F433983

General Info

Members Datasets Scaffolds Average Seq Length
398 234 796 300

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100401068|Ga0070711_1004010681
Length 328
Sequence MASSGRQSPEALEDDARWRSAGDRIQILLDASAGSGTVVRERTEQLAGELTDLYGAALERMVAIAARSAPELVGEFAADELVASLMLVHGLHPHGVERRIEDALDGVRPYLGSHGGDVTLLEVVDDVVRLQFAGSCKSCPSSAVTLEFAVEDAVRAAAPEITSIEVVAAERDSAPAALIPADSLMSRIRPKDTSAAGWYPAPDIADLGPGEVGGFLVAGVPILACRVGDDLFAYHDRCGRCAESMAGAQLHRPMGAPAPGGRSAATRGXXXVQAVLRCPRCGAHFDAVHAGASVDDATDGATHLDPIPLLRRDGVLSVAVLAEATGVM

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
227 2643221692 Nocardia sp. Root136 Isolate Unclassified
228 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
229 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
230 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
231 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
232 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
233 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
234 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.06
Nodule 0.25
Rhizoplane 13.57
Rhizosphere 64.07
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100401068 3300005439 Bacteria 1113
2 JGI24743J22301_10008264 3300001991 Bacteria 1823
3 JGI24744J21845_10000886 3300002077 Bacteria 5647
4 JGI24034J26672_10003853 3300002239 Unclassified 2107
5 JGI24742J22300_10000726 3300002244 Bacteria 5010
6 JGI24751J29686_10006472 3300002459 Bacteria 2388
7 rootH2_10290048 3300003320 Bacteria 1516
8 rootL2_10345160 3300003322 Bacteria 1198
9 Ga0070676_10057739 3300005328 Bacteria 2298
10 Ga0070676_10115275 3300005328 Bacteria 1679
11 Ga0070683_100138205 3300005329 Bacteria 2308
12 Ga0070690_100003225 3300005330 Bacteria 8901
13 Ga0070670_100263506 3300005331 Bacteria 1503
14 Ga0070666_10016603 3300005335 Bacteria 4711
15 Ga0070666_10226967 3300005335 Bacteria 1318
16 Ga0070682_100031352 3300005337 Bacteria 3215
17 Ga0070682_100115138 3300005337 Bacteria 1798
18 Ga0068868_100067122 3300005338 Bacteria 2854
19 Ga0068868_100152003 3300005338 Bacteria 1907
20 Ga0070691_10049257 3300005341 Bacteria 2006
21 Ga0070668_100001162 3300005347 Bacteria 18593
22 Ga0070668_100092081 3300005347 Bacteria 2390
23 Ga0070671_100019853 3300005355 Bacteria 5475
24 Ga0070671_100029987 3300005355 Bacteria 4488
25 Ga0070674_100002431 3300005356 Bacteria 10300
26 Ga0070688_100044953 3300005365 Bacteria 2726
27 Ga0070659_100115057 3300005366 Bacteria 2174
28 Ga0070667_100000378 3300005367 Bacteria 48704
29 Ga0070667_100001903 3300005367 Bacteria 18522
30 Ga0070667_100081359 3300005367 Bacteria 2771
31 Ga0070667_100107528 3300005367 Bacteria 2415
32 Ga0070714_100194697 3300005435 Bacteria 1852
33 Ga0070710_10011070 3300005437 Bacteria 4447
34 Ga0070710_10036325 3300005437 Bacteria 2693
35 Ga0070701_10002388 3300005438 Bacteria 7218
36 Ga0070711_100005157 3300005439 Bacteria 7787
37 Ga0070700_100004440 3300005441 Bacteria 7329
38 Ga0070694_100046963 3300005444 Bacteria 2900
39 Ga0070663_100058642 3300005455 Bacteria 2765
40 Ga0070663_100234027 3300005455 Bacteria 1448
41 Ga0070678_100000403 3300005456 Bacteria 20375
42 Ga0070678_100017641 3300005456 Bacteria 4604
43 Ga0070678_100253623 3300005456 Bacteria 1476
44 Ga0070662_100001482 3300005457 Bacteria 14455
45 Ga0070662_100055322 3300005457 Bacteria 2878
46 Ga0068867_100005700 3300005459 Bacteria 8827
47 Ga0070685_10038131 3300005466 Bacteria 2724
48 Ga0070685_10273438 3300005466 Bacteria 1128
49 Ga0070684_100176065 3300005535 Bacteria 1944
50 Ga0068853_100004486 3300005539 Bacteria 10828
51 Ga0068853_100036937 3300005539 Bacteria 4155
52 Ga0070686_100117575 3300005544 Bacteria 1821
53 Ga0070695_100068238 3300005545 Bacteria 2321
54 Ga0070696_100180588 3300005546 Bacteria 1565
55 Ga0070693_100017562 3300005547 Bacteria 3721
56 Ga0070693_100171336 3300005547 Bacteria 1390
57 Ga0070665_100043559 3300005548 Bacteria 4510
58 Ga0070665_100097081 3300005548 Bacteria 2952
59 Ga0070704_100010009 3300005549 Bacteria 5759
60 Ga0068855_100143273 3300005563 Bacteria 2722
61 Ga0068854_100009574 3300005578 Bacteria 6254
62 Ga0068854_100069132 3300005578 Bacteria 2577
63 Ga0068856_100033177 3300005614 Bacteria 5056
64 Ga0070702_100075400 3300005615 Bacteria 2004
65 Ga0070702_100082086 3300005615 Bacteria 1933
66 Ga0068852_100150801 3300005616 Bacteria 2161
67 Ga0068859_100002523 3300005617 Bacteria 18577
68 Ga0068859_100261381 3300005617 Bacteria 1822
69 Ga0068864_100194212 3300005618 Bacteria 1862
70 Ga0068866_10000454 3300005718 Bacteria 18801
71 Ga0068866_10134995 3300005718 Bacteria 1409
72 Ga0068861_100004122 3300005719 Bacteria 9752
73 Ga0068861_100214724 3300005719 Bacteria 1622
74 Ga0068861_100405788 3300005719 Bacteria 1210
75 Ga0068870_10096426 3300005840 Bacteria 1663
76 Ga0068863_100007723 3300005841 Bacteria 10517
77 Ga0068863_100376751 3300005841 Bacteria 1385
78 Ga0068858_100002323 3300005842 Bacteria 19223
79 Ga0068858_100483559 3300005842 Bacteria 1195
80 Ga0068860_100002038 3300005843 Bacteria 21300
81 Ga0068860_100498542 3300005843 Bacteria 1215
82 Ga0068862_100009344 3300005844 Bacteria 8114
83 Ga0068862_100142243 3300005844 Bacteria 2130
84 Ga0081455_10044691 3300005937 Bacteria 3861
85 Ga0075368_10040334 3300006042 Bacteria 1833
86 Ga0075363_100000459 3300006048 Bacteria 12784
87 Ga0075363_100002414 3300006048 Bacteria 7625
88 Ga0075363_100026462 3300006048 Bacteria 2968
89 Ga0075363_100035760 3300006048 Bacteria 2602
90 Ga0075363_100038125 3300006048 Bacteria 2526
91 Ga0075363_100056183 3300006048 Bacteria 2110
92 Ga0075364_10000249 3300006051 Bacteria 25906
93 Ga0075364_10001427 3300006051 Bacteria 12944
94 Ga0075364_10025728 3300006051 Bacteria 3748
95 Ga0075364_10053210 3300006051 Bacteria 2646
96 Ga0070715_10026494 3300006163 Bacteria 2307
97 Ga0070716_100028412 3300006173 Bacteria 3013
98 Ga0070712_100183688 3300006175 Bacteria 1631
99 Ga0070712_100230569 3300006175 Bacteria 1470
100 Ga0075362_10014755 3300006177 Bacteria 3162
101 Ga0075367_10008902 3300006178 Bacteria 5222
102 Ga0075367_10085554 3300006178 Bacteria 1913
103 Ga0075369_10000146 3300006186 Bacteria 19639
104 Ga0075369_10016300 3300006186 Bacteria 2996
105 Ga0075369_10018826 3300006186 Bacteria 2815
106 Ga0075369_10077792 3300006186 Bacteria 1467
107 Ga0075369_10092671 3300006186 Bacteria 1349
108 Ga0075369_10100969 3300006186 Bacteria 1294
109 Ga0075370_10005544 3300006353 Bacteria 6288
110 Ga0075370_10023134 3300006353 Bacteria 3420
111 Ga0075370_10041385 3300006353 Bacteria 2601
112 Ga0075428_100001592 3300006844 Bacteria 24310
113 Ga0068865_100002624 3300006881 Bacteria 10687
114 Ga0068865_100092498 3300006881 Bacteria 2197
115 Ga0097620_100002523 3300006931 Bacteria 18577
116 Ga0097620_100261361 3300006931 Bacteria 1822
117 Ga0105250_10099024 3300009092 Bacteria 1189
118 Ga0111539_10623487 3300009094 Bacteria 1256
119 Ga0105245_10001205 3300009098 Bacteria 23411
120 Ga0105245_10060601 3300009098 Bacteria 3408
121 Ga0105245_10528465 3300009098 Bacteria 1199
122 Ga0105247_10000760 3300009101 Bacteria 24880
123 Ga0105247_10024105 3300009101 Bacteria 3665
124 Ga0105243_10010883 3300009148 Bacteria 6882
125 Ga0105241_10036717 3300009174 Bacteria 3688
126 Ga0105242_10011016 3300009176 Bacteria 6944
127 Ga0105248_10006964 3300009177 Bacteria 12388
128 Ga0105248_10010432 3300009177 Bacteria 10232
129 Ga0105237_10014637 3300009545 Bacteria 8193
130 Ga0105238_10081501 3300009551 Bacteria 3225
131 Ga0105249_10017547 3300009553 Bacteria 6355
132 Ga0105249_10169522 3300009553 Bacteria 2116
133 Ga0105239_10005679 3300010375 Bacteria 14582
134 Ga0105239_10091176 3300010375 Bacteria 3363
135 Ga0105246_10144069 3300011119 Bacteria 1795
136 Ga0157371_10270724 3300013102 Bacteria 1226
137 Ga0157369_10293819 3300013105 Bacteria 1691
138 Ga0157374_10077972 3300013296 Bacteria 3137
139 Ga0157378_10013958 3300013297 Bacteria 7028
140 Ga0157378_10287366 3300013297 Bacteria 1587
141 Ga0163162_10095662 3300013306 Bacteria 3057
142 Ga0157372_10110880 3300013307 Bacteria 3143
143 Ga0157375_10001782 3300013308 Bacteria 18460
144 Ga0163163_10226261 3300014325 Bacteria 1920
145 Ga0157380_10011395 3300014326 Bacteria 6425
146 Ga0157379_10005098 3300014968 Bacteria 11268
147 Ga0163161_10001310 3300017792 Bacteria 18516
148 Ga0163161_10477924 3300017792 Bacteria 1011
149 Ga0213872_10058540 3300021361 Bacteria 1744
150 Ga0213876_10002291 3300021384 Bacteria 11296
151 Ga0213876_10006202 3300021384 Bacteria 6525
152 Ga0213875_10043589 3300021388 Bacteria 2107
153 Ga0213875_10106272 3300021388 Bacteria 1310
154 Ga0207692_10057942 3300025898 Bacteria 1994
155 Ga0207692_10067762 3300025898 Bacteria 1869
156 Ga0207642_10001301 3300025899 Bacteria 7723
157 Ga0207642_10044527 3300025899 Bacteria 1965
158 Ga0207710_10005559 3300025900 Bacteria 5424
159 Ga0207688_10034348 3300025901 Bacteria 2808
160 Ga0207680_10227448 3300025903 Bacteria 1281
161 Ga0207685_10004342 3300025905 Bacteria 3592
162 Ga0207645_10182251 3300025907 Bacteria 1378
163 Ga0207643_10045367 3300025908 Bacteria 2482
164 Ga0207643_10188499 3300025908 Bacteria 1251
165 Ga0207671_10016345 3300025914 Bacteria 5771
166 Ga0207693_10001055 3300025915 Bacteria 24657
167 Ga0207693_10001618 3300025915 Bacteria 19904
168 Ga0207662_10045716 3300025918 Bacteria 2588
169 Ga0207657_10046939 3300025919 Bacteria 3781
170 Ga0207694_10051364 3300025924 Bacteria 3196
171 Ga0207650_10219645 3300025925 Bacteria 1529
172 Ga0207687_10000764 3300025927 Bacteria 21700
173 Ga0207664_10051674 3300025929 Bacteria 3247
174 Ga0207644_10041844 3300025931 Bacteria 3243
175 Ga0207690_10295106 3300025932 Bacteria 1267
176 Ga0207709_10008755 3300025935 Bacteria 5581
177 Ga0207669_10000627 3300025937 Bacteria 15280
178 Ga0207704_10000923 3300025938 Bacteria 12997
179 Ga0207665_10008614 3300025939 Bacteria 6713
180 Ga0207665_10059770 3300025939 Bacteria 2580
181 Ga0207665_10210111 3300025939 Bacteria 1421
182 Ga0207665_10491264 3300025939 Bacteria 947
183 Ga0207711_10030011 3300025941 Bacteria 4587
184 Ga0207661_10188662 3300025944 Bacteria 1806
185 Ga0207667_10092863 3300025949 Bacteria 3117
186 Ga0207712_10018855 3300025961 Bacteria 4499
187 Ga0207712_10095356 3300025961 Bacteria 2200
188 Ga0207668_10020569 3300025972 Bacteria 4195
189 Ga0207640_10015922 3300025981 Bacteria 4364
190 Ga0207658_10003566 3300025986 Bacteria 10983
191 Ga0207658_10025870 3300025986 Bacteria 4111
192 Ga0207658_10038522 3300025986 Bacteria 3444
193 Ga0207658_10264841 3300025986 Bacteria 1466
194 Ga0207677_10032088 3300026023 Bacteria 3373
195 Ga0207703_10016802 3300026035 Bacteria 5708
196 Ga0207639_10001347 3300026041 Bacteria 16592
197 Ga0207678_10005973 3300026067 Bacteria 10840
198 Ga0207678_10028618 3300026067 Bacteria 4863
199 Ga0207678_10110354 3300026067 Bacteria 2347
200 Ga0207708_10001524 3300026075 Bacteria 17274
201 Ga0207708_10032764 3300026075 Bacteria 3945
202 Ga0207702_10059657 3300026078 Bacteria 3250
203 Ga0207648_10004805 3300026089 Bacteria 13789
204 Ga0207648_10022637 3300026089 Bacteria 5641
205 Ga0207676_10037447 3300026095 Bacteria 3697
206 Ga0207676_10163949 3300026095 Bacteria 1929
207 Ga0207676_10392269 3300026095 Bacteria 1295
208 Ga0207675_100004732 3300026118 Bacteria 13104
209 Ga0207675_100331491 3300026118 Bacteria 1488
210 Ga0207675_100515650 3300026118 Bacteria 1191
211 Ga0207683_10002556 3300026121 Bacteria 15880
212 Ga0207683_10189104 3300026121 Bacteria 1869
213 Ga0207698_10434586 3300026142 Bacteria 1263
214 Ga0268266_10068429 3300028379 Bacteria 3074
215 Ga0268266_10072970 3300028379 Bacteria 2977
216 Ga0268266_10517780 3300028379 Bacteria 1140
217 Ga0268265_10005926 3300028380 Bacteria 8322
218 Ga0268264_10009224 3300028381 Bacteria 8173
219 Ga0307410_10013694 3300031852 Bacteria 4743
220 Ga0307412_10253154 3300031911 Bacteria 1368
221 Ga0307409_100170278 3300031995 Bacteria 1916
222 Ga0307416_100069063 3300032002 Bacteria 2922
223 Ga0307416_100237239 3300032002 Bacteria 1764
224 Ga0307414_10313848 3300032004 Bacteria 1332
225 Ga0307415_100022763 3300032126 Bacteria 3875
226 Ga0316582_0153823 3300036647 Bacteria 1556
227 Ga0436364_0798070 3300037853 Bacteria 1346
228 Ga0436364_1220451 3300037853 Bacteria 2881
229 Ga0436364_1390044 3300037853 Bacteria 19719
230 Ga0436365_0169608 3300039437 Bacteria 31046
231 Ga0436365_0263559 3300039437 Bacteria 17167
232 Ga0436365_1854889 3300039437 Bacteria 5751
233 Ga0436360_0305144 3300039438 Bacteria 4653
234 Ga0439466_0026114 3300041411 Bacteria 2034
235 Ga0439465_0006625 3300041413 Bacteria 3679
236 Ga0439465_0008883 3300041413 Bacteria 3166
237 Ga0439465_0012101 3300041413 Bacteria 2702
238 Ga0466972_0001842 3300044658 Bacteria 10380
239 Ga0466972_0005207 3300044658 Bacteria 6510
240 Ga0466972_0068342 3300044658 Bacteria 1697
241 Ga0466965_0018444 3300044683 Bacteria 3345
242 Ga0466963_0103509 3300044694 Bacteria 1950
243 Ga0466964_0188097 3300044706 Bacteria 983
244 Ga0466971_0029066 3300044719 Bacteria 2472
245 Ga0466971_0056592 3300044719 Bacteria 1769
246 Ga0466968_0140660 3300044735 Bacteria 1104
247 Ga0466970_0032520 3300044765 Bacteria 2756
248 Ga0466957_0030143 3300044842 Bacteria 3238
249 Ga0466957_0097178 3300044842 Bacteria 1852
250 Ga0466960_0000171 3300044901 Bacteria 22212
251 Ga0466958_0076240 3300045836 Bacteria 2058
252 Ga0466967_0007608 3300045976 Bacteria 7834
253 Ga0466967_0020720 3300045976 Bacteria 5322
254 Ga0466967_0209996 3300045976 Bacteria 1846
255 Ga0495629_0007888 3300046459 Bacteria 7834
256 Ga0495638_0000244 3300046460 Bacteria 74504
257 Ga0495606_0080252 3300046507 Bacteria 2030
258 Ga0495658_0256250 3300046683 Bacteria 1101
259 Ga0495649_0059078 3300046694 Bacteria 2065
260 Ga0495581_0073473 3300047315 Bacteria 1979
261 Ga0495672_0003188 3300047320 Bacteria 14260
262 Ga0495673_0001500 3300047469 Bacteria 18434
263 Ga0495686_0002412 3300047472 Bacteria 17726
264 Ga0495593_0032555 3300047673 Bacteria 2842
265 Ga0496100_0000153 3300048903 Bacteria 38499
266 Ga0496100_0001206 3300048903 Bacteria 12559
267 Ga0496100_0006140 3300048903 Bacteria 6536
268 Ga0496100_0009043 3300048903 Bacteria 5582
269 Ga0496101_0000078 3300048904 Bacteria 108113
270 Ga0496101_0000104 3300048904 Bacteria 87820
271 Ga0496101_0001651 3300048904 Bacteria 13377
272 Ga0496101_0006391 3300048904 Bacteria 7583
273 Ga0496101_0006991 3300048904 Bacteria 7287
274 Ga0496102_0000056 3300048905 Bacteria 172707
275 Ga0496102_0003051 3300048905 Bacteria 14186
276 Ga0496102_0003940 3300048905 Bacteria 12575
277 Ga0496102_0004488 3300048905 Bacteria 11782
278 Ga0496102_0128841 3300048905 Bacteria 2367
279 Ga0496102_0188185 3300048905 Bacteria 1945
280 Ga0496102_0207527 3300048905 Bacteria 1847
281 Ga0496103_0000040 3300048906 Bacteria 172148
282 Ga0496103_0001356 3300048906 Bacteria 16501
283 Ga0496103_0017437 3300048906 Bacteria 4297
284 Ga0496103_0144849 3300048906 Bacteria 1520
285 Ga0496104_0005377 3300048907 Bacteria 11211
286 Ga0496104_0150118 3300048907 Bacteria 2238
287 Ga0496105_0017889 3300048908 Bacteria 5688
288 Ga0496105_0081579 3300048908 Bacteria 2671
289 Ga0496105_0096750 3300048908 Bacteria 2438
290 Ga0496106_0000916 3300048909 Bacteria 21429
291 Ga0496106_0002376 3300048909 Bacteria 14017
292 Ga0496106_0008729 3300048909 Bacteria 7495
293 Ga0496106_0207968 3300048909 Bacteria 1558
294 Ga0496107_0000384 3300048910 Bacteria 24004
295 Ga0496107_0000401 3300048910 Bacteria 23422
296 Ga0496108_0003127 3300048911 Bacteria 13300
297 Ga0496108_0048708 3300048911 Bacteria 3543
298 Ga0496108_0089020 3300048911 Bacteria 2623
299 Ga0496109_0000427 3300048912 Bacteria 36973
300 Ga0496109_0002322 3300048912 Bacteria 15843
301 Ga0496109_0087568 3300048912 Bacteria 2877
302 Ga0496109_0095242 3300048912 Bacteria 2756
303 Ga0496109_0201357 3300048912 Bacteria 1872
304 Ga0496110_0017775 3300048913 Bacteria 5950
305 Ga0496110_0142755 3300048913 Bacteria 2165
306 Ga0496110_0527207 3300048913 Bacteria 1074
307 Ga0496111_0025881 3300048914 Bacteria 4140
308 Ga0496111_0046317 3300048914 Bacteria 3131
309 Ga0496112_0004928 3300048915 Bacteria 11427
310 Ga0496112_0016886 3300048915 Bacteria 6849
311 Ga0496112_0089979 3300048915 Bacteria 3038
312 Ga0496113_0008695 3300048916 Bacteria 6627
313 Ga0496114_0000306 3300048917 Bacteria 36002
314 Ga0496114_0001884 3300048917 Bacteria 15921
315 Ga0496114_0222890 3300048917 Bacteria 1655
316 Ga0496115_0000451 3300048918 Bacteria 32969
317 Ga0496115_0000590 3300048918 Bacteria 27806
318 Ga0496115_0128113 3300048918 Bacteria 2091
319 Ga0496116_0000056 3300048919 Bacteria 282554
320 Ga0496116_0016963 3300048919 Bacteria 5676
321 Ga0496117_0000003 3300048920 Bacteria 1881097
322 Ga0496117_0056479 3300048920 Bacteria 2733
323 Ga0496118_0000001 3300048921 Bacteria 1881100
324 Ga0496118_0030182 3300048921 Bacteria 4530
325 Ga0496119_0002028 3300048922 Bacteria 22916
326 Ga0496119_0046355 3300048922 Bacteria 2715
327 Ga0496119_0213555 3300048922 Bacteria 991
328 Ga0496120_0001057 3300048923 Bacteria 36420
329 Ga0496121_0000002 3300048924 Bacteria 1494588
330 Ga0496121_0000121 3300048924 Bacteria 172480
331 Ga0496122_0000141 3300048925 Bacteria 168707
332 Ga0496122_0008842 3300048925 Bacteria 10745
333 Ga0496123_0014046 3300048926 Bacteria 6664
334 Ga0496123_0068315 3300048926 Bacteria 2239
335 Ga0496124_0000002 3300048927 Bacteria 1494588
336 Ga0496124_0210686 3300048927 Bacteria 1471
337 Ga0496125_0000002 3300048928 Bacteria 1480920
338 Ga0496126_0000011 3300048929 Bacteria 744275
339 Ga0496126_0005119 3300048929 Bacteria 15193
340 Ga0496126_0028877 3300048929 Bacteria 5277
341 Ga0501032_0003117 3300049569 Bacteria 12774
342 Ga0501032_0003633 3300049569 Bacteria 11735
343 Ga0501033_0021735 3300049570 Bacteria 4843
344 Ga0501033_0288220 3300049570 Bacteria 1158
345 Ga0501034_0003930 3300049571 Bacteria 16699
346 Ga0501034_0129956 3300049571 Bacteria 2502
347 Ga0501037_0019236 3300049573 Bacteria 5033
348 Ga0501039_0000701 3300049575 Bacteria 24079
349 Ga0501043_0005569 3300049579 Bacteria 10148
350 Ga0501043_0012872 3300049579 Bacteria 6540
351 Ga0501046_0002848 3300049580 Bacteria 16092
352 Ga0501047_0012026 3300049581 Bacteria 8190
353 Ga0501048_0006308 3300049582 Bacteria 9015
354 Ga0501070_0002577 3300049586 Bacteria 15850
355 Ga0501070_0003144 3300049586 Bacteria 14372
356 Ga0501073_0302290 3300049589 Bacteria 1104
357 Ga0501080_0040181 3300049742 Bacteria 4364
358 Ga0501080_0058104 3300049742 Bacteria 3601
359 Ga0501035_0003525 3300049822 Bacteria 14958
360 Ga0501044_0002377 3300049823 Bacteria 21431
361 Ga0501044_0004314 3300049823 Bacteria 15946
362 nmdc:mga03683_4635_c1 3300050489 Bacteria 2820
363 nmdc:mga03n38_16918_c1 3300050490 Bacteria 2846
364 nmdc:mga03n38_2991_c1 3300050490 Bacteria 5348
365 nmdc:mga03n38_33785_c1 3300050490 Bacteria 2179
366 nmdc:mga03n38_60138_c1 3300050490 Bacteria 1726
367 nmdc:mga00v17_1055_c1 3300050491 Bacteria 14542
368 nmdc:mga00v17_32762_c1 3300050491 Bacteria 3074
369 nmdc:mga00v17_5300_c1 3300050491 Bacteria 6794
370 nmdc:mga00v17_592_c1 3300050491 Bacteria 20177
371 nmdc:mga00v17_80460_c1 3300050491 Bacteria 2033
372 nmdc:mga00v17_89459_c1 3300050491 Bacteria 1932
373 nmdc:mga06z11_11187_c1 3300050494 Bacteria 3858
374 nmdc:mga07m45_195834_c1 3300050496 Bacteria 1175
375 nmdc:mga07m45_5364_c1 3300050496 Bacteria 6383
376 nmdc:mga05p37_177978_c1 3300050507 Bacteria 2590
377 nmdc:mga06r32_31402_c1 3300050510 Bacteria 4988
378 nmdc:mga08y16_442719_c1 3300050511 Bacteria 1326
379 nmdc:mga0sz30_11379_c1 3300050516 Bacteria 3433
380 nmdc:mga0sz30_2093_c1 3300050516 Bacteria 7128
381 nmdc:mga0sz30_25153_c1 3300050516 Bacteria 2434
382 nmdc:mga0sz30_467_c1 3300050516 Bacteria 15334
383 nmdc:mga0sz30_53232_c1 3300050516 Bacteria 1719
384 nmdc:mga0sz30_624_c1 3300050516 Bacteria 13121
385 nmdc:mga0sz30_94705_c1 3300050516 Bacteria 1302
386 Ga0500635_0034956 3300053080 Bacteria 1649
387 Ga0500643_014085 3300053087 Bacteria 2794
388 Ga0500652_000502 3300053131 Bacteria 13717
389 Ga0500645_000016 3300053730 Bacteria 147392
390 2523387288 2523231044 Bacteria 6434991
391 2644511598 2643221692 Bacteria 7282860
392 2738708725 2738541274 Bacteria 6909446
393 2739333117 2738543028 Bacteria 6917070
394 2842138294 2842134933 Bacteria 5847019
395 2902798605 2902792274 Bacteria 7270173
396 2902799374 2902799365 Bacteria 5419524
397 2929215122 2929212328 Bacteria 7708288
398 2939587499 2939582691 Bacteria 7088898
399 Ga0070711_100401068
400 JGI24743J22301_10008264
401 JGI24744J21845_10000886
402 JGI24034J26672_10003853
403 JGI24742J22300_10000726
404 JGI24751J29686_10006472
405 rootH2_10290048
406 rootL2_10345160
407 Ga0070676_10057739
408 Ga0070676_10115275
409 Ga0070683_100138205
410 Ga0070690_100003225
411 Ga0070670_100263506
412 Ga0070666_10016603
413 Ga0070666_10226967
414 Ga0070682_100031352
415 Ga0070682_100115138
416 Ga0068868_100067122
417 Ga0068868_100152003
418 Ga0070691_10049257
419 Ga0070668_100001162
420 Ga0070668_100092081
421 Ga0070671_100019853
422 Ga0070671_100029987
423 Ga0070674_100002431
424 Ga0070688_100044953
425 Ga0070659_100115057
426 Ga0070667_100000378
427 Ga0070667_100001903
428 Ga0070667_100081359
429 Ga0070667_100107528
430 Ga0070714_100194697
431 Ga0070710_10011070
432 Ga0070710_10036325
433 Ga0070701_10002388
434 Ga0070711_100005157
435 Ga0070700_100004440
436 Ga0070694_100046963
437 Ga0070663_100058642
438 Ga0070663_100234027
439 Ga0070678_100000403
440 Ga0070678_100017641
441 Ga0070678_100253623
442 Ga0070662_100001482
443 Ga0070662_100055322
444 Ga0068867_100005700
445 Ga0070685_10038131
446 Ga0070685_10273438
447 Ga0070684_100176065
448 Ga0068853_100004486
449 Ga0068853_100036937
450 Ga0070686_100117575
451 Ga0070695_100068238
452 Ga0070696_100180588
453 Ga0070693_100017562
454 Ga0070693_100171336
455 Ga0070665_100043559
456 Ga0070665_100097081
457 Ga0070704_100010009
458 Ga0068855_100143273
459 Ga0068854_100009574
460 Ga0068854_100069132
461 Ga0068856_100033177
462 Ga0070702_100075400
463 Ga0070702_100082086
464 Ga0068852_100150801
465 Ga0068859_100002523
466 Ga0068859_100261381
467 Ga0068864_100194212
468 Ga0068866_10000454
469 Ga0068866_10134995
470 Ga0068861_100004122
471 Ga0068861_100214724
472 Ga0068861_100405788
473 Ga0068870_10096426
474 Ga0068863_100007723
475 Ga0068863_100376751
476 Ga0068858_100002323
477 Ga0068858_100483559
478 Ga0068860_100002038
479 Ga0068860_100498542
480 Ga0068862_100009344
481 Ga0068862_100142243
482 Ga0081455_10044691
483 Ga0075368_10040334
484 Ga0075363_100000459
485 Ga0075363_100002414
486 Ga0075363_100026462
487 Ga0075363_100035760
488 Ga0075363_100038125
489 Ga0075363_100056183
490 Ga0075364_10000249
491 Ga0075364_10001427
492 Ga0075364_10025728
493 Ga0075364_10053210
494 Ga0070715_10026494
495 Ga0070716_100028412
496 Ga0070712_100183688
497 Ga0070712_100230569
498 Ga0075362_10014755
499 Ga0075367_10008902
500 Ga0075367_10085554
501 Ga0075369_10000146
502 Ga0075369_10016300
503 Ga0075369_10018826
504 Ga0075369_10077792
505 Ga0075369_10092671
506 Ga0075369_10100969
507 Ga0075370_10005544
508 Ga0075370_10023134
509 Ga0075370_10041385
510 Ga0075428_100001592
511 Ga0068865_100002624
512 Ga0068865_100092498
513 Ga0097620_100002523
514 Ga0097620_100261361
515 Ga0105250_10099024
516 Ga0111539_10623487
517 Ga0105245_10001205
518 Ga0105245_10060601
519 Ga0105245_10528465
520 Ga0105247_10000760
521 Ga0105247_10024105
522 Ga0105243_10010883
523 Ga0105241_10036717
524 Ga0105242_10011016
525 Ga0105248_10006964
526 Ga0105248_10010432
527 Ga0105237_10014637
528 Ga0105238_10081501
529 Ga0105249_10017547
530 Ga0105249_10169522
531 Ga0105239_10005679
532 Ga0105239_10091176
533 Ga0105246_10144069
534 Ga0157371_10270724
535 Ga0157369_10293819
536 Ga0157374_10077972
537 Ga0157378_10013958
538 Ga0157378_10287366
539 Ga0163162_10095662
540 Ga0157372_10110880
541 Ga0157375_10001782
542 Ga0163163_10226261
543 Ga0157380_10011395
544 Ga0157379_10005098
545 Ga0163161_10001310
546 Ga0163161_10477924
547 Ga0213872_10058540
548 Ga0213876_10002291
549 Ga0213876_10006202
550 Ga0213875_10043589
551 Ga0213875_10106272
552 Ga0207692_10057942
553 Ga0207692_10067762
554 Ga0207642_10001301
555 Ga0207642_10044527
556 Ga0207710_10005559
557 Ga0207688_10034348
558 Ga0207680_10227448
559 Ga0207685_10004342
560 Ga0207645_10182251
561 Ga0207643_10045367
562 Ga0207643_10188499
563 Ga0207671_10016345
564 Ga0207693_10001055
565 Ga0207693_10001618
566 Ga0207662_10045716
567 Ga0207657_10046939
568 Ga0207694_10051364
569 Ga0207650_10219645
570 Ga0207687_10000764
571 Ga0207664_10051674
572 Ga0207644_10041844
573 Ga0207690_10295106
574 Ga0207709_10008755
575 Ga0207669_10000627
576 Ga0207704_10000923
577 Ga0207665_10008614
578 Ga0207665_10059770
579 Ga0207665_10210111
580 Ga0207665_10491264
581 Ga0207711_10030011
582 Ga0207661_10188662
583 Ga0207667_10092863
584 Ga0207712_10018855
585 Ga0207712_10095356
586 Ga0207668_10020569
587 Ga0207640_10015922
588 Ga0207658_10003566
589 Ga0207658_10025870
590 Ga0207658_10038522
591 Ga0207658_10264841
592 Ga0207677_10032088
593 Ga0207703_10016802
594 Ga0207639_10001347
595 Ga0207678_10005973
596 Ga0207678_10028618
597 Ga0207678_10110354
598 Ga0207708_10001524
599 Ga0207708_10032764
600 Ga0207702_10059657
601 Ga0207648_10004805
602 Ga0207648_10022637
603 Ga0207676_10037447
604 Ga0207676_10163949
605 Ga0207676_10392269
606 Ga0207675_100004732
607 Ga0207675_100331491
608 Ga0207675_100515650
609 Ga0207683_10002556
610 Ga0207683_10189104
611 Ga0207698_10434586
612 Ga0268266_10068429
613 Ga0268266_10072970
614 Ga0268266_10517780
615 Ga0268265_10005926
616 Ga0268264_10009224
617 Ga0307410_10013694
618 Ga0307412_10253154
619 Ga0307409_100170278
620 Ga0307416_100069063
621 Ga0307416_100237239
622 Ga0307414_10313848
623 Ga0307415_100022763
624 Ga0316582_0153823
625 Ga0436364_0798070
626 Ga0436364_1220451
627 Ga0436364_1390044
628 Ga0436365_0169608
629 Ga0436365_0263559
630 Ga0436365_1854889
631 Ga0436360_0305144
632 Ga0439466_0026114
633 Ga0439465_0006625
634 Ga0439465_0008883
635 Ga0439465_0012101
636 Ga0466972_0001842
637 Ga0466972_0005207
638 Ga0466972_0068342
639 Ga0466965_0018444
640 Ga0466963_0103509
641 Ga0466964_0188097
642 Ga0466971_0029066
643 Ga0466971_0056592
644 Ga0466968_0140660
645 Ga0466970_0032520
646 Ga0466957_0030143
647 Ga0466957_0097178
648 Ga0466960_0000171
649 Ga0466958_0076240
650 Ga0466967_0007608
651 Ga0466967_0020720
652 Ga0466967_0209996
653 Ga0495629_0007888
654 Ga0495638_0000244
655 Ga0495606_0080252
656 Ga0495658_0256250
657 Ga0495649_0059078
658 Ga0495581_0073473
659 Ga0495672_0003188
660 Ga0495673_0001500
661 Ga0495686_0002412
662 Ga0495593_0032555
663 Ga0496100_0000153
664 Ga0496100_0001206
665 Ga0496100_0006140
666 Ga0496100_0009043
667 Ga0496101_0000078
668 Ga0496101_0000104
669 Ga0496101_0001651
670 Ga0496101_0006391
671 Ga0496101_0006991
672 Ga0496102_0000056
673 Ga0496102_0003051
674 Ga0496102_0003940
675 Ga0496102_0004488
676 Ga0496102_0128841
677 Ga0496102_0188185
678 Ga0496102_0207527
679 Ga0496103_0000040
680 Ga0496103_0001356
681 Ga0496103_0017437
682 Ga0496103_0144849
683 Ga0496104_0005377
684 Ga0496104_0150118
685 Ga0496105_0017889
686 Ga0496105_0081579
687 Ga0496105_0096750
688 Ga0496106_0000916
689 Ga0496106_0002376
690 Ga0496106_0008729
691 Ga0496106_0207968
692 Ga0496107_0000384
693 Ga0496107_0000401
694 Ga0496108_0003127
695 Ga0496108_0048708
696 Ga0496108_0089020
697 Ga0496109_0000427
698 Ga0496109_0002322
699 Ga0496109_0087568
700 Ga0496109_0095242
701 Ga0496109_0201357
702 Ga0496110_0017775
703 Ga0496110_0142755
704 Ga0496110_0527207
705 Ga0496111_0025881
706 Ga0496111_0046317
707 Ga0496112_0004928
708 Ga0496112_0016886
709 Ga0496112_0089979
710 Ga0496113_0008695
711 Ga0496114_0000306
712 Ga0496114_0001884
713 Ga0496114_0222890
714 Ga0496115_0000451
715 Ga0496115_0000590
716 Ga0496115_0128113
717 Ga0496116_0000056
718 Ga0496116_0016963
719 Ga0496117_0000003
720 Ga0496117_0056479
721 Ga0496118_0000001
722 Ga0496118_0030182
723 Ga0496119_0002028
724 Ga0496119_0046355
725 Ga0496119_0213555
726 Ga0496120_0001057
727 Ga0496121_0000002
728 Ga0496121_0000121
729 Ga0496122_0000141
730 Ga0496122_0008842
731 Ga0496123_0014046
732 Ga0496123_0068315
733 Ga0496124_0000002
734 Ga0496124_0210686
735 Ga0496125_0000002
736 Ga0496126_0000011
737 Ga0496126_0005119
738 Ga0496126_0028877
739 Ga0501032_0003117
740 Ga0501032_0003633
741 Ga0501033_0021735
742 Ga0501033_0288220
743 Ga0501034_0003930
744 Ga0501034_0129956
745 Ga0501037_0019236
746 Ga0501039_0000701
747 Ga0501043_0005569
748 Ga0501043_0012872
749 Ga0501046_0002848
750 Ga0501047_0012026
751 Ga0501048_0006308
752 Ga0501070_0002577
753 Ga0501070_0003144
754 Ga0501073_0302290
755 Ga0501080_0040181
756 Ga0501080_0058104
757 Ga0501035_0003525
758 Ga0501044_0002377
759 Ga0501044_0004314
760 nmdc:mga03683_4635_c1
761 nmdc:mga03n38_16918_c1
762 nmdc:mga03n38_2991_c1
763 nmdc:mga03n38_33785_c1
764 nmdc:mga03n38_60138_c1
765 nmdc:mga00v17_1055_c1
766 nmdc:mga00v17_32762_c1
767 nmdc:mga00v17_5300_c1
768 nmdc:mga00v17_592_c1
769 nmdc:mga00v17_80460_c1
770 nmdc:mga00v17_89459_c1
771 nmdc:mga06z11_11187_c1
772 nmdc:mga07m45_195834_c1
773 nmdc:mga07m45_5364_c1
774 nmdc:mga05p37_177978_c1
775 nmdc:mga06r32_31402_c1
776 nmdc:mga08y16_442719_c1
777 nmdc:mga0sz30_11379_c1
778 nmdc:mga0sz30_2093_c1
779 nmdc:mga0sz30_25153_c1
780 nmdc:mga0sz30_467_c1
781 nmdc:mga0sz30_53232_c1
782 nmdc:mga0sz30_624_c1
783 nmdc:mga0sz30_94705_c1
784 Ga0500635_0034956
785 Ga0500643_014085
786 Ga0500652_000502
787 Ga0500645_000016
788 2523387288
789 2644511598
790 2738708725
791 2739333117
792 2842138294
793 2902798605
794 2902799374
795 2929215122
796 2939587499

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01106

NifU

NifU-like domain

100

165

0.98

Map