F433961

General Info

Members Datasets Scaffolds Average Seq Length
398 198 796 158

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10938215|Ga0070676_109382151
Length 150
Sequence MADSLPPEEVALWQRRLASQANNQAWRLSELPSRTPQEDEEMLQAAHAAMHFWRIVGDANNRAYAALLVAHAYALAQAEPAFLQHGCVPWERACATAVEANVASALGDAEKYATSYREAERLIAALPDAEDREVLNATLRVVSRASSGVA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
196 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 3.52
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10938215 3300005328 Unclassified 646
2 JGI24736J21556_1008414 3300001904 Bacteria 1716
3 JGI24739J22299_10080493 3300001989 Bacteria 1001
4 Ga0065712_10082055 3300005290 Bacteria 2939
5 Ga0070658_10011430 3300005327 Bacteria 7120
6 Ga0070658_10648080 3300005327 Bacteria 916
7 Ga0070676_10011526 3300005328 Bacteria 4807
8 Ga0070676_10515107 3300005328 Bacteria 851
9 Ga0070683_100064551 3300005329 Bacteria 3409
10 Ga0070690_100290716 3300005330 Bacteria 1169
11 Ga0070670_100012259 3300005331 Bacteria 7335
12 Ga0070670_100059489 3300005331 Bacteria 3279
13 Ga0070670_100518614 3300005331 Bacteria 1061
14 Ga0070670_101297528 3300005331 Unclassified 666
15 Ga0070670_101430979 3300005331 Unclassified 634
16 Ga0070677_10422602 3300005333 Bacteria 707
17 Ga0068869_100054926 3300005334 Bacteria 2901
18 Ga0070666_10002699 3300005335 Bacteria 10708
19 Ga0070666_10018262 3300005335 Bacteria 4507
20 Ga0070666_10083996 3300005335 Bacteria 2179
21 Ga0070660_100015131 3300005339 Bacteria 5566
22 Ga0070660_100363265 3300005339 Bacteria 1193
23 Ga0070687_100005118 3300005343 Bacteria 5287
24 Ga0070661_100010133 3300005344 Bacteria 6545
25 Ga0070661_100203202 3300005344 Bacteria 1515
26 Ga0070661_100531619 3300005344 Bacteria 944
27 Ga0070668_100185184 3300005347 Bacteria 1703
28 Ga0070668_100898533 3300005347 Unclassified 792
29 Ga0070668_101081463 3300005347 Unclassified 723
30 Ga0070669_100094646 3300005353 Bacteria 2245
31 Ga0070669_100829759 3300005353 Unclassified 787
32 Ga0070675_100001378 3300005354 Bacteria 17810
33 Ga0070675_100039408 3300005354 Bacteria 3856
34 Ga0070675_100096702 3300005354 Bacteria 2481
35 Ga0070675_100772165 3300005354 Unclassified 878
36 Ga0070671_100011146 3300005355 Bacteria 7221
37 Ga0070671_100024502 3300005355 Bacteria 4940
38 Ga0070671_100030681 3300005355 Bacteria 4437
39 Ga0070671_100650148 3300005355 Bacteria 913
40 Ga0070674_100151788 3300005356 Bacteria 1749
41 Ga0070674_100222520 3300005356 Bacteria 1469
42 Ga0070673_100000700 3300005364 Bacteria 18503
43 Ga0070673_100297504 3300005364 Unclassified 1420
44 Ga0070659_100003445 3300005366 Bacteria 11266
45 Ga0070659_100354916 3300005366 Bacteria 1231
46 Ga0070667_100139055 3300005367 Bacteria 2125
47 Ga0070667_100197619 3300005367 Bacteria 1783
48 Ga0070667_100355945 3300005367 Bacteria 1326
49 Ga0070667_101070184 3300005367 Unclassified 753
50 Ga0070667_101070185 3300005367 Bacteria 753
51 Ga0070711_100431940 3300005439 Unclassified 1075
52 Ga0070700_100004494 3300005441 Bacteria 7288
53 Ga0070663_100065467 3300005455 Bacteria 2631
54 Ga0070663_100141523 3300005455 Bacteria 1837
55 Ga0070663_100323966 3300005455 Bacteria 1240
56 Ga0070663_101461729 3300005455 Bacteria 607
57 Ga0070678_100020411 3300005456 Bacteria 4347
58 Ga0070678_100030672 3300005456 Bacteria 3699
59 Ga0070678_100049862 3300005456 Bacteria 3024
60 Ga0070678_100677580 3300005456 Bacteria 927
61 Ga0070678_100737939 3300005456 Bacteria 890
62 Ga0070662_100005206 3300005457 Bacteria 8298
63 Ga0070662_100007301 3300005457 Bacteria 7159
64 Ga0070662_100337222 3300005457 Bacteria 1233
65 Ga0070662_100563338 3300005457 Bacteria 956
66 Ga0070681_10035397 3300005458 Bacteria 5016
67 Ga0070685_10007891 3300005466 Bacteria 5453
68 Ga0070685_10799714 3300005466 Unclassified 695
69 Ga0070679_100080036 3300005530 Bacteria 3257
70 Ga0070684_101176451 3300005535 Bacteria 721
71 Ga0070684_101496014 3300005535 Bacteria 636
72 Ga0068853_100006396 3300005539 Bacteria 9356
73 Ga0068853_100019697 3300005539 Bacteria 5601
74 Ga0068853_100077944 3300005539 Bacteria 2895
75 Ga0068853_100115664 3300005539 Bacteria 2387
76 Ga0068853_100536097 3300005539 Bacteria 1108
77 Ga0068853_100915520 3300005539 Unclassified 842
78 Ga0068853_100969416 3300005539 Unclassified 818
79 Ga0070672_100008142 3300005543 Bacteria 7165
80 Ga0070672_100683893 3300005543 Unclassified 898
81 Ga0070686_100001038 3300005544 Bacteria 15968
82 Ga0070686_100885457 3300005544 Bacteria 725
83 Ga0070695_100687585 3300005545 Bacteria 811
84 Ga0070693_100354753 3300005547 Bacteria 1005
85 Ga0070665_100001521 3300005548 Bacteria 26874
86 Ga0070665_100098128 3300005548 Bacteria 2934
87 Ga0070665_100834730 3300005548 Unclassified 935
88 Ga0070704_100579081 3300005549 Bacteria 984
89 Ga0068855_100000634 3300005563 Bacteria 42949
90 Ga0068855_100308480 3300005563 Bacteria 1751
91 Ga0070664_100000284 3300005564 Bacteria 36685
92 Ga0070664_100313338 3300005564 Bacteria 1420
93 Ga0070664_100430844 3300005564 Bacteria 1209
94 Ga0068857_100073448 3300005577 Bacteria 3047
95 Ga0068854_100011914 3300005578 Bacteria 5681
96 Ga0068854_100019805 3300005578 Bacteria 4541
97 Ga0068854_100096508 3300005578 Bacteria 2209
98 Ga0068854_100309948 3300005578 Bacteria 1280
99 Ga0068854_101064769 3300005578 Bacteria 719
100 Ga0068854_101674547 3300005578 Bacteria 581
101 Ga0068856_100000681 3300005614 Bacteria 36870
102 Ga0068856_100627294 3300005614 Bacteria 1096
103 Ga0068856_101210597 3300005614 Unclassified 771
104 Ga0068856_101450510 3300005614 Unclassified 700
105 Ga0070702_100000971 3300005615 Bacteria 11317
106 Ga0068852_100012303 3300005616 Bacteria 6491
107 Ga0068852_100153139 3300005616 Bacteria 2146
108 Ga0068852_100232953 3300005616 Bacteria 1756
109 Ga0068852_100428691 3300005616 Bacteria 1306
110 Ga0068852_100459418 3300005616 Unclassified 1262
111 Ga0068852_102342332 3300005616 Unclassified 555
112 Ga0068859_100491091 3300005617 Unclassified 1323
113 Ga0068859_101123409 3300005617 Bacteria 865
114 Ga0068864_100064089 3300005618 Bacteria 3186
115 Ga0068866_10030360 3300005718 Bacteria 2594
116 Ga0068861_100012805 3300005719 Bacteria 5857
117 Ga0068861_100305127 3300005719 Bacteria 1380
118 Ga0068861_100382567 3300005719 Bacteria 1244
119 Ga0068851_10040935 3300005834 Bacteria 2329
120 Ga0068851_10184459 3300005834 Bacteria 1157
121 Ga0068851_10337924 3300005834 Bacteria 873
122 Ga0068851_10535378 3300005834 Unclassified 706
123 Ga0068863_100001991 3300005841 Bacteria 20307
124 Ga0068863_100029055 3300005841 Bacteria 5281
125 Ga0068863_100361091 3300005841 Unclassified 1416
126 Ga0068863_100482877 3300005841 Bacteria 1219
127 Ga0068863_101745633 3300005841 Unclassified 632
128 Ga0068858_100006090 3300005842 Bacteria 11767
129 Ga0068858_100110790 3300005842 Bacteria 2563
130 Ga0068860_100071536 3300005843 Bacteria 3296
131 Ga0068860_100186372 3300005843 Unclassified 2007
132 Ga0068860_101746272 3300005843 Unclassified 644
133 Ga0097621_100031814 3300006237 Bacteria 4188
134 Ga0097621_100204944 3300006237 Bacteria 1713
135 Ga0097621_100426801 3300006237 Bacteria 1191
136 Ga0075370_10219269 3300006353 Bacteria 1124
137 Ga0068871_100199793 3300006358 Bacteria 1725
138 Ga0068871_100492537 3300006358 Bacteria 1104
139 Ga0068865_101406912 3300006881 Bacteria 623
140 Ga0097620_100490985 3300006931 Unclassified 1323
141 Ga0097620_101123455 3300006931 Bacteria 865
142 Ga0105240_10036939 3300009093 Bacteria 6279
143 Ga0105240_10315961 3300009093 Bacteria 1782
144 Ga0105240_10626069 3300009093 Bacteria 1182
145 Ga0105240_10717232 3300009093 Bacteria 1090
146 Ga0105240_10983831 3300009093 Unclassified 903
147 Ga0111539_10021657 3300009094 Bacteria 7907
148 Ga0105245_10701888 3300009098 Bacteria 1045
149 Ga0105245_10855836 3300009098 Bacteria 949
150 Ga0105243_10098855 3300009148 Bacteria 2418
151 Ga0105241_10027156 3300009174 Bacteria 4261
152 Ga0105241_10072430 3300009174 Bacteria 2678
153 Ga0105242_10251068 3300009176 Bacteria 1594
154 Ga0105248_10001612 3300009177 Bacteria 25083
155 Ga0105248_10532676 3300009177 Bacteria 1325
156 Ga0105248_10642221 3300009177 Unclassified 1197
157 Ga0105237_10075443 3300009545 Bacteria 3363
158 Ga0105237_10236591 3300009545 Bacteria 1828
159 Ga0105237_11088562 3300009545 Unclassified 806
160 Ga0105237_11452919 3300009545 Unclassified 692
161 Ga0105238_10001625 3300009551 Bacteria 22496
162 Ga0105238_10177666 3300009551 Bacteria 2106
163 Ga0105238_10291779 3300009551 Bacteria 1613
164 Ga0105238_11337279 3300009551 Bacteria 743
165 Ga0105238_12083262 3300009551 Unclassified 601
166 Ga0105249_10067053 3300009553 Bacteria 3305
167 Ga0105249_10072540 3300009553 Bacteria 3183
168 Ga0105239_10040553 3300010375 Bacteria 5100
169 Ga0105239_10199450 3300010375 Bacteria 2242
170 Ga0105239_10240279 3300010375 Bacteria 2033
171 Ga0105239_10452174 3300010375 Bacteria 1457
172 Ga0157373_10000725 3300013100 Bacteria 25780
173 Ga0157373_10100276 3300013100 Bacteria 2038
174 Ga0157371_10000174 3300013102 Bacteria 93381
175 Ga0157370_10191461 3300013104 Bacteria 1898
176 Ga0157370_10429369 3300013104 Bacteria 1215
177 Ga0157370_11524507 3300013104 Unclassified 601
178 Ga0157369_10000308 3300013105 Bacteria 65409
179 Ga0157369_10085739 3300013105 Bacteria 3365
180 Ga0157369_10368032 3300013105 Bacteria 1492
181 Ga0157369_10523447 3300013105 Bacteria 1226
182 Ga0157374_10448954 3300013296 Bacteria 1291
183 Ga0157374_10849478 3300013296 Unclassified 930
184 Ga0157374_11526046 3300013296 Unclassified 691
185 Ga0157378_10004587 3300013297 Bacteria 12117
186 Ga0157378_10089107 3300013297 Bacteria 2801
187 Ga0157378_10452231 3300013297 Bacteria 1275
188 Ga0163162_10000070 3300013306 Bacteria 96586
189 Ga0163162_10010404 3300013306 Bacteria 9041
190 Ga0163162_10356927 3300013306 Bacteria 1594
191 Ga0157372_10000712 3300013307 Bacteria 36536
192 Ga0157372_10134496 3300013307 Bacteria 2846
193 Ga0157372_10212728 3300013307 Bacteria 2241
194 Ga0157372_10659912 3300013307 Bacteria 1218
195 Ga0157372_10731655 3300013307 Bacteria 1150
196 Ga0157375_10033394 3300013308 Bacteria 4889
197 Ga0157375_10069734 3300013308 Bacteria 3523
198 Ga0157375_10073360 3300013308 Bacteria 3441
199 Ga0157377_10001630 3300014745 Bacteria 9779
200 Ga0157379_10619093 3300014968 Bacteria 1012
201 Ga0157379_10796942 3300014968 Unclassified 892
202 Ga0157376_10111735 3300014969 Bacteria 2406
203 Ga0157376_10140798 3300014969 Bacteria 2164
204 Ga0157376_10398309 3300014969 Unclassified 1330
205 Ga0157376_10456422 3300014969 Bacteria 1248
206 Ga0163161_11029995 3300017792 Bacteria 704
207 Ga0209672_101408 3300025228 Bacteria 8779
208 Ga0209437_101225 3300025233 Bacteria 7315
209 Ga0209455_1005598 3300025272 Bacteria 3852
210 Ga0209051_1024302 3300025303 Bacteria 2494
211 Ga0207697_10261316 3300025315 Unclassified 766
212 Ga0207656_10033688 3300025321 Bacteria 2135
213 Ga0207656_10111716 3300025321 Bacteria 1263
214 Ga0207692_10510669 3300025898 Unclassified 764
215 Ga0207680_10029098 3300025903 Bacteria 3099
216 Ga0207680_10164900 3300025903 Bacteria 1488
217 Ga0207680_10170940 3300025903 Bacteria 1464
218 Ga0207680_10186020 3300025903 Bacteria 1407
219 Ga0207647_10000019 3300025904 Bacteria 123924
220 Ga0207699_10550361 3300025906 Unclassified 837
221 Ga0207645_10014486 3300025907 Bacteria 5275
222 Ga0207645_10561105 3300025907 Unclassified 775
223 Ga0207705_10100677 3300025909 Bacteria 2125
224 Ga0207705_10411274 3300025909 Bacteria 1047
225 Ga0207654_10064741 3300025911 Bacteria 2150
226 Ga0207707_10128823 3300025912 Bacteria 2213
227 Ga0207695_10011573 3300025913 Bacteria 10671
228 Ga0207695_10028052 3300025913 Bacteria 6252
229 Ga0207695_10067526 3300025913 Bacteria 3668
230 Ga0207671_10008754 3300025914 Bacteria 8525
231 Ga0207671_10109693 3300025914 Bacteria 2099
232 Ga0207671_10387867 3300025914 Bacteria 1110
233 Ga0207671_10710432 3300025914 Unclassified 799
234 Ga0207663_10337813 3300025916 Unclassified 1137
235 Ga0207663_10662069 3300025916 Bacteria 825
236 Ga0207662_10013298 3300025918 Bacteria 4602
237 Ga0207657_10000234 3300025919 Bacteria 58447
238 Ga0207649_10011101 3300025920 Bacteria 4958
239 Ga0207649_10026851 3300025920 Bacteria 3372
240 Ga0207649_11014193 3300025920 Unclassified 653
241 Ga0207652_10056560 3300025921 Bacteria 3377
242 Ga0207681_10071842 3300025923 Bacteria 2415
243 Ga0207681_10083767 3300025923 Bacteria 2258
244 Ga0207681_10456039 3300025923 Bacteria 1041
245 Ga0207694_10001535 3300025924 Bacteria 19628
246 Ga0207694_10008148 3300025924 Bacteria 7918
247 Ga0207694_10017910 3300025924 Bacteria 5355
248 Ga0207650_10034298 3300025925 Bacteria 3680
249 Ga0207650_10049096 3300025925 Bacteria 3115
250 Ga0207650_10137869 3300025925 Bacteria 1915
251 Ga0207650_10191699 3300025925 Bacteria 1633
252 Ga0207650_10550981 3300025925 Bacteria 967
253 Ga0207659_10025131 3300025926 Bacteria 3998
254 Ga0207659_10034454 3300025926 Bacteria 3491
255 Ga0207659_10553702 3300025926 Unclassified 978
256 Ga0207687_10712596 3300025927 Bacteria 852
257 Ga0207644_10011467 3300025931 Bacteria 5866
258 Ga0207644_10023448 3300025931 Bacteria 4226
259 Ga0207644_10273499 3300025931 Bacteria 1354
260 Ga0207690_10019028 3300025932 Bacteria 4218
261 Ga0207706_10000097 3300025933 Bacteria 91923
262 Ga0207706_10003006 3300025933 Bacteria 16254
263 Ga0207706_10858120 3300025933 Unclassified 769
264 Ga0207706_10998932 3300025933 Unclassified 703
265 Ga0207686_10347661 3300025934 Bacteria 1115
266 Ga0207704_10042703 3300025938 Bacteria 2671
267 Ga0207704_10314032 3300025938 Bacteria 1206
268 Ga0207691_10050249 3300025940 Bacteria 3818
269 Ga0207691_10083872 3300025940 Bacteria 2861
270 Ga0207691_10154384 3300025940 Bacteria 2017
271 Ga0207711_10015457 3300025941 Bacteria 6334
272 Ga0207711_10397957 3300025941 Bacteria 1279
273 Ga0207689_10000417 3300025942 Bacteria 39835
274 Ga0207679_10004363 3300025945 Bacteria 8806
275 Ga0207679_10369812 3300025945 Bacteria 1254
276 Ga0207667_10001396 3300025949 Bacteria 30278
277 Ga0207667_10098029 3300025949 Bacteria 3025
278 Ga0207651_10005902 3300025960 Bacteria 6337
279 Ga0207651_10719136 3300025960 Unclassified 881
280 Ga0207712_10000601 3300025961 Bacteria 28655
281 Ga0207712_11698623 3300025961 Unclassified 566
282 Ga0207668_10376811 3300025972 Bacteria 1193
283 Ga0207640_10006300 3300025981 Bacteria 6506
284 Ga0207640_10024267 3300025981 Bacteria 3657
285 Ga0207640_10744141 3300025981 Unclassified 845
286 Ga0207640_10846748 3300025981 Bacteria 795
287 Ga0207640_11370675 3300025981 Bacteria 633
288 Ga0207658_10045369 3300025986 Bacteria 3203
289 Ga0207658_10132120 3300025986 Bacteria 2007
290 Ga0207658_10316471 3300025986 Bacteria 1350
291 Ga0207677_10337868 3300026023 Bacteria 1257
292 Ga0207703_10006133 3300026035 Bacteria 9621
293 Ga0207639_10000117 3300026041 Bacteria 61185
294 Ga0207639_10006979 3300026041 Bacteria 7696
295 Ga0207639_10030425 3300026041 Bacteria 3959
296 Ga0207639_10654538 3300026041 Bacteria 972
297 Ga0207678_10009716 3300026067 Bacteria 8460
298 Ga0207678_10020176 3300026067 Bacteria 5852
299 Ga0207678_10229149 3300026067 Bacteria 1591
300 Ga0207678_10291276 3300026067 Bacteria 1402
301 Ga0207708_10010732 3300026075 Bacteria 6809
302 Ga0207702_10004946 3300026078 Bacteria 11710
303 Ga0207702_10190887 3300026078 Bacteria 1893
304 Ga0207702_10263894 3300026078 Bacteria 1622
305 Ga0207702_10266260 3300026078 Bacteria 1615
306 Ga0207641_10089741 3300026088 Bacteria 2687
307 Ga0207641_10318907 3300026088 Bacteria 1473
308 Ga0207641_10359719 3300026088 Unclassified 1389
309 Ga0207648_10141903 3300026089 Unclassified 2117
310 Ga0207648_10235826 3300026089 Bacteria 1628
311 Ga0207676_10089625 3300026095 Bacteria 2521
312 Ga0207676_10345264 3300026095 Bacteria 1375
313 Ga0207676_11514254 3300026095 Unclassified 668
314 Ga0207674_10055735 3300026116 Bacteria 4017
315 Ga0207674_10074079 3300026116 Bacteria 3417
316 Ga0207674_10263050 3300026116 Unclassified 1672
317 Ga0207675_100006117 3300026118 Bacteria 11442
318 Ga0207675_100141408 3300026118 Bacteria 2286
319 Ga0207683_10027052 3300026121 Bacteria 4957
320 Ga0207683_10128814 3300026121 Bacteria 2275
321 Ga0207683_10154508 3300026121 Archaea 2072
322 Ga0207683_10185469 3300026121 Bacteria 1887
323 Ga0207698_10007013 3300026142 Bacteria 7058
324 Ga0207698_10198762 3300026142 Bacteria 1793
325 Ga0207698_10441915 3300026142 Bacteria 1253
326 Ga0207698_10883996 3300026142 Unclassified 900
327 Ga0207428_10180093 3300027907 Bacteria 1597
328 Ga0268266_10000007 3300028379 Bacteria 1372921
329 Ga0268266_10299157 3300028379 Bacteria 1500
330 Ga0268265_10140759 3300028380 Bacteria 2020
331 Ga0268264_10125352 3300028381 Bacteria 2269
332 Ga0268264_11233033 3300028381 Unclassified 758
333 Ga0307515_10023733 3300028794 Bacteria 10731
334 Ga0307509_10063558 3300031507 Bacteria 3885
335 Ga0373944_0009093 3300035089 Bacteria 2689
336 Ga0373945_0060695 3300035116 Bacteria 1411
337 Ga0373955_0510886 3300035172 Unclassified 734
338 Ga0373924_0069699 3300035410 Bacteria 1482
339 Ga0373947_0452449 3300035725 Unclassified 870
340 Ga0373937_0034320 3300036401 Bacteria 4615
341 Ga0373937_0078582 3300036401 Bacteria 3049
342 Ga0373925_0033454 3300037068 Bacteria 3788
343 Ga0373925_0887823 3300037068 Bacteria 735
344 Ga0395899_0013830 3300037312 Bacteria 6167
345 Ga0395898_0001677 3300037466 Bacteria 29673
346 Ga0451789_0856323 3300041443 Bacteria 599
347 Ga0451833_1255750 3300041491 Unclassified 935
348 Ga0451847_0757350 3300041503 Unclassified 568
349 Ga0451853_0459477 3300041512 Unclassified 605
350 Ga0439441_004847 3300042001 Unclassified 2060
351 Ga0451577_0191978 3300042876 Bacteria 1842
352 Ga0453684_0027249 3300044712 Bacteria 8203
353 Ga0466959_0028286 3300045049 Bacteria 4156
354 Ga0466958_0006100 3300045836 Bacteria 6532
355 Ga0495629_0121514 3300046459 Bacteria 1820
356 Ga0495638_0000009 3300046460 Bacteria 525345
357 Ga0495580_0147274 3300046472 Bacteria 1632
358 Ga0495582_0191924 3300046473 Bacteria 1166
359 Ga0495606_0001915 3300046507 Bacteria 25886
360 Ga0495622_0022520 3300046557 Bacteria 2936
361 Ga0495625_0048507 3300046660 Bacteria 3057
362 Ga0495657_0156838 3300046675 Unclassified 1410
363 Ga0495647_0221906 3300046681 Bacteria 835
364 Ga0495658_0046476 3300046683 Bacteria 2440
365 Ga0495671_0136322 3300046692 Bacteria 1196
366 Ga0495649_0000266 3300046694 Bacteria 46547
367 Ga0495600_0626867 3300046809 Unclassified 652
368 Ga0495581_0229927 3300047315 Bacteria 1085
369 Ga0496100_1519371 3300048903 Bacteria 529
370 Ga0496102_0512171 3300048905 Bacteria 1122
371 Ga0496105_0145438 3300048908 Bacteria 1949
372 Ga0496106_0000897 3300048909 Bacteria 21762
373 Ga0496106_0227893 3300048909 Bacteria 1487
374 Ga0496106_0629287 3300048909 Bacteria 858
375 Ga0496107_0009339 3300048910 Bacteria 6798
376 Ga0496109_0649985 3300048912 Bacteria 991
377 Ga0496111_0565385 3300048914 Bacteria 834
378 Ga0496114_0091012 3300048917 Bacteria 2590
379 Ga0496114_0613493 3300048917 Unclassified 959
380 Ga0496115_0000046 3300048918 Bacteria 112212
381 Ga0496115_0001229 3300048918 Bacteria 18394
382 Ga0496126_0025046 3300048929 Bacteria 5750
383 Ga0496126_0083291 3300048929 Bacteria 2823
384 Ga0495682_0030689 3300049460 Bacteria 1988
385 Ga0501037_0218553 3300049573 Bacteria 1342
386 Ga0501043_0056432 3300049579 Bacteria 3085
387 Ga0501043_0197425 3300049579 Bacteria 1563
388 Ga0501046_0011632 3300049580 Bacteria 7523
389 Ga0501070_0132500 3300049586 Bacteria 2059
390 Ga0501073_0130439 3300049589 Bacteria 1742
391 Ga0501044_0256727 3300049823 Bacteria 1687
392 nmdc:mga08y16_22575_c1 3300050511 Bacteria 6644
393 Ga0495619_0173560 3300053085 Bacteria 1491
394 Ga0500651_0000924 3300053093 Bacteria 14398
395 Ga0500566_0153330 3300053094 Bacteria 1209
396 Ga0500614_171327 3300053123 Unclassified 661
397 Ga0501084_0125940 3300054114 Bacteria 2155
398 Ga0501082_0000672 3300060353 Bacteria 30077
399 Ga0070676_10938215
400 JGI24736J21556_1008414
401 JGI24739J22299_10080493
402 Ga0065712_10082055
403 Ga0070658_10011430
404 Ga0070658_10648080
405 Ga0070676_10011526
406 Ga0070676_10515107
407 Ga0070683_100064551
408 Ga0070690_100290716
409 Ga0070670_100012259
410 Ga0070670_100059489
411 Ga0070670_100518614
412 Ga0070670_101297528
413 Ga0070670_101430979
414 Ga0070677_10422602
415 Ga0068869_100054926
416 Ga0070666_10002699
417 Ga0070666_10018262
418 Ga0070666_10083996
419 Ga0070660_100015131
420 Ga0070660_100363265
421 Ga0070687_100005118
422 Ga0070661_100010133
423 Ga0070661_100203202
424 Ga0070661_100531619
425 Ga0070668_100185184
426 Ga0070668_100898533
427 Ga0070668_101081463
428 Ga0070669_100094646
429 Ga0070669_100829759
430 Ga0070675_100001378
431 Ga0070675_100039408
432 Ga0070675_100096702
433 Ga0070675_100772165
434 Ga0070671_100011146
435 Ga0070671_100024502
436 Ga0070671_100030681
437 Ga0070671_100650148
438 Ga0070674_100151788
439 Ga0070674_100222520
440 Ga0070673_100000700
441 Ga0070673_100297504
442 Ga0070659_100003445
443 Ga0070659_100354916
444 Ga0070667_100139055
445 Ga0070667_100197619
446 Ga0070667_100355945
447 Ga0070667_101070184
448 Ga0070667_101070185
449 Ga0070711_100431940
450 Ga0070700_100004494
451 Ga0070663_100065467
452 Ga0070663_100141523
453 Ga0070663_100323966
454 Ga0070663_101461729
455 Ga0070678_100020411
456 Ga0070678_100030672
457 Ga0070678_100049862
458 Ga0070678_100677580
459 Ga0070678_100737939
460 Ga0070662_100005206
461 Ga0070662_100007301
462 Ga0070662_100337222
463 Ga0070662_100563338
464 Ga0070681_10035397
465 Ga0070685_10007891
466 Ga0070685_10799714
467 Ga0070679_100080036
468 Ga0070684_101176451
469 Ga0070684_101496014
470 Ga0068853_100006396
471 Ga0068853_100019697
472 Ga0068853_100077944
473 Ga0068853_100115664
474 Ga0068853_100536097
475 Ga0068853_100915520
476 Ga0068853_100969416
477 Ga0070672_100008142
478 Ga0070672_100683893
479 Ga0070686_100001038
480 Ga0070686_100885457
481 Ga0070695_100687585
482 Ga0070693_100354753
483 Ga0070665_100001521
484 Ga0070665_100098128
485 Ga0070665_100834730
486 Ga0070704_100579081
487 Ga0068855_100000634
488 Ga0068855_100308480
489 Ga0070664_100000284
490 Ga0070664_100313338
491 Ga0070664_100430844
492 Ga0068857_100073448
493 Ga0068854_100011914
494 Ga0068854_100019805
495 Ga0068854_100096508
496 Ga0068854_100309948
497 Ga0068854_101064769
498 Ga0068854_101674547
499 Ga0068856_100000681
500 Ga0068856_100627294
501 Ga0068856_101210597
502 Ga0068856_101450510
503 Ga0070702_100000971
504 Ga0068852_100012303
505 Ga0068852_100153139
506 Ga0068852_100232953
507 Ga0068852_100428691
508 Ga0068852_100459418
509 Ga0068852_102342332
510 Ga0068859_100491091
511 Ga0068859_101123409
512 Ga0068864_100064089
513 Ga0068866_10030360
514 Ga0068861_100012805
515 Ga0068861_100305127
516 Ga0068861_100382567
517 Ga0068851_10040935
518 Ga0068851_10184459
519 Ga0068851_10337924
520 Ga0068851_10535378
521 Ga0068863_100001991
522 Ga0068863_100029055
523 Ga0068863_100361091
524 Ga0068863_100482877
525 Ga0068863_101745633
526 Ga0068858_100006090
527 Ga0068858_100110790
528 Ga0068860_100071536
529 Ga0068860_100186372
530 Ga0068860_101746272
531 Ga0097621_100031814
532 Ga0097621_100204944
533 Ga0097621_100426801
534 Ga0075370_10219269
535 Ga0068871_100199793
536 Ga0068871_100492537
537 Ga0068865_101406912
538 Ga0097620_100490985
539 Ga0097620_101123455
540 Ga0105240_10036939
541 Ga0105240_10315961
542 Ga0105240_10626069
543 Ga0105240_10717232
544 Ga0105240_10983831
545 Ga0111539_10021657
546 Ga0105245_10701888
547 Ga0105245_10855836
548 Ga0105243_10098855
549 Ga0105241_10027156
550 Ga0105241_10072430
551 Ga0105242_10251068
552 Ga0105248_10001612
553 Ga0105248_10532676
554 Ga0105248_10642221
555 Ga0105237_10075443
556 Ga0105237_10236591
557 Ga0105237_11088562
558 Ga0105237_11452919
559 Ga0105238_10001625
560 Ga0105238_10177666
561 Ga0105238_10291779
562 Ga0105238_11337279
563 Ga0105238_12083262
564 Ga0105249_10067053
565 Ga0105249_10072540
566 Ga0105239_10040553
567 Ga0105239_10199450
568 Ga0105239_10240279
569 Ga0105239_10452174
570 Ga0157373_10000725
571 Ga0157373_10100276
572 Ga0157371_10000174
573 Ga0157370_10191461
574 Ga0157370_10429369
575 Ga0157370_11524507
576 Ga0157369_10000308
577 Ga0157369_10085739
578 Ga0157369_10368032
579 Ga0157369_10523447
580 Ga0157374_10448954
581 Ga0157374_10849478
582 Ga0157374_11526046
583 Ga0157378_10004587
584 Ga0157378_10089107
585 Ga0157378_10452231
586 Ga0163162_10000070
587 Ga0163162_10010404
588 Ga0163162_10356927
589 Ga0157372_10000712
590 Ga0157372_10134496
591 Ga0157372_10212728
592 Ga0157372_10659912
593 Ga0157372_10731655
594 Ga0157375_10033394
595 Ga0157375_10069734
596 Ga0157375_10073360
597 Ga0157377_10001630
598 Ga0157379_10619093
599 Ga0157379_10796942
600 Ga0157376_10111735
601 Ga0157376_10140798
602 Ga0157376_10398309
603 Ga0157376_10456422
604 Ga0163161_11029995
605 Ga0209672_101408
606 Ga0209437_101225
607 Ga0209455_1005598
608 Ga0209051_1024302
609 Ga0207697_10261316
610 Ga0207656_10033688
611 Ga0207656_10111716
612 Ga0207692_10510669
613 Ga0207680_10029098
614 Ga0207680_10164900
615 Ga0207680_10170940
616 Ga0207680_10186020
617 Ga0207647_10000019
618 Ga0207699_10550361
619 Ga0207645_10014486
620 Ga0207645_10561105
621 Ga0207705_10100677
622 Ga0207705_10411274
623 Ga0207654_10064741
624 Ga0207707_10128823
625 Ga0207695_10011573
626 Ga0207695_10028052
627 Ga0207695_10067526
628 Ga0207671_10008754
629 Ga0207671_10109693
630 Ga0207671_10387867
631 Ga0207671_10710432
632 Ga0207663_10337813
633 Ga0207663_10662069
634 Ga0207662_10013298
635 Ga0207657_10000234
636 Ga0207649_10011101
637 Ga0207649_10026851
638 Ga0207649_11014193
639 Ga0207652_10056560
640 Ga0207681_10071842
641 Ga0207681_10083767
642 Ga0207681_10456039
643 Ga0207694_10001535
644 Ga0207694_10008148
645 Ga0207694_10017910
646 Ga0207650_10034298
647 Ga0207650_10049096
648 Ga0207650_10137869
649 Ga0207650_10191699
650 Ga0207650_10550981
651 Ga0207659_10025131
652 Ga0207659_10034454
653 Ga0207659_10553702
654 Ga0207687_10712596
655 Ga0207644_10011467
656 Ga0207644_10023448
657 Ga0207644_10273499
658 Ga0207690_10019028
659 Ga0207706_10000097
660 Ga0207706_10003006
661 Ga0207706_10858120
662 Ga0207706_10998932
663 Ga0207686_10347661
664 Ga0207704_10042703
665 Ga0207704_10314032
666 Ga0207691_10050249
667 Ga0207691_10083872
668 Ga0207691_10154384
669 Ga0207711_10015457
670 Ga0207711_10397957
671 Ga0207689_10000417
672 Ga0207679_10004363
673 Ga0207679_10369812
674 Ga0207667_10001396
675 Ga0207667_10098029
676 Ga0207651_10005902
677 Ga0207651_10719136
678 Ga0207712_10000601
679 Ga0207712_11698623
680 Ga0207668_10376811
681 Ga0207640_10006300
682 Ga0207640_10024267
683 Ga0207640_10744141
684 Ga0207640_10846748
685 Ga0207640_11370675
686 Ga0207658_10045369
687 Ga0207658_10132120
688 Ga0207658_10316471
689 Ga0207677_10337868
690 Ga0207703_10006133
691 Ga0207639_10000117
692 Ga0207639_10006979
693 Ga0207639_10030425
694 Ga0207639_10654538
695 Ga0207678_10009716
696 Ga0207678_10020176
697 Ga0207678_10229149
698 Ga0207678_10291276
699 Ga0207708_10010732
700 Ga0207702_10004946
701 Ga0207702_10190887
702 Ga0207702_10263894
703 Ga0207702_10266260
704 Ga0207641_10089741
705 Ga0207641_10318907
706 Ga0207641_10359719
707 Ga0207648_10141903
708 Ga0207648_10235826
709 Ga0207676_10089625
710 Ga0207676_10345264
711 Ga0207676_11514254
712 Ga0207674_10055735
713 Ga0207674_10074079
714 Ga0207674_10263050
715 Ga0207675_100006117
716 Ga0207675_100141408
717 Ga0207683_10027052
718 Ga0207683_10128814
719 Ga0207683_10154508
720 Ga0207683_10185469
721 Ga0207698_10007013
722 Ga0207698_10198762
723 Ga0207698_10441915
724 Ga0207698_10883996
725 Ga0207428_10180093
726 Ga0268266_10000007
727 Ga0268266_10299157
728 Ga0268265_10140759
729 Ga0268264_10125352
730 Ga0268264_11233033
731 Ga0307515_10023733
732 Ga0307509_10063558
733 Ga0373944_0009093
734 Ga0373945_0060695
735 Ga0373955_0510886
736 Ga0373924_0069699
737 Ga0373947_0452449
738 Ga0373937_0034320
739 Ga0373937_0078582
740 Ga0373925_0033454
741 Ga0373925_0887823
742 Ga0395899_0013830
743 Ga0395898_0001677
744 Ga0451789_0856323
745 Ga0451833_1255750
746 Ga0451847_0757350
747 Ga0451853_0459477
748 Ga0439441_004847
749 Ga0451577_0191978
750 Ga0453684_0027249
751 Ga0466959_0028286
752 Ga0466958_0006100
753 Ga0495629_0121514
754 Ga0495638_0000009
755 Ga0495580_0147274
756 Ga0495582_0191924
757 Ga0495606_0001915
758 Ga0495622_0022520
759 Ga0495625_0048507
760 Ga0495657_0156838
761 Ga0495647_0221906
762 Ga0495658_0046476
763 Ga0495671_0136322
764 Ga0495649_0000266
765 Ga0495600_0626867
766 Ga0495581_0229927
767 Ga0496100_1519371
768 Ga0496102_0512171
769 Ga0496105_0145438
770 Ga0496106_0000897
771 Ga0496106_0227893
772 Ga0496106_0629287
773 Ga0496107_0009339
774 Ga0496109_0649985
775 Ga0496111_0565385
776 Ga0496114_0091012
777 Ga0496114_0613493
778 Ga0496115_0000046
779 Ga0496115_0001229
780 Ga0496126_0025046
781 Ga0496126_0083291
782 Ga0495682_0030689
783 Ga0501037_0218553
784 Ga0501043_0056432
785 Ga0501043_0197425
786 Ga0501046_0011632
787 Ga0501070_0132500
788 Ga0501073_0130439
789 Ga0501044_0256727
790 nmdc:mga08y16_22575_c1
791 Ga0495619_0173560
792 Ga0500651_0000924
793 Ga0500566_0153330
794 Ga0500614_171327
795 Ga0501084_0125940
796 Ga0501082_0000672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8209 64 133
4gyo-assembly3.cif.gz_B crystal structure of rap protein complexed with competence and sporulation factor 0.7968 37 150
4gyo-assembly2.cif.gz_A crystal structure of rap protein complexed with competence and sporulation factor 0.7951 37 150
4wne-assembly1.cif.gz_A crystal structure of the tpr domain of lgn in complex with frmpd4/preso1 at 2.0 angstrom resolution 0.7872 39 150
6j2x-assembly1.cif.gz_Q yeast proteasome in resting state (c1-a) 0.7813 39 146
ID Description Score Start End Superfamily
af_P18296_840_1330_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8542 37 135 1.25.40.10
af_Q09485_118_204_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8257 63 146 1.25.40.10
af_Q54KD0_1109_1271_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8249 37 139 1.25.40.10
af_A0A1D8PLW8_56_435_1.25.40.570 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.8206 34 137 1.25.40.570
af_Q9VSK6_675_829_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8172 37 131 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A3S2TIG4-F1-model_v4 Uncharacterized protein 0.9808 1 158
AF-A0A2V8JYG2-F1-model_v4 Uncharacterized protein 0.9644 1 158
AF-A0A2N5X0G6-F1-model_v4 Uncharacterized protein 0.9592 43 158
AF-A0A800MG09-F1-model_v4 Uncharacterized protein 0.9549 5 155
AF-A0A382T5Z0-F1-model_v4 Uncharacterized protein 0.9448 53 156

Map