria 1359
302 Ga0501038_0635860 3300049574 Bacteria 804
303 Ga0501039_0042925 3300049575 Bacteria 3493
304 Ga0501039_0105036 3300049575 Bacteria 2205
305 Ga0501039_0107330 3300049575 Bacteria 2181
306 Ga0501040_0350723 3300049576 Bacteria 1057
307 Ga0501043_0054027 3300049579 Bacteria 3154
308 Ga0501043_0078139 3300049579 Bacteria 2600
309 Ga0501043_0480030 3300049579 Bacteria 931
310 Ga0501046_0538172 3300049580 Bacteria 834
311 Ga0501047_0122504 3300049581 Bacteria 2481
312 Ga0501047_0428645 3300049581 Bacteria 1153
313 Ga0501067_0074447 3300049583 Bacteria 1882
314 Ga0501069_0005905 3300049585 Bacteria 6379
315 Ga0501069_0028225 3300049585 Bacteria 3076
316 Ga0501069_0119714 3300049585 Bacteria 1503
317 Ga0501069_0256656 3300049585 Bacteria 1020
318 Ga0501070_0041797 3300049586 Bacteria 3817
319 Ga0501070_0219746 3300049586 Bacteria 1558
320 Ga0501070_0315311 3300049586 Bacteria 1272
321 Ga0501070_0396634 3300049586 Bacteria 1116
322 Ga0501070_0438132 3300049586 Bacteria 1054
323 Ga0501070_0482906 3300049586 Bacteria 996
324 Ga0501070_0482920 3300049586 Bacteria 996
325 Ga0501071_0071715 3300049587 Bacteria 2526
326 Ga0501072_0000464 3300049588 Bacteria 29314
327 Ga0501072_0087328 3300049588 Bacteria 2475
328 Ga0501072_0101284 3300049588 Bacteria 2289
329 Ga0501072_0125254 3300049588 Bacteria 2047
330 Ga0501072_0565496 3300049588 Bacteria 897
331 Ga0501073_0138058 3300049589 Bacteria 1689
332 Ga0501073_0201299 3300049589 Bacteria 1377
333 Ga0501073_0413024 3300049589 Bacteria 932
334 Ga0501073_0556398 3300049589 Bacteria 792
335 Ga0501074_0065260 3300049590 Bacteria 2620
336 Ga0501074_0157681 3300049590 Bacteria 1621
337 Ga0501074_0465137 3300049590 Bacteria 896
338 Ga0501076_0315589 3300049592 Bacteria 1282
339 Ga0501076_1584421 3300049592 Bacteria 537
340 Ga0501077_0041037 3300049593 Bacteria 2947
341 Ga0501079_0089151 3300049741 Bacteria 2388
342 Ga0501079_0643968 3300049741 Bacteria 834
343 Ga0501079_0850208 3300049741 Bacteria 718
344 Ga0501080_0012654 3300049742 Bacteria 7737
345 Ga0501080_0038261 3300049742 Bacteria 4479
346 Ga0501080_0344887 3300049742 Bacteria 1345
347 Ga0501080_0420069 3300049742 Bacteria 1201
348 Ga0501081_0068650 3300049743 Bacteria 2468
349 Ga0501083_0034454 3300049744 Bacteria 3462
350 Ga0501083_0497846 3300049744 Bacteria 793
351 Ga0501083_0695425 3300049744 Bacteria 661
352 Ga0501035_0004713 3300049822 Bacteria 12950
353 Ga0501035_0139155 3300049822 Bacteria 2111
354 Ga0501044_0046583 3300049823 Bacteria 4488
355 Ga0501044_0083306 3300049823 Bacteria 3234
356 Ga0501044_0136833 3300049823 Bacteria 2440
357 Ga0501044_0221633 3300049823 Bacteria 1842
358 Ga0501044_0290481 3300049823 Bacteria 1566
359 Ga0501044_0349635 3300049823 Bacteria 1398
360 Ga0501044_0789336 3300049823 Bacteria 830
361 Ga0501044_0940037 3300049823 Bacteria 738
362 nmdc:mga03n38_467173_c1 3300050490 Bacteria 704
363 nmdc:mga00v17_420491_c1 3300050491 Bacteria 868
364 nmdc:mga00v17_94127_c1 3300050491 Bacteria 1885
365 nmdc:mga0yw44_149277_c1 3300050492 Bacteria 1524
366 nmdc:mga0k408_529800_c1 3300050493 Bacteria 697
367 nmdc:mga06z11_236983_c1 3300050494 Bacteria 1071
368 nmdc:mga04h51_100283_c1 3300050495 Bacteria 1054
369 nmdc:mga04h51_82298_c1 3300050495 Bacteria 1145
370 nmdc:mga08y16_265144_c1 3300050511 Bacteria 1773
371 nmdc:mga0sz30_17764_c1 3300050516 Bacteria 2840
372 Ga0495601_0009363 3300053077 Bacteria 5791
373 Ga0495601_0018400 3300053077 Bacteria 4252
374 Ga0495601_0108724 3300053077 Bacteria 1794
375 Ga0495601_0234366 3300053077 Unclassified 1198
376 Ga0495612_0093952 3300053078 Unclassified 1272
377 Ga0495612_0105900 3300053078 Bacteria 1200
378 Ga0495595_0008200 3300053084 Bacteria 4287
379 Ga0495595_0032930 3300053084 Bacteria 2336
380 Ga0495595_0083492 3300053084 Unclassified 1525
381 Ga0495595_0234041 3300053084 Bacteria 918
382 Ga0495619_0006836 3300053085 Bacteria 7210
383 Ga0495619_0011198 3300053085 Bacteria 5641
384 Ga0495619_0395605 3300053085 Unclassified 954
385 Ga0500644_0001445 3300053088 Bacteria 6273
386 Ga0500651_0008936 3300053093 Bacteria 5927
387 Ga0500562_024824 3300053108 Unclassified 1568
388 Ga0500595_002616 3300053119 Bacteria 8764
389 Ga0500595_073974 3300053119 Bacteria 1007
390 Ga0500642_0011422 3300053130 Bacteria 3176
391 Ga0500616_0171422 3300053153 Bacteria 985
392 Ga0501084_0085592 3300054114 Bacteria 2646
393 Ga0501082_0034182 3300060353 Bacteria 4386
394 Ga0501082_0140084 3300060353 Bacteria 2099
395 Ga0501082_0187543 3300060353 Bacteria 1799
396 Ga0501082_0199243 3300060353 Bacteria 1742
397 Ga0530510_0145967 3300061734 Bacteria 1745
398 2643754946 2643221547 Bacteria 4740017
399 Ga0373939_0021070
400 JGI25153J46596_10009294
401 Ga0065712_10088792
402 Ga0070658_10009737
403 Ga0070683_100579644
404 Ga0070690_100094780
405 Ga0070670_100006191
406 Ga0070680_100007994
407 Ga0070680_100086831
408 Ga0068868_100083117
409 Ga0070691_10028211
410 Ga0070687_100606335
411 Ga0070661_100075301
412 Ga0070668_100670931
413 Ga0070673_100311881
414 Ga0070673_100839198
415 Ga0070659_100242584
416 Ga0070714_100019407
417 Ga0070714_100082248
418 Ga0070714_100217852
419 Ga0070713_100179866
420 Ga0070713_100348246
421 Ga0070713_100476573
422 Ga0070711_100311153
423 Ga0070705_100083620
424 Ga0070705_100564741
425 Ga0070694_100023467
426 Ga0070708_100455163
427 Ga0070663_100039179
428 Ga0070678_100132719
429 Ga0070662_100004931
430 Ga0070662_100110112
431 Ga0070681_10049026
432 Ga0070681_10054713
433 Ga0070681_10064707
434 Ga0070681_10199354
435 Ga0068867_100292226
436 Ga0070707_100571185
437 Ga0070699_100457224
438 Ga0070679_100132074
439 Ga0070679_100397305
440 Ga0070679_101036825
441 Ga0070695_100332450
442 Ga0070695_100500259
443 Ga0070693_100375185
444 Ga0070704_100361057
445 Ga0068855_100076905
446 Ga0068855_100588719
447 Ga0068855_101382121
448 Ga0070664_100299524
449 Ga0068857_100318837
450 Ga0068856_100172367
451 Ga0070702_100717790
452 Ga0068859_100972077
453 Ga0068866_10242209
454 Ga0068861_100414875
455 Ga0068858_100178268
456 Ga0068860_100446681
457 Ga0068860_100573457
458 Ga0070717_10084083
459 Ga0075365_10111115
460 Ga0075368_10065352
461 Ga0075363_100072469
462 Ga0075363_100077270
463 Ga0075363_100126822
464 Ga0075364_10542893
465 Ga0070715_10048545
466 Ga0075362_10010918
467 Ga0075362_10317572
468 Ga0075367_10089126
469 Ga0075367_10182255
470 Ga0075367_10448610
471 Ga0075369_10028769
472 Ga0075366_10072333
473 Ga0097621_100138258
474 Ga0097621_100302270
475 Ga0075370_10249200
476 Ga0068871_100303657
477 Ga0097620_100972072
478 Ga0099794_10259328
479 Ga0105240_10931920
480 Ga0105245_10181868
481 Ga0105245_11697678
482 Ga0105242_10019180
483 Ga0105248_10182640
484 Ga0105248_10193555
485 Ga0105248_11000818
486 Ga0105237_10121953
487 Ga0105237_10473890
488 Ga0105238_10079541
489 Ga0157370_10120088
490 Ga0157378_10096369
491 Ga0163162_10099346
492 Ga0163162_10573320
493 Ga0157375_10173417
494 Ga0163163_11435438
495 Ga0157379_10063147
496 Ga0157379_10459903
497 Ga0157376_10144776
498 Ga0213874_10017706
499 Ga0209758_1000772
500 Ga0207685_10024235
501 Ga0207705_10008036
502 Ga0207707_10061863
503 Ga0207707_10111203
504 Ga0207707_10204837
505 Ga0207707_10245546
506 Ga0207707_10536523
507 Ga0207671_10351379
508 Ga0207693_10035384
509 Ga0207693_10177722
510 Ga0207663_10158809
511 Ga0207660_10191841
512 Ga0207660_10320103
513 Ga0207649_10175916
514 Ga0207652_10046940
515 Ga0207652_10053861
516 Ga0207652_10118827
517 Ga0207687_10125564
518 Ga0207687_10321005
519 Ga0207700_10053038
520 Ga0207700_10337523
521 Ga0207664_10137443
522 Ga0207690_10148852
523 Ga0207706_10081044
524 Ga0207706_10081581
525 Ga0207709_10089560
526 Ga0207669_10034071
527 Ga0207704_10154142
528 Ga0207665_10086997
529 Ga0207691_10139739
530 Ga0207691_10533273
531 Ga0207711_10034256
532 Ga0207679_10033200
533 Ga0207679_10309891
534 Ga0207667_10358892
535 Ga0207668_10697635
536 Ga0207703_10368727
537 Ga0207678_10189922
538 Ga0207678_10228260
539 Ga0207702_11008902
540 Ga0207675_100490142
541 Ga0207683_10002930
542 Ga0209813_10100503
543 Ga0268266_10099205
544 Ga0268265_11028944
545 Ga0268264_10086253
546 Ga0265760_10025754
547 Ga0265330_10098495
548 Ga0265332_10048824
549 Ga0265325_10003249
550 Ga0265325_10017700
551 Ga0265325_10081927
552 Ga0265329_10021899
553 Ga0265339_10006395
554 Ga0265331_10023490
555 Ga0265316_10167913
556 Ga0307408_100371829
557 Ga0265313_10004421
558 Ga0265313_10016641
559 Ga0265313_10020522
560 Ga0265314_10005898
561 Ga0265314_10036730
562 Ga0265314_10051521
563 Ga0265342_10000348
564 Ga0265342_10219741
565 Ga0307412_10447048
566 Ga0373950_0005867
567 Ga0373934_0005467
568 Ga0373934_0287843
569 Ga0373940_0063864
570 Ga0373932_0017733
571 Ga0373941_0000127
572 Ga0373941_0091376
573 Ga0373945_0065840
574 Ga0373953_0007362
575 Ga0373954_0005195
576 Ga0373954_0013930
577 Ga0373956_0004015
578 Ga0373957_0005302
579 Ga0373943_0428239
580 Ga0373955_0015696
581 Ga0373962_0134496
582 Ga0373924_0002141
583 Ga0373931_0383890
584 Ga0373935_0018433
585 Ga0373935_0259961
586 Ga0373927_0408376
587 Ga0373927_0494305
588 Ga0373933_0146677
589 Ga0373933_0158005
590 Ga0373947_0051623
591 Ga0373947_0711846
592 Ga0373937_0001465
593 Ga0373937_0184004
594 Ga0373925_0053780
595 Ga0373925_0068055
596 Ga0436363_0025657
597 Ga0466957_0037514
598 Ga0466958_0537415
599 Ga0495592_0080662
600 Ga0495603_0442382
601 Ga0495629_0129055
602 Ga0495638_0073488
603 Ga0495651_0001857
604 Ga0495651_0238953
605 Ga0495651_0312786
606 Ga0495653_0008003
607 Ga0495653_0094570
608 Ga0495582_0084945
609 Ga0495662_0220764
610 Ga0495664_0056525
611 Ga0495594_0095598
612 Ga0495608_0001353
613 Ga0495618_0002672
614 Ga0495628_0377517
615 Ga0495630_0581646
616 Ga0495652_0036863
617 Ga0495652_0050044
618 Ga0495640_0030796
619 Ga0495640_0191042
620 Ga0495586_0002589
621 Ga0495586_0393207
622 Ga0495587_0026489
623 Ga0495587_0064998
624 Ga0495645_0049694
625 Ga0495622_0010714
626 Ga0495667_0001195
627 Ga0495667_0024697
628 Ga0495634_0215731
629 Ga0495635_0007948
630 Ga0495635_0253306
631 Ga0495635_0382392
632 Ga0495588_0007837
633 Ga0495657_0022860
634 Ga0495657_0024002
635 Ga0495599_0061173
636 Ga0495599_0113381
637 Ga0495623_0001587
638 Ga0495646_0005460
639 Ga0495624_0021906
640 Ga0495624_0106229
641 Ga0495624_0260567
642 Ga0495600_0009343
643 Ga0495600_0183107
644 Ga0495581_0007500
645 Ga0495581_0136721
646 Ga0495604_0092463
647 Ga0495604_0566513
648 Ga0495674_0031850
649 Ga0495674_0116680
650 Ga0495674_0128551
651 Ga0495680_0004460
652 Ga0495675_0000639
653 Ga0495684_0039706
654 Ga0495684_0120290
655 Ga0495593_0083298
656 Ga0495593_0099839
657 Ga0495602_0045156
658 Ga0495602_0056284
659 Ga0495602_0070791
660 Ga0496101_0188625
661 Ga0496101_0192513
662 Ga0496102_0022335
663 Ga0496102_0032067
664 Ga0496102_0347100
665 Ga0496102_0348180
666 Ga0496103_0312756
667 Ga0496105_0035784
668 Ga0496106_0104244
669 Ga0496106_0131868
670 Ga0496106_0244245
671 Ga0496106_0361292
672 Ga0496107_0005084
673 Ga0496108_0032837
674 Ga0496109_1005473
675 Ga0496110_0257521
676 Ga0496112_0119139
677 Ga0496113_0386514
678 Ga0496114_0110726
679 Ga0496114_0255365
680 Ga0496115_0038891
681 Ga0496115_0098116
682 Ga0496115_0263784
683 Ga0501031_0040207
684 Ga0501031_0430876
685 Ga0501032_0067720
686 Ga0501032_0156215
687 Ga0501033_0087870
688 Ga0501033_0113978
689 Ga0501034_0000230
690 Ga0501034_0100778
691 Ga0501034_0283579
692 Ga0501034_0298385
693 Ga0501034_0303696
694 Ga0501034_0366832
695 Ga0501034_0390012
696 Ga0501036_0151433
697 Ga0501037_0180989
698 Ga0501037_0220303
699 Ga0501038_0264052
700 Ga0501038_0635860
701 Ga0501039_0042925
702 Ga0501039_0105036
703 Ga0501039_0107330
704 Ga0501040_0350723
705 Ga0501043_0054027
706 Ga0501043_0078139
707 Ga0501043_0480030
708 Ga0501046_0538172
709 Ga0501047_0122504
710 Ga0501047_0428645
711 Ga0501067_0074447
712 Ga0501069_0005905
713 Ga0501069_0028225
714 Ga0501069_0119714
715 Ga0501069_0256656
716 Ga0501070_0041797
717 Ga0501070_0219746
718 Ga0501070_0315311
719 Ga0501070_0396634
720 Ga0501070_0438132
721 Ga0501070_0482906
722 Ga0501070_0482920
723 Ga0501071_0071715
724 Ga0501072_0000464
725 Ga0501072_0087328
726 Ga0501072_0101284
727 Ga0501072_0125254
728 Ga0501072_0565496
729 Ga0501073_0138058
730 Ga0501073_0201299
731 Ga0501073_0413024
732 Ga0501073_0556398
733 Ga0501074_0065260
734 Ga0501074_0157681
735 Ga0501074_0465137
736 Ga0501076_0315589
737 Ga0501076_1584421
738 Ga0501077_0041037
739 Ga0501079_0089151
740 Ga0501079_0643968
741 Ga0501079_0850208
742 Ga0501080_0012654
743 Ga0501080_0038261
744 Ga0501080_0344887
745 Ga0501080_0420069
746 Ga0501081_0068650
747 Ga0501083_0034454
748 Ga0501083_0497846
749 Ga0501083_0695425
750 Ga0501035_0004713
751 Ga0501035_0139155
752 Ga0501044_0046583
753 Ga0501044_0083306
754 Ga0501044_0136833
755 Ga0501044_0221633
756 Ga0501044_0290481
757 Ga0501044_0349635
758 Ga0501044_0789336
759 Ga0501044_0940037
760 nmdc:mga03n38_467173_c1
761 nmdc:mga00v17_420491_c1
762 nmdc:mga00v17_94127_c1
763 nmdc:mga0yw44_149277_c1
764 nmdc:mga0k408_529800_c1
765 nmdc:mga06z11_236983_c1
766 nmdc:mga04h51_100283_c1
767 nmdc:mga04h51_82298_c1
768 nmdc:mga08y16_265144_c1
769 nmdc:mga0sz30_17764_c1
770 Ga0495601_0009363
771 Ga0495601_0018400
772 Ga0495601_0108724
773 Ga0495601_0234366
774 Ga0495612_0093952
775 Ga0495612_0105900
776 Ga0495595_0008200
777 Ga0495595_0032930
778 Ga0495595_0083492
779 Ga0495595_0234041
780 Ga0495619_0006836
781 Ga0495619_0011198
782 Ga0495619_0395605
783 Ga0500644_0001445
784 Ga0500651_0008936
785 Ga0500562_024824
786 Ga0500595_002616
787 Ga0500595_073974
788 Ga0500642_0011422
789 Ga0500616_0171422
790 Ga0501084_0085592
791 Ga0501082_0034182
792 Ga0501082_0140084
793 Ga0501082_0187543
794 Ga0501082_0199243
795 Ga0530510_0145967
796 2643754946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j7m-assembly1.cif.gz_M complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.6782 132 181
6j7m-assembly2.cif.gz_N complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.6681 132 181
3oyy-assembly1.cif.gz_A structure of pseudomonas aeruginosa elongation factor p 0.6636 130 179
3cpf-assembly2.cif.gz_B crystal structure of human eukaryotic translation initiation factor eif5a 0.6349 131 181
3cpf-assembly1.cif.gz_A crystal structure of human eukaryotic translation initiation factor eif5a 0.626 131 181
ID Description Score Start End Superfamily
af_F1Q5D8_106_273_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7237 144 172 2.110.10.10
af_C0M4B0_278_410_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7092 145 172 2.110.10.10
af_O62390_114_307_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.6796 138 172 2.110.10.10
af_Q9W122_298_495_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.6742 139 172 2.110.10.10
af_Q54YP4_1_419_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6445 144 173 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A849E876-F1-model_v4 Uncharacterized protein 0.9796 73 204
AF-A0A2U3LUR2-F1-model_v4 Uncharacterized protein 0.9579 77 204
AF-A0A7Y5W2G8-F1-model_v4 Uncharacterized protein 0.9466 69 203
AF-A0A3S3U7Q2-F1-model_v4 Uncharacterized protein 0.9456 69 198
AF-A0A238JPP0-F1-model_v4 Uncharacterized protein 0.936 79 204

Map