F433891

General Info

Members Datasets Scaffolds Average Seq Length
397 202 794 133

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_1071737_c1|nmdc:mga08y16_1071737_c1_171_626
Length 151
Sequence MTSLLAIAVVAAMVAPVLAHHSATMFESEKTITVEGVVKEFQFTNPHSWLLVDVKNKNGTVTTWGFEAEGPSTLQRSGIRPSDFAAGTKLKITGRPMKNGSPAAIWVDAVRADGKRFDPRRIQGQVGNGESGERPGAEAFPSLAKEGWLRH

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.75
Stem 0
Stem Tuber 0
Unclassified 41.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_1071737_c1 3300050511 Bacteria 782
2 JGI25406J46586_10089776 3300003203 Bacteria 929
3 Ga0065704_10681372 3300005289 Unclassified 556
4 Ga0065712_10327474 3300005290 Unclassified 819
5 Ga0065712_10411962 3300005290 Bacteria 720
6 Ga0065715_10219620 3300005293 Bacteria 1278
7 Ga0065715_10538663 3300005293 Unclassified 723
8 Ga0065707_10484805 3300005295 Unclassified 770
9 Ga0070683_101332323 3300005329 Unclassified 690
10 Ga0070690_100665350 3300005330 Unclassified 797
11 Ga0070690_100785584 3300005330 Unclassified 737
12 Ga0070670_100055410 3300005331 Unclassified 3403
13 Ga0068869_100494948 3300005334 Bacteria 1020
14 Ga0070680_100633285 3300005336 Bacteria 919
15 Ga0070689_100151182 3300005340 Bacteria 1872
16 Ga0070689_100751883 3300005340 Unclassified 854
17 Ga0070691_10179256 3300005341 Bacteria 1102
18 Ga0070691_10180246 3300005341 Bacteria 1099
19 Ga0070687_100094376 3300005343 Bacteria 1661
20 Ga0070687_100126931 3300005343 Bacteria 1467
21 Ga0070687_101499916 3300005343 Unclassified 507
22 Ga0070661_100495152 3300005344 Unclassified 978
23 Ga0070668_100119191 3300005347 Bacteria 2108
24 Ga0070669_100002320 3300005353 Bacteria 13766
25 Ga0070675_100023030 3300005354 Bacteria 4976
26 Ga0070675_100110239 3300005354 Bacteria 2327
27 Ga0070675_100230237 3300005354 Bacteria 1616
28 Ga0070675_100590415 3300005354 Bacteria 1007
29 Ga0070671_100200169 3300005355 Unclassified 1693
30 Ga0070671_100803329 3300005355 Unclassified 819
31 Ga0070674_100360307 3300005356 Unclassified 1177
32 Ga0070673_100130563 3300005364 Bacteria 2107
33 Ga0070673_100933735 3300005364 Unclassified 806
34 Ga0070688_100057484 3300005365 Unclassified 2445
35 Ga0070688_100331022 3300005365 Bacteria 1109
36 Ga0070659_101945168 3300005366 Unclassified 528
37 Ga0070701_10002939 3300005438 Bacteria 6653
38 Ga0070701_10015921 3300005438 Bacteria 3484
39 Ga0070701_10401440 3300005438 Bacteria 869
40 Ga0070705_100016820 3300005440 Bacteria 3807
41 Ga0070705_100084098 3300005440 Bacteria 1963
42 Ga0070705_100261430 3300005440 Unclassified 1221
43 Ga0070700_100164350 3300005441 Unclassified 1531
44 Ga0070700_100542989 3300005441 Bacteria 902
45 Ga0070694_100001751 3300005444 Bacteria 12819
46 Ga0070694_100001969 3300005444 Bacteria 12177
47 Ga0070694_100009058 3300005444 Bacteria 6101
48 Ga0070694_100092460 3300005444 Bacteria 2125
49 Ga0070694_101888948 3300005444 Unclassified 510
50 Ga0070663_100786185 3300005455 Unclassified 815
51 Ga0070678_102392792 3300005456 Unclassified 502
52 Ga0070662_100018635 3300005457 Bacteria 4699
53 Ga0068867_100042600 3300005459 Unclassified 3322
54 Ga0068867_100580952 3300005459 Unclassified 974
55 Ga0068867_101601457 3300005459 Unclassified 609
56 Ga0070685_10153120 3300005466 Unclassified 1463
57 Ga0070706_100512678 3300005467 Unclassified 1115
58 Ga0070706_100733263 3300005467 Unclassified 916
59 Ga0070706_101042499 3300005467 Unclassified 754
60 Ga0070707_100018324 3300005468 Bacteria 6588
61 Ga0070707_101236909 3300005468 Bacteria 713
62 Ga0070707_101250687 3300005468 Unclassified 709
63 Ga0070707_101823286 3300005468 Unclassified 576
64 Ga0070698_100004770 3300005471 Bacteria 14880
65 Ga0070698_100016307 3300005471 Bacteria 7843
66 Ga0070698_100070914 3300005471 Bacteria 3496
67 Ga0070699_100000148 3300005518 Bacteria 66426
68 Ga0070699_100005763 3300005518 Bacteria 10840
69 Ga0070699_100021890 3300005518 Bacteria 5509
70 Ga0070699_100622668 3300005518 Bacteria 985
71 Ga0070679_100766249 3300005530 Bacteria 908
72 Ga0070697_100112517 3300005536 Bacteria 2270
73 Ga0070697_100982732 3300005536 Unclassified 750
74 Ga0070672_100157966 3300005543 Bacteria 1879
75 Ga0070672_100775236 3300005543 Unclassified 843
76 Ga0070672_101291484 3300005543 Unclassified 651
77 Ga0070686_101375550 3300005544 Unclassified 592
78 Ga0070695_100007561 3300005545 Bacteria 6437
79 Ga0070695_100045623 3300005545 Unclassified 2794
80 Ga0070695_100074126 3300005545 Bacteria 2236
81 Ga0070695_100134567 3300005545 Bacteria 1707
82 Ga0070695_100227162 3300005545 Bacteria 1348
83 Ga0070695_100294962 3300005545 Bacteria 1196
84 Ga0070695_100695989 3300005545 Unclassified 806
85 Ga0070696_100000912 3300005546 Bacteria 19224
86 Ga0070696_100323840 3300005546 Unclassified 1187
87 Ga0070696_101007109 3300005546 Unclassified 696
88 Ga0070696_101205228 3300005546 Bacteria 640
89 Ga0070693_100359468 3300005547 Bacteria 999
90 Ga0070665_100006313 3300005548 Bacteria 12099
91 Ga0070704_100010290 3300005549 Bacteria 5688
92 Ga0070704_100910029 3300005549 Unclassified 792
93 Ga0070704_100990328 3300005549 Unclassified 760
94 Ga0070664_100118946 3300005564 Bacteria 2312
95 Ga0070664_100205249 3300005564 Unclassified 1760
96 Ga0070664_101795882 3300005564 Bacteria 581
97 Ga0068857_100063530 3300005577 Bacteria 3282
98 Ga0068857_100073624 3300005577 Bacteria 3044
99 Ga0068857_100108997 3300005577 Bacteria 2488
100 Ga0068854_100842868 3300005578 Unclassified 802
101 Ga0070702_100382166 3300005615 Unclassified 1002
102 Ga0070702_100472652 3300005615 Bacteria 914
103 Ga0070702_101204324 3300005615 Bacteria 610
104 Ga0070702_101289922 3300005615 Unclassified 592
105 Ga0070702_101550184 3300005615 Unclassified 547
106 Ga0068852_101820985 3300005616 Bacteria 631
107 Ga0068859_100056052 3300005617 Unclassified 3966
108 Ga0068859_100191166 3300005617 Bacteria 2131
109 Ga0068859_100239966 3300005617 Unclassified 1901
110 Ga0068859_100861099 3300005617 Unclassified 992
111 Ga0068861_100002036 3300005719 Bacteria 13092
112 Ga0068861_100592044 3300005719 Unclassified 1017
113 Ga0068861_100747367 3300005719 Bacteria 913
114 Ga0068861_100887594 3300005719 Unclassified 843
115 Ga0068870_10002016 3300005840 Bacteria 8393
116 Ga0068870_10265371 3300005840 Bacteria 1070
117 Ga0068863_100086143 3300005841 Unclassified 2976
118 Ga0068863_100936198 3300005841 Bacteria 868
119 Ga0068858_100002852 3300005842 Bacteria 17379
120 Ga0068858_100209923 3300005842 Unclassified 1842
121 Ga0068858_100289508 3300005842 Unclassified 1561
122 Ga0068860_100311471 3300005843 Unclassified 1544
123 Ga0068860_101314383 3300005843 Unclassified 744
124 Ga0068862_100002651 3300005844 Bacteria 15744
125 Ga0068862_101180556 3300005844 Bacteria 763
126 Ga0068862_102438750 3300005844 Bacteria 535
127 Ga0081539_10000175 3300005985 Bacteria 150479
128 Ga0081539_10002917 3300005985 Bacteria 22574
129 Ga0070717_11975738 3300006028 Unclassified 526
130 Ga0075432_10010445 3300006058 Bacteria 3152
131 Ga0070716_100175314 3300006173 Unclassified 1403
132 Ga0097621_100245152 3300006237 Bacteria 1567
133 Ga0097621_101210173 3300006237 Unclassified 712
134 Ga0097621_101669710 3300006237 Unclassified 606
135 Ga0068871_100049463 3300006358 Bacteria 3398
136 Ga0068871_100065561 3300006358 Bacteria 2974
137 Ga0075428_100152304 3300006844 Bacteria 2512
138 Ga0075428_100223867 3300006844 Bacteria 2031
139 Ga0075428_100493563 3300006844 Unclassified 1310
140 Ga0075430_100163393 3300006846 Bacteria 1853
141 Ga0075433_10000250 3300006852 Bacteria 31089
142 Ga0075433_10106466 3300006852 Bacteria 2486
143 Ga0075433_10249214 3300006852 Unclassified 1576
144 Ga0075433_10422594 3300006852 Bacteria 1175
145 Ga0075433_11644492 3300006852 Unclassified 553
146 Ga0075434_100000994 3300006871 Bacteria 22977
147 Ga0075434_100036617 3300006871 Bacteria 4854
148 Ga0075434_100230196 3300006871 Bacteria 1873
149 Ga0075434_100293016 3300006871 Unclassified 1647
150 Ga0075434_100407062 3300006871 Bacteria 1381
151 Ga0075434_101042445 3300006871 Bacteria 832
152 Ga0075434_101302136 3300006871 Unclassified 737
153 Ga0075429_100026245 3300006880 Bacteria 5056
154 Ga0075429_100631165 3300006880 Bacteria 939
155 Ga0068865_100373799 3300006881 Bacteria 1161
156 Ga0068865_100402313 3300006881 Unclassified 1122
157 Ga0075436_100868526 3300006914 Unclassified 674
158 Ga0075436_101225079 3300006914 Unclassified 567
159 Ga0075436_101270001 3300006914 Unclassified 557
160 Ga0097620_100056053 3300006931 Unclassified 3966
161 Ga0097620_100191179 3300006931 Bacteria 2131
162 Ga0097620_100239974 3300006931 Unclassified 1901
163 Ga0097620_100861060 3300006931 Unclassified 992
164 Ga0075435_100003523 3300007076 Bacteria 10623
165 Ga0075435_100074405 3300007076 Unclassified 2779
166 Ga0075435_100094503 3300007076 Bacteria 2471
167 Ga0075435_100174600 3300007076 Unclassified 1814
168 Ga0075435_101563469 3300007076 Unclassified 579
169 Ga0105240_10057138 3300009093 Unclassified 4878
170 Ga0111539_10003655 3300009094 Bacteria 20264
171 Ga0111539_10004603 3300009094 Bacteria 18020
172 Ga0111539_10530869 3300009094 Unclassified 1371
173 Ga0111539_11112946 3300009094 Unclassified 918
174 Ga0105245_10163812 3300009098 Bacteria 2112
175 Ga0105247_10208593 3300009101 Unclassified 1317
176 Ga0114129_10005499 3300009147 Bacteria 17911
177 Ga0114129_10020765 3300009147 Bacteria 9333
178 Ga0114129_10021565 3300009147 Bacteria 9144
179 Ga0114129_10091901 3300009147 Bacteria 4204
180 Ga0114129_10125781 3300009147 Bacteria 3524
181 Ga0114129_10305527 3300009147 Unclassified 2119
182 Ga0114129_10443256 3300009147 Bacteria 1704
183 Ga0114129_11366043 3300009147 Unclassified 875
184 Ga0105243_10047095 3300009148 Bacteria 3393
185 Ga0105243_10138691 3300009148 Unclassified 2072
186 Ga0105243_13029124 3300009148 Unclassified 509
187 Ga0105242_10105463 3300009176 Bacteria 2394
188 Ga0105242_11215273 3300009176 Bacteria 774
189 Ga0105248_10366972 3300009177 Bacteria 1621
190 Ga0105248_11428512 3300009177 Unclassified 783
191 Ga0105249_10002720 3300009553 Bacteria 15285
192 Ga0105249_10184891 3300009553 Bacteria 2030
193 Ga0105249_10320676 3300009553 Unclassified 1561
194 Ga0105246_10296262 3300011119 Unclassified 1304
195 Ga0105246_10503078 3300011119 Bacteria 1029
196 Ga0105246_10662138 3300011119 Unclassified 910
197 Ga0157315_1017523 3300012508 Bacteria 721
198 Ga0157374_10225542 3300013296 Bacteria 1840
199 Ga0157378_11263642 3300013297 Unclassified 779
200 Ga0157378_11268838 3300013297 Unclassified 777
201 Ga0163162_11064494 3300013306 Bacteria 916
202 Ga0157375_10039449 3300013308 Bacteria 4546
203 Ga0157375_10887672 3300013308 Bacteria 1036
204 Ga0163163_11601278 3300014325 Bacteria 712
205 Ga0157380_10044308 3300014326 Bacteria 3486
206 Ga0157380_10155396 3300014326 Bacteria 1982
207 Ga0157380_11072423 3300014326 Unclassified 843
208 Ga0157377_10324505 3300014745 Unclassified 1024
209 Ga0157379_10012294 3300014968 Bacteria 7477
210 Ga0157376_10132315 3300014969 Bacteria 2228
211 Ga0157376_10651593 3300014969 Bacteria 1054
212 Ga0207666_1030728 3300025271 Unclassified 822
213 Ga0207653_10047160 3300025885 Bacteria 1426
214 Ga0207682_10075995 3300025893 Bacteria 1431
215 Ga0207710_10112550 3300025900 Unclassified 1293
216 Ga0207680_10104501 3300025903 Bacteria 1826
217 Ga0207645_10149364 3300025907 Bacteria 1525
218 Ga0207643_10002530 3300025908 Bacteria 9892
219 Ga0207684_10892741 3300025910 Unclassified 747
220 Ga0207695_10093853 3300025913 Unclassified 3009
221 Ga0207660_10423016 3300025917 Bacteria 1075
222 Ga0207662_10102080 3300025918 Bacteria 1778
223 Ga0207662_10484706 3300025918 Bacteria 850
224 Ga0207662_10503506 3300025918 Unclassified 834
225 Ga0207649_11309712 3300025920 Unclassified 573
226 Ga0207646_10011300 3300025922 Bacteria 8669
227 Ga0207646_10948013 3300025922 Unclassified 762
228 Ga0207646_11130069 3300025922 Unclassified 689
229 Ga0207646_11436685 3300025922 Unclassified 599
230 Ga0207681_10009535 3300025923 Bacteria 5932
231 Ga0207650_10040801 3300025925 Unclassified 3398
232 Ga0207659_10008010 3300025926 Bacteria 6535
233 Ga0207659_10326107 3300025926 Bacteria 1268
234 Ga0207659_10357550 3300025926 Unclassified 1213
235 Ga0207659_10978094 3300025926 Unclassified 728
236 Ga0207687_10548224 3300025927 Unclassified 970
237 Ga0207700_10416385 3300025928 Bacteria 1180
238 Ga0207644_10071441 3300025931 Bacteria 2539
239 Ga0207690_10533193 3300025932 Bacteria 953
240 Ga0207706_10068701 3300025933 Unclassified 3117
241 Ga0207709_10021900 3300025935 Bacteria 3621
242 Ga0207709_10153301 3300025935 Unclassified 1598
243 Ga0207670_10005252 3300025936 Bacteria 7091
244 Ga0207670_10573291 3300025936 Unclassified 924
245 Ga0207669_11225941 3300025937 Bacteria 636
246 Ga0207691_10171849 3300025940 Bacteria 1898
247 Ga0207691_10196375 3300025940 Bacteria 1758
248 Ga0207711_10797690 3300025941 Unclassified 879
249 Ga0207689_10062783 3300025942 Unclassified 3055
250 Ga0207689_10188828 3300025942 Bacteria 1700
251 Ga0207689_10441294 3300025942 Unclassified 1087
252 Ga0207689_10473787 3300025942 Bacteria 1048
253 Ga0207679_10096756 3300025945 Bacteria 2298
254 Ga0207651_10127454 3300025960 Bacteria 1942
255 Ga0207651_10145509 3300025960 Bacteria 1837
256 Ga0207651_10173979 3300025960 Bacteria 1701
257 Ga0207651_11510838 3300025960 Unclassified 605
258 Ga0207712_10004553 3300025961 Bacteria 8747
259 Ga0207668_10030570 3300025972 Bacteria 3540
260 Ga0207640_10801873 3300025981 Unclassified 816
261 Ga0207658_12037636 3300025986 Bacteria 522
262 Ga0207677_10175991 3300026023 Bacteria 1678
263 Ga0207703_10016344 3300026035 Bacteria 5785
264 Ga0207703_10053602 3300026035 Bacteria 3278
265 Ga0207703_10914199 3300026035 Unclassified 840
266 Ga0207639_11668475 3300026041 Bacteria 597
267 Ga0207678_10865095 3300026067 Unclassified 799
268 Ga0207708_10057953 3300026075 Unclassified 2955
269 Ga0207641_10033865 3300026088 Unclassified 4246
270 Ga0207641_11192382 3300026088 Bacteria 761
271 Ga0207648_10001634 3300026089 Bacteria 24557
272 Ga0207676_10345248 3300026095 Bacteria 1375
273 Ga0207676_10732697 3300026095 Bacteria 960
274 Ga0207676_10855762 3300026095 Bacteria 890
275 Ga0207674_10005085 3300026116 Bacteria 15701
276 Ga0207674_10089311 3300026116 Bacteria 3074
277 Ga0207674_10121101 3300026116 Unclassified 2584
278 Ga0207675_100003468 3300026118 Bacteria 15411
279 Ga0207675_100008997 3300026118 Bacteria 9370
280 Ga0207675_100135071 3300026118 Bacteria 2340
281 Ga0207675_100720139 3300026118 Bacteria 1008
282 Ga0207675_100812975 3300026118 Unclassified 948
283 Ga0207428_10000231 3300027907 Bacteria 77049
284 Ga0268265_10000545 3300028380 Bacteria 38390
285 Ga0268265_10206670 3300028380 Bacteria 1708
286 Ga0268265_10521652 3300028380 Unclassified 1123
287 Ga0268264_10130194 3300028381 Unclassified 2229
288 Ga0268264_10495052 3300028381 Unclassified 1191
289 Ga0268264_10552660 3300028381 Bacteria 1129
290 Ga0307408_100484988 3300031548 Unclassified 1079
291 Ga0316576_10567546 3300031727 Bacteria 830
292 Ga0307410_10491743 3300031852 Bacteria 1008
293 Ga0307412_10438131 3300031911 Unclassified 1073
294 Ga0307416_103042998 3300032002 Unclassified 561
295 Ga0373948_0100715 3300034817 Unclassified 680
296 Ga0373958_0073047 3300034819 Unclassified 764
297 Ga0373949_0026460 3300035090 Unclassified 1359
298 Ga0373932_0144128 3300035112 Unclassified 812
299 Ga0373939_0053368 3300035114 Bacteria 1262
300 Ga0373962_0055791 3300035242 Bacteria 1149
301 Ga0316574_0078967 3300035398 Bacteria 2087
302 Ga0373947_0459639 3300035725 Bacteria 863
303 Ga0373925_1588649 3300037068 Unclassified 535
304 Ga0450916_057110 3300042530 Bacteria 627
305 Ga0450916_081873 3300042530 Unclassified 552
306 Ga0451576_0014207 3300045051 Bacteria 8874
307 Ga0451576_0077659 3300045051 Bacteria 3456
308 Ga0451576_0139640 3300045051 Bacteria 2527
309 Ga0451576_0210917 3300045051 Bacteria 2028
310 Ga0451576_0993286 3300045051 Unclassified 880
311 Ga0495603_0130468 3300046455 Bacteria 1464
312 Ga0495629_0524098 3300046459 Unclassified 797
313 Ga0495580_0147590 3300046472 Bacteria 1630
314 Ga0495580_0399913 3300046472 Bacteria 926
315 Ga0495584_0058948 3300046491 Unclassified 1931
316 Ga0495585_0391892 3300046492 Unclassified 670
317 Ga0495594_0016834 3300046499 Bacteria 3856
318 Ga0495643_0355444 3300046522 Unclassified 655
319 Ga0495598_0021705 3300046537 Bacteria 1711
320 Ga0495598_0430204 3300046537 Unclassified 520
321 Ga0495621_0005881 3300046539 Bacteria 3552
322 Ga0495621_0050312 3300046539 Unclassified 1489
323 Ga0495668_0232006 3300046616 Bacteria 1011
324 Ga0495659_0006398 3300046664 Bacteria 3717
325 Ga0495659_0059675 3300046664 Bacteria 1406
326 Ga0495659_0064078 3300046664 Bacteria 1364
327 Ga0495659_0120546 3300046664 Bacteria 1032
328 Ga0495659_0199380 3300046664 Unclassified 820
329 Ga0495659_0209645 3300046664 Bacteria 802
330 Ga0495659_0230634 3300046664 Unclassified 767
331 Ga0495659_0241601 3300046664 Unclassified 750
332 Ga0495659_0375363 3300046664 Unclassified 611
333 Ga0495588_0032683 3300046674 Unclassified 2623
334 Ga0495670_0342639 3300046691 Bacteria 804
335 Ga0495670_0408477 3300046691 Unclassified 734
336 Ga0495671_0078357 3300046692 Bacteria 1620
337 Ga0495636_0029544 3300047318 Bacteria 2237
338 Ga0495636_0364996 3300047318 Unclassified 683
339 Ga0495676_1026926 3300047321 Unclassified 525
340 Ga0496110_1127004 3300048913 Bacteria 693
341 Ga0501031_0812397 3300049568 Unclassified 599
342 Ga0501032_0911268 3300049569 Unclassified 553
343 Ga0501039_0022791 3300049575 Bacteria 4803
344 Ga0501041_0518330 3300049577 Bacteria 759
345 Ga0501042_0036538 3300049578 Bacteria 3485
346 Ga0501046_0516247 3300049580 Unclassified 854
347 Ga0501048_0104581 3300049582 Bacteria 1998
348 Ga0501067_0140068 3300049583 Bacteria 1347
349 Ga0501068_0368770 3300049584 Unclassified 924
350 Ga0501071_0095890 3300049587 Bacteria 2183
351 Ga0501072_0044680 3300049588 Bacteria 3483
352 Ga0501074_0881487 3300049590 Unclassified 630
353 Ga0501076_0192098 3300049592 Bacteria 1666
354 Ga0501077_0774924 3300049593 Unclassified 617
355 Ga0501249_028380 3300049679 Unclassified 1241
356 Ga0501229_054313 3300049706 Unclassified 598
357 Ga0501080_0896720 3300049742 Unclassified 773
358 Ga0501080_1214490 3300049742 Bacteria 648
359 Ga0501081_0105140 3300049743 Bacteria 2000
360 Ga0501035_0092645 3300049822 Bacteria 2659
361 Ga0501035_0413963 3300049822 Bacteria 1120
362 Ga0501045_0009100 3300049824 Bacteria 6937
363 nmdc:mga05p37_1124697_c1 3300050507 Unclassified 820
364 nmdc:mga05p37_175712_c1 3300050507 Bacteria 2609
365 nmdc:mga05p37_368026_c1 3300050507 Bacteria 1688
366 nmdc:mga05p37_37661_c1 3300050507 Bacteria 5931
367 nmdc:mga05p37_44446_c1 3300050507 Bacteria 5465
368 nmdc:mga05p37_955_c1 3300050507 Bacteria 32691
369 nmdc:mga09592_122654_c1 3300050508 Unclassified 2233
370 nmdc:mga09592_78978_c1 3300050508 Bacteria 2801
371 nmdc:mga0qj67_66589_c1 3300050509 Bacteria 2869
372 nmdc:mga06r32_1119886_c1 3300050510 Unclassified 736
373 nmdc:mga06r32_1323227_c1 3300050510 Bacteria 664
374 nmdc:mga08y16_149592_c1 3300050511 Unclassified 2427
375 nmdc:mga08y16_49577_c1 3300050511 Unclassified 4395
376 nmdc:mga08y16_499277_c1 3300050511 Unclassified 1236
377 nmdc:mga08y16_7227_c1 3300050511 Bacteria 11653
378 nmdc:mga0n895_1122987_c1 3300050512 Unclassified 763
379 nmdc:mga0n895_137220_c1 3300050512 Unclassified 2473
380 nmdc:mga0n895_164923_c1 3300050512 Unclassified 2247
381 nmdc:mga0n895_18089_c1 3300050512 Bacteria 6515
382 nmdc:mga0n895_30123_c1 3300050512 Bacteria 5183
383 nmdc:mga0n895_94801_c1 3300050512 Bacteria 2989
384 nmdc:mga0rr50_151686_c1 3300050513 Unclassified 1873
385 nmdc:mga0rr50_162205_c1 3300050513 Bacteria 1815
386 nmdc:mga0rr50_1967_c1 3300050513 Bacteria 11407
387 nmdc:mga0rr50_8392_c1 3300050513 Bacteria 6428
388 nmdc:mga08x19_1088782_c1 3300050514 Unclassified 567
389 nmdc:mga08x19_1120350_c1 3300050514 Bacteria 558
390 nmdc:mga0a205_131811_c1 3300050515 Bacteria 2400
391 nmdc:mga0a205_15107_c1 3300050515 Bacteria 7212
392 nmdc:mga0a205_26160_c1 3300050515 Bacteria 5560
393 nmdc:mga0a205_518740_c1 3300050515 Bacteria 1048
394 nmdc:mga0a205_83027_c1 3300050515 Bacteria 3095
395 Ga0501084_0017086 3300054114 Bacteria 6027
396 Ga0501082_0253189 3300060353 Bacteria 1532
397 Ga0530510_0001643 3300061734 Bacteria 15123
398 nmdc:mga08y16_1071737_c1
399 JGI25406J46586_10089776
400 Ga0065704_10681372
401 Ga0065712_10327474
402 Ga0065712_10411962
403 Ga0065715_10219620
404 Ga0065715_10538663
405 Ga0065707_10484805
406 Ga0070683_101332323
407 Ga0070690_100665350
408 Ga0070690_100785584
409 Ga0070670_100055410
410 Ga0068869_100494948
411 Ga0070680_100633285
412 Ga0070689_100151182
413 Ga0070689_100751883
414 Ga0070691_10179256
415 Ga0070691_10180246
416 Ga0070687_100094376
417 Ga0070687_100126931
418 Ga0070687_101499916
419 Ga0070661_100495152
420 Ga0070668_100119191
421 Ga0070669_100002320
422 Ga0070675_100023030
423 Ga0070675_100110239
424 Ga0070675_100230237
425 Ga0070675_100590415
426 Ga0070671_100200169
427 Ga0070671_100803329
428 Ga0070674_100360307
429 Ga0070673_100130563
430 Ga0070673_100933735
431 Ga0070688_100057484
432 Ga0070688_100331022
433 Ga0070659_101945168
434 Ga0070701_10002939
435 Ga0070701_10015921
436 Ga0070701_10401440
437 Ga0070705_100016820
438 Ga0070705_100084098
439 Ga0070705_100261430
440 Ga0070700_100164350
441 Ga0070700_100542989
442 Ga0070694_100001751
443 Ga0070694_100001969
444 Ga0070694_100009058
445 Ga0070694_100092460
446 Ga0070694_101888948
447 Ga0070663_100786185
448 Ga0070678_102392792
449 Ga0070662_100018635
450 Ga0068867_100042600
451 Ga0068867_100580952
452 Ga0068867_101601457
453 Ga0070685_10153120
454 Ga0070706_100512678
455 Ga0070706_100733263
456 Ga0070706_101042499
457 Ga0070707_100018324
458 Ga0070707_101236909
459 Ga0070707_101250687
460 Ga0070707_101823286
461 Ga0070698_100004770
462 Ga0070698_100016307
463 Ga0070698_100070914
464 Ga0070699_100000148
465 Ga0070699_100005763
466 Ga0070699_100021890
467 Ga0070699_100622668
468 Ga0070679_100766249
469 Ga0070697_100112517
470 Ga0070697_100982732
471 Ga0070672_100157966
472 Ga0070672_100775236
473 Ga0070672_101291484
474 Ga0070686_101375550
475 Ga0070695_100007561
476 Ga0070695_100045623
477 Ga0070695_100074126
478 Ga0070695_100134567
479 Ga0070695_100227162
480 Ga0070695_100294962
481 Ga0070695_100695989
482 Ga0070696_100000912
483 Ga0070696_100323840
484 Ga0070696_101007109
485 Ga0070696_101205228
486 Ga0070693_100359468
487 Ga0070665_100006313
488 Ga0070704_100010290
489 Ga0070704_100910029
490 Ga0070704_100990328
491 Ga0070664_100118946
492 Ga0070664_100205249
493 Ga0070664_101795882
494 Ga0068857_100063530
495 Ga0068857_100073624
496 Ga0068857_100108997
497 Ga0068854_100842868
498 Ga0070702_100382166
499 Ga0070702_100472652
500 Ga0070702_101204324
501 Ga0070702_101289922
502 Ga0070702_101550184
503 Ga0068852_101820985
504 Ga0068859_100056052
505 Ga0068859_100191166
506 Ga0068859_100239966
507 Ga0068859_100861099
508 Ga0068861_100002036
509 Ga0068861_100592044
510 Ga0068861_100747367
511 Ga0068861_100887594
512 Ga0068870_10002016
513 Ga0068870_10265371
514 Ga0068863_100086143
515 Ga0068863_100936198
516 Ga0068858_100002852
517 Ga0068858_100209923
518 Ga0068858_100289508
519 Ga0068860_100311471
520 Ga0068860_101314383
521 Ga0068862_100002651
522 Ga0068862_101180556
523 Ga0068862_102438750
524 Ga0081539_10000175
525 Ga0081539_10002917
526 Ga0070717_11975738
527 Ga0075432_10010445
528 Ga0070716_100175314
529 Ga0097621_100245152
530 Ga0097621_101210173
531 Ga0097621_101669710
532 Ga0068871_100049463
533 Ga0068871_100065561
534 Ga0075428_100152304
535 Ga0075428_100223867
536 Ga0075428_100493563
537 Ga0075430_100163393
538 Ga0075433_10000250
539 Ga0075433_10106466
540 Ga0075433_10249214
541 Ga0075433_10422594
542 Ga0075433_11644492
543 Ga0075434_100000994
544 Ga0075434_100036617
545 Ga0075434_100230196
546 Ga0075434_100293016
547 Ga0075434_100407062
548 Ga0075434_101042445
549 Ga0075434_101302136
550 Ga0075429_100026245
551 Ga0075429_100631165
552 Ga0068865_100373799
553 Ga0068865_100402313
554 Ga0075436_100868526
555 Ga0075436_101225079
556 Ga0075436_101270001
557 Ga0097620_100056053
558 Ga0097620_100191179
559 Ga0097620_100239974
560 Ga0097620_100861060
561 Ga0075435_100003523
562 Ga0075435_100074405
563 Ga0075435_100094503
564 Ga0075435_100174600
565 Ga0075435_101563469
566 Ga0105240_10057138
567 Ga0111539_10003655
568 Ga0111539_10004603
569 Ga0111539_10530869
570 Ga0111539_11112946
571 Ga0105245_10163812
572 Ga0105247_10208593
573 Ga0114129_10005499
574 Ga0114129_10020765
575 Ga0114129_10021565
576 Ga0114129_10091901
577 Ga0114129_10125781
578 Ga0114129_10305527
579 Ga0114129_10443256
580 Ga0114129_11366043
581 Ga0105243_10047095
582 Ga0105243_10138691
583 Ga0105243_13029124
584 Ga0105242_10105463
585 Ga0105242_11215273
586 Ga0105248_10366972
587 Ga0105248_11428512
588 Ga0105249_10002720
589 Ga0105249_10184891
590 Ga0105249_10320676
591 Ga0105246_10296262
592 Ga0105246_10503078
593 Ga0105246_10662138
594 Ga0157315_1017523
595 Ga0157374_10225542
596 Ga0157378_11263642
597 Ga0157378_11268838
598 Ga0163162_11064494
599 Ga0157375_10039449
600 Ga0157375_10887672
601 Ga0163163_11601278
602 Ga0157380_10044308
603 Ga0157380_10155396
604 Ga0157380_11072423
605 Ga0157377_10324505
606 Ga0157379_10012294
607 Ga0157376_10132315
608 Ga0157376_10651593
609 Ga0207666_1030728
610 Ga0207653_10047160
611 Ga0207682_10075995
612 Ga0207710_10112550
613 Ga0207680_10104501
614 Ga0207645_10149364
615 Ga0207643_10002530
616 Ga0207684_10892741
617 Ga0207695_10093853
618 Ga0207660_10423016
619 Ga0207662_10102080
620 Ga0207662_10484706
621 Ga0207662_10503506
622 Ga0207649_11309712
623 Ga0207646_10011300
624 Ga0207646_10948013
625 Ga0207646_11130069
626 Ga0207646_11436685
627 Ga0207681_10009535
628 Ga0207650_10040801
629 Ga0207659_10008010
630 Ga0207659_10326107
631 Ga0207659_10357550
632 Ga0207659_10978094
633 Ga0207687_10548224
634 Ga0207700_10416385
635 Ga0207644_10071441
636 Ga0207690_10533193
637 Ga0207706_10068701
638 Ga0207709_10021900
639 Ga0207709_10153301
640 Ga0207670_10005252
641 Ga0207670_10573291
642 Ga0207669_11225941
643 Ga0207691_10171849
644 Ga0207691_10196375
645 Ga0207711_10797690
646 Ga0207689_10062783
647 Ga0207689_10188828
648 Ga0207689_10441294
649 Ga0207689_10473787
650 Ga0207679_10096756
651 Ga0207651_10127454
652 Ga0207651_10145509
653 Ga0207651_10173979
654 Ga0207651_11510838
655 Ga0207712_10004553
656 Ga0207668_10030570
657 Ga0207640_10801873
658 Ga0207658_12037636
659 Ga0207677_10175991
660 Ga0207703_10016344
661 Ga0207703_10053602
662 Ga0207703_10914199
663 Ga0207639_11668475
664 Ga0207678_10865095
665 Ga0207708_10057953
666 Ga0207641_10033865
667 Ga0207641_11192382
668 Ga0207648_10001634
669 Ga0207676_10345248
670 Ga0207676_10732697
671 Ga0207676_10855762
672 Ga0207674_10005085
673 Ga0207674_10089311
674 Ga0207674_10121101
675 Ga0207675_100003468
676 Ga0207675_100008997
677 Ga0207675_100135071
678 Ga0207675_100720139
679 Ga0207675_100812975
680 Ga0207428_10000231
681 Ga0268265_10000545
682 Ga0268265_10206670
683 Ga0268265_10521652
684 Ga0268264_10130194
685 Ga0268264_10495052
686 Ga0268264_10552660
687 Ga0307408_100484988
688 Ga0316576_10567546
689 Ga0307410_10491743
690 Ga0307412_10438131
691 Ga0307416_103042998
692 Ga0373948_0100715
693 Ga0373958_0073047
694 Ga0373949_0026460
695 Ga0373932_0144128
696 Ga0373939_0053368
697 Ga0373962_0055791
698 Ga0316574_0078967
699 Ga0373947_0459639
700 Ga0373925_1588649
701 Ga0450916_057110
702 Ga0450916_081873
703 Ga0451576_0014207
704 Ga0451576_0077659
705 Ga0451576_0139640
706 Ga0451576_0210917
707 Ga0451576_0993286
708 Ga0495603_0130468
709 Ga0495629_0524098
710 Ga0495580_0147590
711 Ga0495580_0399913
712 Ga0495584_0058948
713 Ga0495585_0391892
714 Ga0495594_0016834
715 Ga0495643_0355444
716 Ga0495598_0021705
717 Ga0495598_0430204
718 Ga0495621_0005881
719 Ga0495621_0050312
720 Ga0495668_0232006
721 Ga0495659_0006398
722 Ga0495659_0059675
723 Ga0495659_0064078
724 Ga0495659_0120546
725 Ga0495659_0199380
726 Ga0495659_0209645
727 Ga0495659_0230634
728 Ga0495659_0241601
729 Ga0495659_0375363
730 Ga0495588_0032683
731 Ga0495670_0342639
732 Ga0495670_0408477
733 Ga0495671_0078357
734 Ga0495636_0029544
735 Ga0495636_0364996
736 Ga0495676_1026926
737 Ga0496110_1127004
738 Ga0501031_0812397
739 Ga0501032_0911268
740 Ga0501039_0022791
741 Ga0501041_0518330
742 Ga0501042_0036538
743 Ga0501046_0516247
744 Ga0501048_0104581
745 Ga0501067_0140068
746 Ga0501068_0368770
747 Ga0501071_0095890
748 Ga0501072_0044680
749 Ga0501074_0881487
750 Ga0501076_0192098
751 Ga0501077_0774924
752 Ga0501249_028380
753 Ga0501229_054313
754 Ga0501080_0896720
755 Ga0501080_1214490
756 Ga0501081_0105140
757 Ga0501035_0092645
758 Ga0501035_0413963
759 Ga0501045_0009100
760 nmdc:mga05p37_1124697_c1
761 nmdc:mga05p37_175712_c1
762 nmdc:mga05p37_368026_c1
763 nmdc:mga05p37_37661_c1
764 nmdc:mga05p37_44446_c1
765 nmdc:mga05p37_955_c1
766 nmdc:mga09592_122654_c1
767 nmdc:mga09592_78978_c1
768 nmdc:mga0qj67_66589_c1
769 nmdc:mga06r32_1119886_c1
770 nmdc:mga06r32_1323227_c1
771 nmdc:mga08y16_149592_c1
772 nmdc:mga08y16_49577_c1
773 nmdc:mga08y16_499277_c1
774 nmdc:mga08y16_7227_c1
775 nmdc:mga0n895_1122987_c1
776 nmdc:mga0n895_137220_c1
777 nmdc:mga0n895_164923_c1
778 nmdc:mga0n895_18089_c1
779 nmdc:mga0n895_30123_c1
780 nmdc:mga0n895_94801_c1
781 nmdc:mga0rr50_151686_c1
782 nmdc:mga0rr50_162205_c1
783 nmdc:mga0rr50_1967_c1
784 nmdc:mga0rr50_8392_c1
785 nmdc:mga08x19_1088782_c1
786 nmdc:mga08x19_1120350_c1
787 nmdc:mga0a205_131811_c1
788 nmdc:mga0a205_15107_c1
789 nmdc:mga0a205_26160_c1
790 nmdc:mga0a205_518740_c1
791 nmdc:mga0a205_83027_c1
792 Ga0501084_0017086
793 Ga0501082_0253189
794 Ga0530510_0001643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

7

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xn1-assembly1.cif.gz_A crystal structure of the gh43_1 enzyme from xanthomonas citri complexed with xylose 0.7687 41 71
1sru-assembly1.cif.gz_C crystal structure of full length e. coli ssb protein 0.7635 31 95
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7438 34 68
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7435 34 68
6xn1-assembly2.cif.gz_B crystal structure of the gh43_1 enzyme from xanthomonas citri complexed with xylose 0.7429 41 71
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8708 38 67 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8261 38 71 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.806 32 91 2.40.50.140
af_Q69TF4_44_149_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.806 40 69 3.30.420.40
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7992 32 92 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A381VHI2-F1-model_v4 Uncharacterized protein 0.9699 30 120
AF-A0A4Q6B4C5-F1-model_v4 Uncharacterized protein 0.9656 26 120
AF-A0A2V8GWG2-F1-model_v4 DUF5666 domain-containing protein 0.9642 30 119
AF-A0A2V8MEI0-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9635 24 121
AF-A0A2V8A7A3-F1-model_v4 Uncharacterized protein 0.9622 21 119

Map