F433760

General Info

Members Datasets Scaffolds Average Seq Length
397 199 397 391

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10000001|Ga0157370_10000001144
Length 463
Sequence MRKAGDAEHGVVRFGARLSGENHSIIKDDGAQTQKLLLNWRIWDRAPASIVKIREQGLWGMVQSLAKFSKRTDWNTEESALARAHRERVQTELPLADLTASNPTRCGFVYDGRLLAPLTDSRALEYDPQPLGLQRTREAVCGYYADHGVEVWPERVVMTTSTSEAYSFLFKLLCDPGDEIVVPQPGYPLFDFLGVLDDVRIKTAPLVYDHGWQIEPEGFRRALSAQARAIVLVHPNNPTGHFTKKWETEELANLCREQGIALIVDEVFLDYSFGGEKGESFASGLEGVDVFVVSGLSKIAGLPQMKAAWIVATGPHAPEVMSRLEVIADTFLSMNAPVQRAIPVWLEGRGEIQQQILNRVKANLAELDRQLANFDLVRRIEVEGGWYAVLRIPAVRPDEKTVLELLERGVWVHPGYFFGMAESGWLVVSLLGSVEEFKTGVQLIVDYFRTHQGTNNCLVGVKP

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.26
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003366 3300003320 Bacteria 16665
2 rootL2_10222745 3300003322 Bacteria 3014
3 Ga0065715_10002164 3300005293 Bacteria 7382
4 Ga0070658_10018718 3300005327 Bacteria 5548
5 Ga0070658_10027544 3300005327 Bacteria 4559
6 Ga0070658_10043821 3300005327 Unclassified 3615
7 Ga0070676_10017099 3300005328 Bacteria 4011
8 Ga0070683_100021465 3300005329 Bacteria 5765
9 Ga0070683_100140006 3300005329 Bacteria 2292
10 Ga0070690_100013903 3300005330 Bacteria 4773
11 Ga0070670_100005335 3300005331 Bacteria 10837
12 Ga0070670_100009560 3300005331 Bacteria 8275
13 Ga0070680_100014573 3300005336 Bacteria 6148
14 Ga0070680_100024417 3300005336 Bacteria 4829
15 Ga0070682_100182293 3300005337 Bacteria 1468
16 Ga0068868_100020981 3300005338 Bacteria 4918
17 Ga0070689_100000011 3300005340 Bacteria 218327
18 Ga0070689_100017085 3300005340 Bacteria 5323
19 Ga0070661_100010035 3300005344 Bacteria 6574
20 Ga0070661_100052757 3300005344 Unclassified 2976
21 Ga0070668_100031669 3300005347 Bacteria 4024
22 Ga0070669_100015831 3300005353 Bacteria 5378
23 Ga0070671_100005443 3300005355 Bacteria 10162
24 Ga0070671_100014395 3300005355 Bacteria 6391
25 Ga0070713_100020605 3300005436 Bacteria 5058
26 Ga0070713_100034981 3300005436 Bacteria 4041
27 Ga0070713_100087761 3300005436 Bacteria 2669
28 Ga0070713_100115417 3300005436 Bacteria 2347
29 Ga0070701_10023701 3300005438 Bacteria 2960
30 Ga0070694_100035708 3300005444 Bacteria 3288
31 Ga0070708_100093414 3300005445 Unclassified 2742
32 Ga0070706_100000048 3300005467 Bacteria 142843
33 Ga0070707_100028062 3300005468 Bacteria 5355
34 Ga0070707_100316183 3300005468 Unclassified 1517
35 Ga0070699_100089546 3300005518 Bacteria 2689
36 Ga0070679_100174390 3300005530 Bacteria 2123
37 Ga0070684_100003332 3300005535 Bacteria 12021
38 Ga0070697_100000161 3300005536 Bacteria 54619
39 Ga0070697_100043850 3300005536 Bacteria 3622
40 Ga0068853_100000074 3300005539 Bacteria 69174
41 Ga0068853_100022492 3300005539 Bacteria 5266
42 Ga0070672_100054425 3300005543 Bacteria 3132
43 Ga0070686_100022791 3300005544 Bacteria 3734
44 Ga0070665_100008390 3300005548 Bacteria 10449
45 Ga0070665_100022721 3300005548 Bacteria 6314
46 Ga0070665_100114271 3300005548 Bacteria 2702
47 Ga0070665_100128250 3300005548 Bacteria 2539
48 Ga0068855_100001215 3300005563 Bacteria 31959
49 Ga0068855_100003203 3300005563 Bacteria 20029
50 Ga0068855_100010470 3300005563 Bacteria 11190
51 Ga0068855_100023784 3300005563 Bacteria 7339
52 Ga0068857_100001254 3300005577 Bacteria 19874
53 Ga0068857_100024193 3300005577 Bacteria 5346
54 Ga0068856_100003456 3300005614 Bacteria 15972
55 Ga0068856_100004477 3300005614 Bacteria 13900
56 Ga0068856_100008315 3300005614 Bacteria 10112
57 Ga0068856_100129465 3300005614 Bacteria 2528
58 Ga0068856_100192969 3300005614 Unclassified 2050
59 Ga0068856_100222384 3300005614 Bacteria 1903
60 Ga0068852_100000073 3300005616 Bacteria 69820
61 Ga0068852_100000157 3300005616 Bacteria 45299
62 Ga0068859_100000040 3300005617 Bacteria 162782
63 Ga0068859_100024035 3300005617 Bacteria 6115
64 Ga0068859_100036071 3300005617 Bacteria 4963
65 Ga0068859_100205183 3300005617 Unclassified 2056
66 Ga0068864_100005109 3300005618 Bacteria 10753
67 Ga0068864_100036276 3300005618 Unclassified 4202
68 Ga0068866_10007111 3300005718 Bacteria 4678
69 Ga0068861_100036765 3300005719 Bacteria 3637
70 Ga0068851_10022659 3300005834 Bacteria 3063
71 Ga0068863_100004315 3300005841 Bacteria 14010
72 Ga0068863_100029377 3300005841 Bacteria 5247
73 Ga0068858_100056261 3300005842 Bacteria 3636
74 Ga0068858_100065610 3300005842 Bacteria 3359
75 Ga0068858_100134131 3300005842 Bacteria 2322
76 Ga0068860_100014746 3300005843 Bacteria 7642
77 Ga0068860_100030486 3300005843 Bacteria 5187
78 Ga0068862_100179504 3300005844 Bacteria 1899
79 Ga0081455_10033054 3300005937 Bacteria 4652
80 Ga0070717_10001564 3300006028 Bacteria 15848
81 Ga0097621_100001548 3300006237 Bacteria 15728
82 Ga0097621_100004777 3300006237 Bacteria 9480
83 Ga0068871_100001595 3300006358 Bacteria 15248
84 Ga0068871_100263328 3300006358 Bacteria 1504
85 Ga0075428_100055382 3300006844 Bacteria 4345
86 Ga0075428_100102226 3300006844 Bacteria 3125
87 Ga0075431_100114231 3300006847 Bacteria 2787
88 Ga0075431_100192394 3300006847 Bacteria 2090
89 Ga0075434_100281628 3300006871 Bacteria 1682
90 Ga0068865_100005433 3300006881 Bacteria 7729
91 Ga0075436_100076223 3300006914 Unclassified 2322
92 Ga0097620_100000040 3300006931 Bacteria 162782
93 Ga0097620_100024035 3300006931 Bacteria 6115
94 Ga0097620_100036072 3300006931 Bacteria 4963
95 Ga0097620_100205183 3300006931 Unclassified 2056
96 Ga0105240_10000110 3300009093 Bacteria 171018
97 Ga0105240_10001139 3300009093 Bacteria 46550
98 Ga0105240_10003498 3300009093 Bacteria 24350
99 Ga0105240_10011865 3300009093 Bacteria 12096
100 Ga0105240_10013709 3300009093 Bacteria 11108
101 Ga0105240_10017198 3300009093 Bacteria 9756
102 Ga0105240_10095064 3300009093 Bacteria 3634
103 Ga0105240_10095222 3300009093 Bacteria 3630
104 Ga0105245_10001870 3300009098 Bacteria 19126
105 Ga0105245_10003381 3300009098 Bacteria 14291
106 Ga0105245_10005417 3300009098 Bacteria 11215
107 Ga0105245_10022119 3300009098 Bacteria 5583
108 Ga0105245_10108133 3300009098 Bacteria 2582
109 Ga0105245_10335346 3300009098 Bacteria 1494
110 Ga0105247_10012244 3300009101 Bacteria 5154
111 Ga0105247_10037455 3300009101 Bacteria 2960
112 Ga0105247_10073745 3300009101 Bacteria 2139
113 Ga0114129_10367677 3300009147 Bacteria 1902
114 Ga0105241_10000063 3300009174 Bacteria 80541
115 Ga0105241_10000111 3300009174 Bacteria 58391
116 Ga0105241_10002420 3300009174 Bacteria 14007
117 Ga0105241_10003751 3300009174 Bacteria 11269
118 Ga0105241_10050445 3300009174 Bacteria 3171
119 Ga0105242_10042700 3300009176 Bacteria 3664
120 Ga0105248_10000004 3300009177 Bacteria 695244
121 Ga0105248_10018351 3300009177 Bacteria 7727
122 Ga0105248_10018480 3300009177 Bacteria 7705
123 Ga0105248_10053790 3300009177 Bacteria 4516
124 Ga0105248_10077627 3300009177 Bacteria 3734
125 Ga0105248_10340909 3300009177 Bacteria 1687
126 Ga0105237_10024254 3300009545 Bacteria 6207
127 Ga0105238_10000022 3300009551 Bacteria 204310
128 Ga0105238_10060628 3300009551 Bacteria 3787
129 Ga0105238_10119736 3300009551 Bacteria 2613
130 Ga0105238_10190043 3300009551 Bacteria 2030
131 Ga0105238_10206318 3300009551 Unclassified 1941
132 Ga0105238_10206844 3300009551 Bacteria 1939
133 Ga0105239_10004574 3300010375 Bacteria 16490
134 Ga0105239_10004929 3300010375 Bacteria 15757
135 Ga0105239_10071038 3300010375 Bacteria 3824
136 Ga0105239_10325747 3300010375 Bacteria 1733
137 Ga0105239_10333265 3300010375 Bacteria 1712
138 Ga0105246_10007035 3300011119 Bacteria 6885
139 Ga0157373_10194792 3300013100 Bacteria 1428
140 Ga0157370_10000001 3300013104 Bacteria 529517
141 Ga0157370_10054728 3300013104 Bacteria 3803
142 Ga0157370_10087131 3300013104 Bacteria 2933
143 Ga0157369_10000017 3300013105 Bacteria 246520
144 Ga0157369_10001016 3300013105 Bacteria 35331
145 Ga0157369_10001500 3300013105 Bacteria 28635
146 Ga0157369_10002310 3300013105 Bacteria 22945
147 Ga0157369_10003062 3300013105 Bacteria 19966
148 Ga0157369_10006657 3300013105 Bacteria 13354
149 Ga0157369_10054883 3300013105 Unclassified 4302
150 Ga0157369_10086996 3300013105 Bacteria 3337
151 Ga0157369_10140214 3300013105 Bacteria 2558
152 Ga0157369_10344282 3300013105 Bacteria 1549
153 Ga0157374_10015655 3300013296 Bacteria 6658
154 Ga0157374_10224342 3300013296 Unclassified 1845
155 Ga0157374_10358663 3300013296 Bacteria 1449
156 Ga0157378_10000059 3300013297 Bacteria 95905
157 Ga0157378_10011342 3300013297 Bacteria 7799
158 Ga0157378_10095372 3300013297 Unclassified 2709
159 Ga0157378_10103040 3300013297 Bacteria 2607
160 Ga0157378_10231152 3300013297 Bacteria 1762
161 Ga0163162_10021422 3300013306 Bacteria 6366
162 Ga0163162_10097665 3300013306 Unclassified 3026
163 Ga0157372_10000019 3300013307 Bacteria 209591
164 Ga0157372_10001397 3300013307 Bacteria 26011
165 Ga0157372_10018587 3300013307 Bacteria 7477
166 Ga0157372_10025697 3300013307 Bacteria 6405
167 Ga0157372_10041919 3300013307 Bacteria 5061
168 Ga0157372_10059676 3300013307 Bacteria 4267
169 Ga0157372_10174147 3300013307 Bacteria 2490
170 Ga0157372_10199760 3300013307 Bacteria 2316
171 Ga0157372_10251112 3300013307 Unclassified 2053
172 Ga0163163_10001614 3300014325 Bacteria 18969
173 Ga0163163_10004504 3300014325 Bacteria 11893
174 Ga0157380_10006794 3300014326 Bacteria 8083
175 Ga0157380_10042960 3300014326 Unclassified 3536
176 Ga0157379_10015131 3300014968 Bacteria 6767
177 Ga0157379_10037896 3300014968 Bacteria 4300
178 Ga0157379_10210181 3300014968 Bacteria 1761
179 Ga0157376_10015352 3300014969 Bacteria 5784
180 Ga0157376_10171039 3300014969 Bacteria 1979
181 Ga0207656_10003195 3300025321 Bacteria 5603
182 Ga0207656_10045459 3300025321 Unclassified 1879
183 Ga0207642_10005440 3300025899 Bacteria 4158
184 Ga0207710_10001637 3300025900 Bacteria 10933
185 Ga0207710_10005232 3300025900 Bacteria 5607
186 Ga0207710_10018844 3300025900 Bacteria 2938
187 Ga0207680_10034144 3300025903 Bacteria 2908
188 Ga0207680_10121139 3300025903 Bacteria 1711
189 Ga0207647_10006895 3300025904 Bacteria 8234
190 Ga0207645_10019428 3300025907 Bacteria 4454
191 Ga0207705_10036218 3300025909 Bacteria 3531
192 Ga0207705_10053257 3300025909 Bacteria 2915
193 Ga0207705_10053811 3300025909 Unclassified 2901
194 Ga0207684_10000121 3300025910 Bacteria 143066
195 Ga0207654_10000148 3300025911 Bacteria 44438
196 Ga0207654_10000215 3300025911 Bacteria 35610
197 Ga0207654_10046778 3300025911 Unclassified 2469
198 Ga0207695_10000026 3300025913 Bacteria 624558
199 Ga0207695_10000096 3300025913 Bacteria 265048
200 Ga0207695_10000168 3300025913 Bacteria 193087
201 Ga0207695_10000398 3300025913 Bacteria 97114
202 Ga0207695_10013431 3300025913 Bacteria 9768
203 Ga0207695_10013487 3300025913 Bacteria 9744
204 Ga0207695_10063165 3300025913 Bacteria 3818
205 Ga0207671_10000022 3300025914 Bacteria 277803
206 Ga0207671_10005196 3300025914 Bacteria 12100
207 Ga0207657_10067767 3300025919 Bacteria 3034
208 Ga0207649_10007625 3300025920 Bacteria 5884
209 Ga0207649_10034882 3300025920 Unclassified 3018
210 Ga0207652_10221913 3300025921 Unclassified 1703
211 Ga0207646_10091965 3300025922 Bacteria 2715
212 Ga0207694_10000009 3300025924 Bacteria 460687
213 Ga0207694_10009788 3300025924 Bacteria 7235
214 Ga0207687_10008473 3300025927 Bacteria 6722
215 Ga0207687_10173709 3300025927 Unclassified 1664
216 Ga0207700_10014109 3300025928 Bacteria 5225
217 Ga0207700_10290565 3300025928 Unclassified 1409
218 Ga0207644_10089323 3300025931 Bacteria 2293
219 Ga0207686_10184562 3300025934 Unclassified 1482
220 Ga0207709_10025016 3300025935 Unclassified 3415
221 Ga0207670_10033896 3300025936 Bacteria 3294
222 Ga0207670_10052082 3300025936 Bacteria 2752
223 Ga0207691_10026803 3300025940 Bacteria 5408
224 Ga0207711_10000032 3300025941 Bacteria 199046
225 Ga0207711_10055226 3300025941 Bacteria 3410
226 Ga0207711_10126841 3300025941 Unclassified 2284
227 Ga0207689_10001414 3300025942 Bacteria 22916
228 Ga0207661_10001567 3300025944 Bacteria 15569
229 Ga0207661_10011133 3300025944 Bacteria 6504
230 Ga0207679_10109054 3300025945 Bacteria 2181
231 Ga0207667_10001656 3300025949 Bacteria 28065
232 Ga0207667_10003253 3300025949 Bacteria 20044
233 Ga0207667_10003259 3300025949 Bacteria 20031
234 Ga0207667_10012010 3300025949 Bacteria 10023
235 Ga0207640_10102717 3300025981 Unclassified 2008
236 Ga0207658_10027822 3300025986 Bacteria 3976
237 Ga0207677_10002816 3300026023 Bacteria 9175
238 Ga0207677_10049484 3300026023 Unclassified 2836
239 Ga0207677_10086238 3300026023 Unclassified 2269
240 Ga0207703_10063325 3300026035 Bacteria 3032
241 Ga0207639_10000065 3300026041 Bacteria 98610
242 Ga0207639_10100499 3300026041 Bacteria 2336
243 Ga0207639_10337351 3300026041 Bacteria 1343
244 Ga0207678_10033647 3300026067 Bacteria 4464
245 Ga0207678_10187072 3300026067 Unclassified 1769
246 Ga0207708_10001189 3300026075 Bacteria 19603
247 Ga0207702_10001772 3300026078 Bacteria 21238
248 Ga0207702_10008208 3300026078 Bacteria 8826
249 Ga0207702_10045602 3300026078 Unclassified 3687
250 Ga0207641_10015820 3300026088 Bacteria 6178
251 Ga0207641_10038300 3300026088 Bacteria 4008
252 Ga0207648_10004418 3300026089 Bacteria 14442
253 Ga0207676_10027514 3300026095 Unclassified 4236
254 Ga0207674_10002547 3300026116 Bacteria 22963
255 Ga0207675_100004586 3300026118 Bacteria 13319
256 Ga0207675_100017396 3300026118 Bacteria 6710
257 Ga0207675_100411401 3300026118 Bacteria 1334
258 Ga0207698_10000018 3300026142 Bacteria 176540
259 Ga0207698_10000028 3300026142 Bacteria 117250
260 Ga0207698_10013761 3300026142 Bacteria 5352
261 Ga0268266_10002423 3300028379 Bacteria 20083
262 Ga0268266_10002773 3300028379 Bacteria 18294
263 Ga0265318_10025754 3300028577 Bacteria 2319
264 Ga0265323_10019975 3300028653 Bacteria 2583
265 Ga0265338_10007111 3300028800 Bacteria 14017
266 Ga0265338_10018475 3300028800 Bacteria 7463
267 Ga0265338_10038081 3300028800 Bacteria 4563
268 Ga0265338_10047480 3300028800 Bacteria 3920
269 Ga0265338_10056098 3300028800 Bacteria 3498
270 Ga0265330_10001094 3300031235 Bacteria 16318
271 Ga0265330_10001536 3300031235 Bacteria 13287
272 Ga0265330_10010151 3300031235 Bacteria 4449
273 Ga0265328_10017076 3300031239 Unclassified 2815
274 Ga0265325_10002174 3300031241 Bacteria 13358
275 Ga0265325_10013045 3300031241 Bacteria 4738
276 Ga0265325_10047197 3300031241 Bacteria 2230
277 Ga0265340_10018031 3300031247 Bacteria 3648
278 Ga0265340_10037400 3300031247 Bacteria 2405
279 Ga0265339_10000073 3300031249 Bacteria 87912
280 Ga0265339_10005566 3300031249 Bacteria 8374
281 Ga0265339_10008886 3300031249 Bacteria 6360
282 Ga0265339_10020422 3300031249 Unclassified 3871
283 Ga0265339_10072712 3300031249 Bacteria 1829
284 Ga0265316_10002312 3300031344 Bacteria 19919
285 Ga0265316_10004661 3300031344 Bacteria 13579
286 Ga0265316_10009144 3300031344 Bacteria 9129
287 Ga0265316_10150054 3300031344 Bacteria 1746
288 Ga0265316_10232152 3300031344 Unclassified 1358
289 Ga0265314_10002940 3300031711 Bacteria 16878
290 Ga0265314_10011923 3300031711 Bacteria 7136
291 Ga0265314_10129401 3300031711 Bacteria 1577
292 Ga0265342_10007340 3300031712 Bacteria 8086
293 Ga0265342_10009299 3300031712 Bacteria 6940
294 Ga0265342_10025558 3300031712 Bacteria 3710
295 Ga0265342_10029942 3300031712 Bacteria 3377
296 Ga0265342_10041423 3300031712 Bacteria 2789
297 Ga0316576_10032401 3300031727 Bacteria 3714
298 Ga0373931_0076470 3300035691 Bacteria 1839
299 Ga0373937_0130139 3300036401 Unclassified 2350
300 Ga0373937_0151251 3300036401 Unclassified 2174
301 Ga0373937_0277515 3300036401 Bacteria 1582
302 Ga0373937_0468747 3300036401 Bacteria 1196
303 Ga0316582_0023789 3300036647 Bacteria 3655
304 Ga0316584_0227721 3300036712 Bacteria 1367
305 Ga0395905_0012868 3300037471 Bacteria 8042
306 Ga0436365_0993760 3300039437 Unclassified 1688
307 Ga0466961_0068921 3300044693 Bacteria 2246
308 Ga0466961_0177774 3300044693 Bacteria 1322
309 Ga0453684_0077097 3300044712 Bacteria 4181
310 Ga0451576_0046807 3300045051 Bacteria 4553
311 Ga0451576_0112986 3300045051 Bacteria 2827
312 Ga0466967_0010336 3300045976 Bacteria 6995
313 Ga0466967_0487152 3300045976 Bacteria 1209
314 Ga0495603_0052580 3300046455 Bacteria 2418
315 Ga0495603_0075197 3300046455 Bacteria 1983
316 Ga0495629_0000032 3300046459 Bacteria 123692
317 Ga0495641_0084490 3300046461 Bacteria 1421
318 Ga0495650_0001665 3300046471 Bacteria 20527
319 Ga0495580_0001130 3300046472 Bacteria 23534
320 Ga0495580_0010011 3300046472 Bacteria 7413
321 Ga0495580_0034706 3300046472 Bacteria 3630
322 Ga0495580_0061254 3300046472 Bacteria 2642
323 Ga0495582_0004653 3300046473 Bacteria 7716
324 Ga0495582_0006335 3300046473 Bacteria 6582
325 Ga0495582_0110923 3300046473 Bacteria 1541
326 Ga0495639_0003430 3300046475 Bacteria 6866
327 Ga0495594_0002500 3300046499 Bacteria 9575
328 Ga0495594_0008499 3300046499 Bacteria 5292
329 Ga0495606_0059772 3300046507 Bacteria 2444
330 Ga0495634_0013813 3300046642 Bacteria 5833
331 Ga0495625_0000440 3300046660 Bacteria 62404
332 Ga0495635_0002545 3300046663 Bacteria 12480
333 Ga0495647_0005765 3300046681 Unclassified 4072
334 Ga0495658_0000032 3300046683 Bacteria 70764
335 Ga0495658_0154168 3300046683 Bacteria 1413
336 Ga0495613_0003654 3300046689 Bacteria 11527
337 Ga0495613_0126354 3300046689 Bacteria 1834
338 Ga0495581_0000814 3300047315 Bacteria 16574
339 Ga0495676_0037832 3300047321 Bacteria 4013
340 Ga0495680_0001036 3300047322 Bacteria 30811
341 Ga0495687_035883 3300047443 Bacteria 2224
342 Ga0495684_0158433 3300047471 Bacteria 1690
343 Ga0495686_0008736 3300047472 Bacteria 7391
344 Ga0495593_0047225 3300047673 Unclassified 2291
345 Ga0495614_0000631 3300048089 Bacteria 14730
346 Ga0496100_0021209 3300048903 Bacteria 3910
347 Ga0496101_0043114 3300048904 Bacteria 3223
348 Ga0496104_0061298 3300048907 Bacteria 3566
349 Ga0496112_0055903 3300048915 Bacteria 3883
350 Ga0496114_0000773 3300048917 Bacteria 23911
351 Ga0501032_0001821 3300049569 Bacteria 16847
352 Ga0501033_0011659 3300049570 Bacteria 6722
353 Ga0501034_0001382 3300049571 Bacteria 32652
354 Ga0501034_0008364 3300049571 Bacteria 10941
355 Ga0501036_0000814 3300049572 Bacteria 23171
356 Ga0501037_0004060 3300049573 Bacteria 10616
357 Ga0501039_0004429 3300049575 Bacteria 10603
358 Ga0501040_0033083 3300049576 Bacteria 3501
359 Ga0501041_0069190 3300049577 Bacteria 2165
360 Ga0501042_0144179 3300049578 Bacteria 1717
361 Ga0501043_0002168 3300049579 Bacteria 16750
362 Ga0501043_0013883 3300049579 Bacteria 6302
363 Ga0501046_0000227 3300049580 Bacteria 58747
364 Ga0501046_0000783 3300049580 Bacteria 30741
365 Ga0501047_0000011 3300049581 Bacteria 409778
366 Ga0501048_0003030 3300049582 Bacteria 12827
367 Ga0501048_0004771 3300049582 Bacteria 10329
368 Ga0501048_0040947 3300049582 Bacteria 3319
369 Ga0501067_0001582 3300049583 Bacteria 12458
370 Ga0501068_0000562 3300049584 Bacteria 18872
371 Ga0501068_0004197 3300049584 Bacteria 7817
372 Ga0501069_0000891 3300049585 Bacteria 14251
373 Ga0501070_0007296 3300049586 Bacteria 9387
374 Ga0501070_0046437 3300049586 Bacteria 3611
375 Ga0501072_0000009 3300049588 Bacteria 206584
376 Ga0501072_0026652 3300049588 Bacteria 4506
377 Ga0501073_0000325 3300049589 Bacteria 31963
378 Ga0501073_0004511 3300049589 Bacteria 10463
379 Ga0501073_0018940 3300049589 Bacteria 4974
380 Ga0501074_0000466 3300049590 Bacteria 24434
381 Ga0501074_0000567 3300049590 Bacteria 22887
382 Ga0501075_0027833 3300049591 Bacteria 4168
383 Ga0501077_0032746 3300049593 Bacteria 3309
384 Ga0501079_0003259 3300049741 Bacteria 11901
385 Ga0501079_0005643 3300049741 Bacteria 9339
386 Ga0501080_0000021 3300049742 Bacteria 91749
387 Ga0501080_0004751 3300049742 Bacteria 12114
388 Ga0501083_0000144 3300049744 Bacteria 48521
389 Ga0501083_0004466 3300049744 Bacteria 9882
390 Ga0501044_0045456 3300049823 Bacteria 4548
391 Ga0501045_0047666 3300049824 Bacteria 3122
392 nmdc:mga08y16_9996_c1 3300050511 Bacteria 9955
393 Ga0495619_0001032 3300053085 Bacteria 18269
394 Ga0501084_0000004 3300054114 Bacteria 267128
395 Ga0501084_0000522 3300054114 Bacteria 29401
396 Ga0501082_0003396 3300060353 Bacteria 13899
397 Ga0501082_0009375 3300060353 Bacteria 8430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0110923 Ga0495582_0110923_74_1009 305
2 3300046499 Ga0495594_0008499 Ga0495594_0008499_3854_4789 305
3 3300036712 Ga0316584_0227721 Ga0316584_0227721_35_982 310
4 3300046461 Ga0495641_0084490 Ga0495641_0084490_370_1356 316
5 3300005548 Ga0070665_100128250 Ga0070665_1001282502 330
6 3300028379 Ga0268266_10002423 Ga0268266_100024232 330
7 3300009177 Ga0105248_10018351 Ga0105248_100183514 334
8 3300013296 Ga0157374_10015655 Ga0157374_100156553 334
9 3300005436 Ga0070713_100087761 Ga0070713_1000877612 347
10 3300036401 Ga0373937_0468747 Ga0373937_0468747_76_1170 348
11 3300046475 Ga0495639_0003430 Ga0495639_0003430_65_1159 348
12 3300047471 Ga0495684_0158433 Ga0495684_0158433_556_1650 348
13 3300013100 Ga0157373_10194792 Ga0157373_101947922 353
14 3300009093 Ga0105240_10003498 Ga0105240_100034989 357
15 3300009177 Ga0105248_10053790 Ga0105248_100537906 357
16 3300009551 Ga0105238_10119736 Ga0105238_101197361 357
17 3300010375 Ga0105239_10004574 Ga0105239_100045748 357
18 3300009093 Ga0105240_10095064 Ga0105240_100950642 359
19 3300009098 Ga0105245_10335346 Ga0105245_103353461 359
20 3300013105 Ga0157369_10344282 Ga0157369_103442822 359
21 3300013307 Ga0157372_10199760 Ga0157372_101997602 359
22 3300048903 Ga0496100_0021209 Ga0496100_0021209_445_1635 361
23 3300048904 Ga0496101_0043114 Ga0496101_0043114_1507_2697 361
24 3300048917 Ga0496114_0000773 Ga0496114_0000773_17842_19032 361
25 3300009177 Ga0105248_10340909 Ga0105248_103409092 362
26 3300046455 Ga0495603_0075197 Ga0495603_0075197_788_1960 365
27 3300046459 Ga0495629_0000032 Ga0495629_0000032_52547_53764 365
28 3300046473 Ga0495582_0004653 Ga0495582_0004653_6047_7219 365
29 3300046499 Ga0495594_0002500 Ga0495594_0002500_2618_3835 365
30 3300046642 Ga0495634_0013813 Ga0495634_0013813_1118_2335 365
31 3300046663 Ga0495635_0002545 Ga0495635_0002545_5253_6470 365
32 3300046681 Ga0495647_0005765 Ga0495647_0005765_799_2016 365
33 3300046683 Ga0495658_0000032 Ga0495658_0000032_21143_22360 365
34 3300046689 Ga0495613_0003654 Ga0495613_0003654_4238_5455 365
35 3300047315 Ga0495581_0000814 Ga0495581_0000814_4438_5655 365
36 3300047321 Ga0495676_0037832 Ga0495676_0037832_1243_2460 365
37 3300047322 Ga0495680_0001036 Ga0495680_0001036_22432_23649 365
38 3300047673 Ga0495593_0047225 Ga0495593_0047225_818_1990 365
39 3300048089 Ga0495614_0000631 Ga0495614_0000631_3566_4783 365
40 3300053085 Ga0495619_0001032 Ga0495619_0001032_11259_12476 365
41 3300005328 Ga0070676_10017099 Ga0070676_100170992 366
42 3300005330 Ga0070690_100013903 Ga0070690_1000139032 366
43 3300005347 Ga0070668_100031669 Ga0070668_1000316692 366
44 3300005353 Ga0070669_100015831 Ga0070669_1000158313 366
45 3300005444 Ga0070694_100035708 Ga0070694_1000357083 366
46 3300005543 Ga0070672_100054425 Ga0070672_1000544253 366
47 3300005544 Ga0070686_100022791 Ga0070686_1000227914 366
48 3300005718 Ga0068866_10007111 Ga0068866_100071113 366
49 3300005719 Ga0068861_100036765 Ga0068861_1000367654 366
50 3300005842 Ga0068858_100056261 Ga0068858_1000562612 366
51 3300006881 Ga0068865_100005433 Ga0068865_1000054334 366
52 3300013297 Ga0157378_10231152 Ga0157378_102311522 366
53 3300013306 Ga0163162_10097665 Ga0163162_100976652 366
54 3300014326 Ga0157380_10042960 Ga0157380_100429602 366
55 3300025899 Ga0207642_10005440 Ga0207642_100054404 366
56 3300025903 Ga0207680_10121139 Ga0207680_101211392 366
57 3300025907 Ga0207645_10019428 Ga0207645_100194282 366
58 3300025935 Ga0207709_10025016 Ga0207709_100250162 366
59 3300025936 Ga0207670_10033896 Ga0207670_100338963 366
60 3300025940 Ga0207691_10026803 Ga0207691_100268033 366
61 3300026075 Ga0207708_10001189 Ga0207708_100011899 366
62 3300026089 Ga0207648_10004418 Ga0207648_100044183 366
63 3300026118 Ga0207675_100017396 Ga0207675_1000173964 366
64 3300028800 Ga0265338_10038081 Ga0265338_100380812 366
65 3300031344 Ga0265316_10009144 Ga0265316_1000914410 366
66 3300036401 Ga0373937_0151251 Ga0373937_0151251_269_1468 366
67 3300045976 Ga0466967_0487152 Ga0466967_0487152_18_1172 366
68 3300003322 rootL2_10222745 rootL2_102227452 367
69 3300005617 Ga0068859_100000040 Ga0068859_10000004088 367
70 3300006871 Ga0075434_100281628 Ga0075434_1002816281 367
71 3300006931 Ga0097620_100000040 Ga0097620_10000004088 367
72 3300028800 Ga0265338_10007111 Ga0265338_1000711113 367
73 3300031239 Ga0265328_10017076 Ga0265328_100170762 367
74 3300031249 Ga0265339_10008886 Ga0265339_100088862 367
75 3300035691 Ga0373931_0076470 Ga0373931_0076470_10_1200 371
76 3300005327 Ga0070658_10018718 Ga0070658_100187186 372
77 3300005530 Ga0070679_100174390 Ga0070679_1001743901 372
78 3300005617 Ga0068859_100036071 Ga0068859_1000360714 372
79 3300006931 Ga0097620_100036072 Ga0097620_1000360724 372
80 3300009551 Ga0105238_10206318 Ga0105238_102063182 372
81 3300013296 Ga0157374_10224342 Ga0157374_102243422 372
82 3300025909 Ga0207705_10036218 Ga0207705_100362182 372
83 3300005355 Ga0070671_100005443 Ga0070671_1000054431 373
84 3300005548 Ga0070665_100022721 Ga0070665_1000227213 373
85 3300005618 Ga0068864_100036276 Ga0068864_1000362763 373
86 3300005841 Ga0068863_100004315 Ga0068863_1000043158 373
87 3300014325 Ga0163163_10004504 Ga0163163_100045049 373
88 3300026088 Ga0207641_10038300 Ga0207641_100383003 373
89 3300026095 Ga0207676_10027514 Ga0207676_100275142 373
90 3300005337 Ga0070682_100182293 Ga0070682_1001822932 375
91 3300009093 Ga0105240_10013709 Ga0105240_100137099 375
92 3300014326 Ga0157380_10006794 Ga0157380_100067943 375
93 3300025913 Ga0207695_10063165 Ga0207695_100631653 375
94 3300025949 Ga0207667_10001656 Ga0207667_1000165618 375
95 3300026067 Ga0207678_10033647 Ga0207678_100336475 375
96 3300026118 Ga0207675_100411401 Ga0207675_1004114012 375
97 3300046471 Ga0495650_0001665 Ga0495650_0001665_241_1392 375
98 3300047472 Ga0495686_0008736 Ga0495686_0008736_2928_4100 375
99 3300050511 nmdc:mga08y16_9996_c1 nmdc:mga08y16_9996_c1_6056_7231 375
100 3300005548 Ga0070665_100114271 Ga0070665_1001142712 376
101 3300028379 Ga0268266_10002773 Ga0268266_100027732 376
102 3300046660 Ga0495625_0000440 Ga0495625_0000440_5332_6486 376
103 3300005614 Ga0068856_100222384 Ga0068856_1002223841 377
104 3300009093 Ga0105240_10017198 Ga0105240_100171985 377
105 3300009098 Ga0105245_10108133 Ga0105245_101081332 377
106 3300013307 Ga0157372_10059676 Ga0157372_100596763 377
107 3300031235 Ga0265330_10010151 Ga0265330_100101512 377
108 3300044712 Ga0453684_0077097 Ga0453684_0077097_338_1486 377
109 3300025919 Ga0207657_10067767 Ga0207657_100677672 378
110 3300037471 Ga0395905_0012868 Ga0395905_0012868_4018_5178 378
111 3300005336 Ga0070680_100014573 Ga0070680_1000145735 379
112 3300009101 Ga0105247_10037455 Ga0105247_100374552 379
113 3300009174 Ga0105241_10000063 Ga0105241_1000006355 379
114 3300009177 Ga0105248_10000004 Ga0105248_10000004423 379
115 3300013105 Ga0157369_10054883 Ga0157369_100548835 379
116 3300014968 Ga0157379_10210181 Ga0157379_102101812 379
117 3300025900 Ga0207710_10018844 Ga0207710_100188444 379
118 3300025911 Ga0207654_10000215 Ga0207654_1000021512 379
119 3300025921 Ga0207652_10221913 Ga0207652_102219132 379
120 3300025941 Ga0207711_10000032 Ga0207711_10000032155 379
121 3300028577 Ga0265318_10025754 Ga0265318_100257542 379
122 3300028800 Ga0265338_10056098 Ga0265338_100560984 379
123 3300031235 Ga0265330_10001094 Ga0265330_100010949 379
124 3300031241 Ga0265325_10013045 Ga0265325_100130452 379
125 3300031247 Ga0265340_10018031 Ga0265340_100180314 379
126 3300031247 Ga0265340_10037400 Ga0265340_100374003 379
127 3300031249 Ga0265339_10000073 Ga0265339_1000007358 379
128 3300031249 Ga0265339_10072712 Ga0265339_100727122 379
129 3300031344 Ga0265316_10150054 Ga0265316_101500542 379
130 3300031344 Ga0265316_10232152 Ga0265316_102321521 379
131 3300031712 Ga0265342_10007340 Ga0265342_100073406 379
132 3300031712 Ga0265342_10009299 Ga0265342_100092992 379
133 3300031712 Ga0265342_10025558 Ga0265342_100255581 379
134 3300031712 Ga0265342_10029942 Ga0265342_100299422 379
135 3300005327 Ga0070658_10027544 Ga0070658_100275445 380
136 3300005327 Ga0070658_10043821 Ga0070658_100438213 380
137 3300005329 Ga0070683_100021465 Ga0070683_1000214654 380
138 3300005329 Ga0070683_100140006 Ga0070683_1001400062 380
139 3300005331 Ga0070670_100005335 Ga0070670_10000533511 380
140 3300005338 Ga0068868_100020981 Ga0068868_1000209813 380
141 3300005344 Ga0070661_100010035 Ga0070661_1000100352 380
142 3300005344 Ga0070661_100052757 Ga0070661_1000527572 380
143 3300005355 Ga0070671_100014395 Ga0070671_1000143953 380
144 3300005436 Ga0070713_100020605 Ga0070713_1000206053 380
145 3300005468 Ga0070707_100028062 Ga0070707_1000280622 380
146 3300005518 Ga0070699_100089546 Ga0070699_1000895462 380
147 3300005535 Ga0070684_100003332 Ga0070684_10000333210 380
148 3300005539 Ga0068853_100000074 Ga0068853_10000007451 380
149 3300005539 Ga0068853_100022492 Ga0068853_1000224924 380
150 3300005548 Ga0070665_100008390 Ga0070665_1000083908 380
151 3300005563 Ga0068855_100001215 Ga0068855_10000121518 380
152 3300005563 Ga0068855_100003203 Ga0068855_1000032036 380
153 3300005563 Ga0068855_100023784 Ga0068855_1000237849 380
154 3300005577 Ga0068857_100001254 Ga0068857_1000012547 380
155 3300005577 Ga0068857_100024193 Ga0068857_1000241933 380
156 3300005614 Ga0068856_100003456 Ga0068856_1000034564 380
157 3300005614 Ga0068856_100004477 Ga0068856_1000044774 380
158 3300005614 Ga0068856_100008315 Ga0068856_1000083157 380
159 3300005614 Ga0068856_100192969 Ga0068856_1001929692 380
160 3300005616 Ga0068852_100000073 Ga0068852_10000007328 380
161 3300005616 Ga0068852_100000157 Ga0068852_10000015736 380
162 3300005617 Ga0068859_100205183 Ga0068859_1002051832 380
163 3300005618 Ga0068864_100005109 Ga0068864_1000051099 380
164 3300005834 Ga0068851_10022659 Ga0068851_100226592 380
165 3300005841 Ga0068863_100029377 Ga0068863_1000293773 380
166 3300005842 Ga0068858_100065610 Ga0068858_1000656102 380
167 3300005842 Ga0068858_100134131 Ga0068858_1001341311 380
168 3300005843 Ga0068860_100014746 Ga0068860_1000147462 380
169 3300005843 Ga0068860_100030486 Ga0068860_1000304864 380
170 3300005844 Ga0068862_100179504 Ga0068862_1001795042 380
171 3300006028 Ga0070717_10001564 Ga0070717_100015644 380
172 3300006237 Ga0097621_100001548 Ga0097621_1000015485 380
173 3300006237 Ga0097621_100004777 Ga0097621_1000047771 380
174 3300006358 Ga0068871_100001595 Ga0068871_1000015958 380
175 3300006358 Ga0068871_100263328 Ga0068871_1002633281 380
176 3300006931 Ga0097620_100205183 Ga0097620_1002051832 380
177 3300009093 Ga0105240_10000110 Ga0105240_1000011030 380
178 3300009093 Ga0105240_10011865 Ga0105240_100118654 380
179 3300009093 Ga0105240_10095222 Ga0105240_100952222 380
180 3300009098 Ga0105245_10003381 Ga0105245_100033813 380
181 3300009098 Ga0105245_10005417 Ga0105245_100054177 380
182 3300009098 Ga0105245_10022119 Ga0105245_100221193 380
183 3300009101 Ga0105247_10012244 Ga0105247_100122444 380
184 3300009174 Ga0105241_10000111 Ga0105241_1000011145 380
185 3300009174 Ga0105241_10002420 Ga0105241_1000242010 380
186 3300009174 Ga0105241_10050445 Ga0105241_100504453 380
187 3300009176 Ga0105242_10042700 Ga0105242_100427003 380
188 3300009177 Ga0105248_10018480 Ga0105248_100184803 380
189 3300009177 Ga0105248_10077627 Ga0105248_100776272 380
190 3300009545 Ga0105237_10024254 Ga0105237_100242543 380
191 3300009551 Ga0105238_10000022 Ga0105238_1000002285 380
192 3300009551 Ga0105238_10190043 Ga0105238_101900432 380
193 3300010375 Ga0105239_10004929 Ga0105239_1000492914 380
194 3300010375 Ga0105239_10071038 Ga0105239_100710381 380
195 3300010375 Ga0105239_10325747 Ga0105239_103257471 380
196 3300011119 Ga0105246_10007035 Ga0105246_100070356 380
197 3300013104 Ga0157370_10000001 Ga0157370_10000001144 380
198 3300013105 Ga0157369_10000017 Ga0157369_1000001772 380
199 3300013105 Ga0157369_10001500 Ga0157369_1000150024 380
200 3300013105 Ga0157369_10003062 Ga0157369_1000306210 380
201 3300013105 Ga0157369_10006657 Ga0157369_100066576 380
202 3300013105 Ga0157369_10140214 Ga0157369_101402144 380
203 3300013296 Ga0157374_10358663 Ga0157374_103586631 380
204 3300013297 Ga0157378_10000059 Ga0157378_1000005981 380
205 3300013297 Ga0157378_10011342 Ga0157378_100113426 380
206 3300013297 Ga0157378_10095372 Ga0157378_100953722 380
207 3300013297 Ga0157378_10103040 Ga0157378_101030403 380
208 3300013306 Ga0163162_10021422 Ga0163162_100214224 380
209 3300013307 Ga0157372_10000019 Ga0157372_1000001941 380
210 3300013307 Ga0157372_10001397 Ga0157372_100013972 380
211 3300013307 Ga0157372_10025697 Ga0157372_100256974 380
212 3300013307 Ga0157372_10041919 Ga0157372_100419194 380
213 3300013307 Ga0157372_10174147 Ga0157372_101741471 380
214 3300013307 Ga0157372_10251112 Ga0157372_102511122 380
215 3300014325 Ga0163163_10001614 Ga0163163_1000161416 380
216 3300014968 Ga0157379_10015131 Ga0157379_100151311 380
217 3300014969 Ga0157376_10015352 Ga0157376_100153522 380
218 3300014969 Ga0157376_10171039 Ga0157376_101710392 380
219 3300025321 Ga0207656_10003195 Ga0207656_100031954 380
220 3300025321 Ga0207656_10045459 Ga0207656_100454592 380
221 3300025900 Ga0207710_10005232 Ga0207710_100052322 380
222 3300025903 Ga0207680_10034144 Ga0207680_100341442 380
223 3300025909 Ga0207705_10053257 Ga0207705_100532572 380
224 3300025909 Ga0207705_10053811 Ga0207705_100538113 380
225 3300025911 Ga0207654_10000148 Ga0207654_100001485 380
226 3300025913 Ga0207695_10000026 Ga0207695_10000026423 380
227 3300025913 Ga0207695_10000096 Ga0207695_10000096103 380
228 3300025913 Ga0207695_10000168 Ga0207695_10000168119 380
229 3300025913 Ga0207695_10013431 Ga0207695_100134318 380
230 3300025913 Ga0207695_10013487 Ga0207695_100134879 380
231 3300025914 Ga0207671_10000022 Ga0207671_10000022176 380
232 3300025914 Ga0207671_10005196 Ga0207671_1000519610 380
233 3300025920 Ga0207649_10007625 Ga0207649_100076255 380
234 3300025920 Ga0207649_10034882 Ga0207649_100348823 380
235 3300025924 Ga0207694_10000009 Ga0207694_10000009106 380
236 3300025924 Ga0207694_10009788 Ga0207694_100097887 380
237 3300025927 Ga0207687_10173709 Ga0207687_101737092 380
238 3300025931 Ga0207644_10089323 Ga0207644_100893232 380
239 3300025934 Ga0207686_10184562 Ga0207686_101845621 380
240 3300025941 Ga0207711_10055226 Ga0207711_100552262 380
241 3300025941 Ga0207711_10126841 Ga0207711_101268411 380
242 3300025942 Ga0207689_10001414 Ga0207689_100014146 380
243 3300025944 Ga0207661_10011133 Ga0207661_100111334 380
244 3300025945 Ga0207679_10109054 Ga0207679_101090542 380
245 3300025949 Ga0207667_10003259 Ga0207667_1000325914 380
246 3300025949 Ga0207667_10012010 Ga0207667_100120106 380
247 3300025981 Ga0207640_10102717 Ga0207640_101027171 380
248 3300025986 Ga0207658_10027822 Ga0207658_100278222 380
249 3300026023 Ga0207677_10002816 Ga0207677_100028169 380
250 3300026023 Ga0207677_10049484 Ga0207677_100494843 380
251 3300026023 Ga0207677_10086238 Ga0207677_100862383 380
252 3300026035 Ga0207703_10063325 Ga0207703_100633252 380
253 3300026041 Ga0207639_10000065 Ga0207639_1000006592 380
254 3300026041 Ga0207639_10100499 Ga0207639_101004993 380
255 3300026041 Ga0207639_10337351 Ga0207639_103373511 380
256 3300026067 Ga0207678_10187072 Ga0207678_101870721 380
257 3300026078 Ga0207702_10001772 Ga0207702_1000177216 380
258 3300026078 Ga0207702_10008208 Ga0207702_100082083 380
259 3300026078 Ga0207702_10045602 Ga0207702_100456023 380
260 3300026088 Ga0207641_10015820 Ga0207641_100158206 380
261 3300026116 Ga0207674_10002547 Ga0207674_1000254711 380
262 3300026142 Ga0207698_10000018 Ga0207698_1000001886 380
263 3300026142 Ga0207698_10000028 Ga0207698_1000002824 380
264 3300026142 Ga0207698_10013761 Ga0207698_100137614 380
265 3300028800 Ga0265338_10018475 Ga0265338_100184752 380
266 3300028800 Ga0265338_10047480 Ga0265338_100474804 380
267 3300031241 Ga0265325_10002174 Ga0265325_100021748 380
268 3300031249 Ga0265339_10020422 Ga0265339_100204224 380
269 3300031711 Ga0265314_10011923 Ga0265314_100119232 380
270 3300039437 Ga0436365_0993760 Ga0436365_0993760_204_1379 380
271 3300045976 Ga0466967_0010336 Ga0466967_0010336_5578_6747 380
272 3300046689 Ga0495613_0126354 Ga0495613_0126354_62_1261 380
273 3300048907 Ga0496104_0061298 Ga0496104_0061298_140_1339 380
274 3300048915 Ga0496112_0055903 Ga0496112_0055903_372_1532 380
275 3300005331 Ga0070670_100009560 Ga0070670_10000956010 381
276 3300005336 Ga0070680_100024417 Ga0070680_1000244172 381
277 3300005340 Ga0070689_100000011 Ga0070689_100000011126 381
278 3300005340 Ga0070689_100017085 Ga0070689_1000170852 381
279 3300005436 Ga0070713_100034981 Ga0070713_1000349816 381
280 3300005436 Ga0070713_100115417 Ga0070713_1001154171 381
281 3300005445 Ga0070708_100093414 Ga0070708_1000934142 381
282 3300005468 Ga0070707_100316183 Ga0070707_1003161831 381
283 3300005536 Ga0070697_100000161 Ga0070697_10000016121 381
284 3300005536 Ga0070697_100043850 Ga0070697_1000438503 381
285 3300005937 Ga0081455_10033054 Ga0081455_100330543 381
286 3300009101 Ga0105247_10073745 Ga0105247_100737451 381
287 3300009147 Ga0114129_10367677 Ga0114129_103676773 381
288 3300013104 Ga0157370_10087131 Ga0157370_100871313 381
289 3300013105 Ga0157369_10002310 Ga0157369_1000231017 381
290 3300013307 Ga0157372_10018587 Ga0157372_100185877 381
291 3300025900 Ga0207710_10001637 Ga0207710_100016373 381
292 3300025904 Ga0207647_10006895 Ga0207647_100068957 381
293 3300025928 Ga0207700_10014109 Ga0207700_100141096 381
294 3300025936 Ga0207670_10052082 Ga0207670_100520822 381
295 3300025944 Ga0207661_10001567 Ga0207661_100015677 381
296 3300031249 Ga0265339_10005566 Ga0265339_100055666 381
297 3300031344 Ga0265316_10002312 Ga0265316_1000231216 381
298 3300031711 Ga0265314_10002940 Ga0265314_100029406 381
299 3300031711 Ga0265314_10129401 Ga0265314_101294011 381
300 3300036401 Ga0373937_0277515 Ga0373937_0277515_408_1559 381
301 3300044693 Ga0466961_0068921 Ga0466961_0068921_960_2138 381
302 3300044693 Ga0466961_0177774 Ga0466961_0177774_77_1261 381
303 3300046472 Ga0495580_0001130 Ga0495580_0001130_5287_6456 381
304 3300046472 Ga0495580_0010011 Ga0495580_0010011_1516_2685 381
305 3300046472 Ga0495580_0034706 Ga0495580_0034706_1271_2440 381
306 3300049583 Ga0501067_0001582 Ga0501067_0001582_5125_6315 381
307 3300049589 Ga0501073_0018940 Ga0501073_0018940_2096_3286 381
308 3300049744 Ga0501083_0004466 Ga0501083_0004466_7308_8465 381
309 3300005293 Ga0065715_10002164 Ga0065715_100021643 382
310 3300005438 Ga0070701_10023701 Ga0070701_100237012 382
311 3300005617 Ga0068859_100024035 Ga0068859_1000240354 382
312 3300006914 Ga0075436_100076223 Ga0075436_1000762232 382
313 3300006931 Ga0097620_100024035 Ga0097620_1000240354 382
314 3300009551 Ga0105238_10206844 Ga0105238_102068441 382
315 3300013105 Ga0157369_10001016 Ga0157369_1000101622 382
316 3300014968 Ga0157379_10037896 Ga0157379_100378964 382
317 3300026118 Ga0207675_100004586 Ga0207675_10000458612 382
318 3300031241 Ga0265325_10047197 Ga0265325_100471972 382
319 3300031344 Ga0265316_10004661 Ga0265316_100046614 382
320 3300045051 Ga0451576_0046807 Ga0451576_0046807_536_1711 382
321 3300045051 Ga0451576_0112986 Ga0451576_0112986_180_1355 382
322 3300046507 Ga0495606_0059772 Ga0495606_0059772_602_1774 382
323 3300047443 Ga0495687_035883 Ga0495687_035883_973_2145 382
324 3300005467 Ga0070706_100000048 Ga0070706_10000004879 383
325 3300006844 Ga0075428_100055382 Ga0075428_1000553823 383
326 3300006844 Ga0075428_100102226 Ga0075428_1001022262 383
327 3300006847 Ga0075431_100192394 Ga0075431_1001923943 383
328 3300009551 Ga0105238_10060628 Ga0105238_100606284 383
329 3300010375 Ga0105239_10333265 Ga0105239_103332651 383
330 3300013105 Ga0157369_10086996 Ga0157369_100869963 383
331 3300025910 Ga0207684_10000121 Ga0207684_1000012137 383
332 3300025922 Ga0207646_10091965 Ga0207646_100919652 383
333 3300031235 Ga0265330_10001536 Ga0265330_1000153610 383
334 3300036401 Ga0373937_0130139 Ga0373937_0130139_469_1644 383
335 3300046455 Ga0495603_0052580 Ga0495603_0052580_797_1984 383
336 3300046472 Ga0495580_0061254 Ga0495580_0061254_1164_2351 383
337 3300046473 Ga0495582_0006335 Ga0495582_0006335_4414_5601 383
338 3300046683 Ga0495658_0154168 Ga0495658_0154168_185_1372 383
339 3300049569 Ga0501032_0001821 Ga0501032_0001821_15229_16392 383
340 3300049570 Ga0501033_0011659 Ga0501033_0011659_1738_2901 383
341 3300049571 Ga0501034_0001382 Ga0501034_0001382_1552_2739 383
342 3300049571 Ga0501034_0008364 Ga0501034_0008364_3968_5131 383
343 3300049572 Ga0501036_0000814 Ga0501036_0000814_17597_18760 383
344 3300049573 Ga0501037_0004060 Ga0501037_0004060_4284_5447 383
345 3300049575 Ga0501039_0004429 Ga0501039_0004429_5619_6782 383
346 3300049576 Ga0501040_0033083 Ga0501040_0033083_1680_2843 383
347 3300049577 Ga0501041_0069190 Ga0501041_0069190_977_2140 383
348 3300049578 Ga0501042_0144179 Ga0501042_0144179_35_1198 383
349 3300049579 Ga0501043_0002168 Ga0501043_0002168_11579_12766 383
350 3300049579 Ga0501043_0013883 Ga0501043_0013883_622_1785 383
351 3300049580 Ga0501046_0000227 Ga0501046_0000227_1424_2611 383
352 3300049580 Ga0501046_0000783 Ga0501046_0000783_5037_6200 383
353 3300049581 Ga0501047_0000011 Ga0501047_0000011_122679_123866 383
354 3300049582 Ga0501048_0003030 Ga0501048_0003030_9324_10511 383
355 3300049582 Ga0501048_0004771 Ga0501048_0004771_6206_7369 383
356 3300049582 Ga0501048_0040947 Ga0501048_0040947_2135_3298 383
357 3300049584 Ga0501068_0000562 Ga0501068_0000562_9354_10517 383
358 3300049584 Ga0501068_0004197 Ga0501068_0004197_2889_4076 383
359 3300049585 Ga0501069_0000891 Ga0501069_0000891_6634_7797 383
360 3300049586 Ga0501070_0007296 Ga0501070_0007296_3060_4247 383
361 3300049586 Ga0501070_0046437 Ga0501070_0046437_487_1650 383
362 3300049588 Ga0501072_0000009 Ga0501072_0000009_81627_82814 383
363 3300049588 Ga0501072_0026652 Ga0501072_0026652_3016_4179 383
364 3300049589 Ga0501073_0000325 Ga0501073_0000325_5037_6200 383
365 3300049589 Ga0501073_0004511 Ga0501073_0004511_7853_9040 383
366 3300049590 Ga0501074_0000466 Ga0501074_0000466_10290_11477 383
367 3300049590 Ga0501074_0000567 Ga0501074_0000567_3018_4181 383
368 3300049591 Ga0501075_0027833 Ga0501075_0027833_850_2013 383
369 3300049593 Ga0501077_0032746 Ga0501077_0032746_1652_2815 383
370 3300049741 Ga0501079_0003259 Ga0501079_0003259_1004_2191 383
371 3300049741 Ga0501079_0005643 Ga0501079_0005643_3968_5131 383
372 3300049742 Ga0501080_0000021 Ga0501080_0000021_53230_54393 383
373 3300049742 Ga0501080_0004751 Ga0501080_0004751_4688_5875 383
374 3300049744 Ga0501083_0000144 Ga0501083_0000144_17628_18815 383
375 3300049823 Ga0501044_0045456 Ga0501044_0045456_131_1294 383
376 3300049824 Ga0501045_0047666 Ga0501045_0047666_666_1829 383
377 3300054114 Ga0501084_0000004 Ga0501084_0000004_115780_116967 383
378 3300054114 Ga0501084_0000522 Ga0501084_0000522_21733_22896 383
379 3300060353 Ga0501082_0003396 Ga0501082_0003396_9354_10517 383
380 3300060353 Ga0501082_0009375 Ga0501082_0009375_1004_2191 383
381 3300006847 Ga0075431_100114231 Ga0075431_1001142312 384
382 3300009093 Ga0105240_10001139 Ga0105240_100011395 384
383 3300013104 Ga0157370_10054728 Ga0157370_100547282 384
384 3300025913 Ga0207695_10000398 Ga0207695_1000039875 384
385 3300025928 Ga0207700_10290565 Ga0207700_102905651 384
386 3300031712 Ga0265342_10041423 Ga0265342_100414232 384
387 3300036647 Ga0316582_0023789 Ga0316582_0023789_110_1267 384
388 3300009098 Ga0105245_10001870 Ga0105245_100018706 385
389 3300009174 Ga0105241_10003751 Ga0105241_100037513 385
390 3300025911 Ga0207654_10046778 Ga0207654_100467782 385
391 3300025927 Ga0207687_10008473 Ga0207687_100084732 385
392 3300028653 Ga0265323_10019975 Ga0265323_100199752 385
393 3300031727 Ga0316576_10032401 Ga0316576_100324013 385
394 3300003320 rootH2_10003366 rootH2_100033669 386
395 3300005563 Ga0068855_100010470 Ga0068855_1000104702 386
396 3300005614 Ga0068856_100129465 Ga0068856_1001294652 386
397 3300025949 Ga0207667_10003253 Ga0207667_100032538 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

117

444

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dyd-assembly1.cif.gz_B human tyrosine aminotransferase 0.8897 30 382
3pdx-assembly1.cif.gz_A-2 crystal structural of mouse tyrosine aminotransferase 0.8818 30 385
1xi9-assembly1.cif.gz_C alanine aminotransferase from pyrococcus furiosus pfu-1397077-001 0.8669 3 386
4cvq-assembly1.cif.gz_B crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution 0.8648 1 384
2dou-assembly1.cif.gz_B probable n-succinyldiaminopimelate aminotransferase (ttha0342) from thermus thermophilus hb8 0.8631 16 381
ID Description Score Start End Superfamily
3nraA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8969 293 386 3.90.1150.10
3dzzB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8953 289 386 3.90.1150.10
4ix8B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8946 47 282 3.40.640.10
3l8aA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8945 289 381 3.90.1150.10
af_P04694_91_334_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8909 47 282 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A0K1QGR7-F1-model_v4 Putative aminotransferase 0.9825 1 386 GO:0008483
GO:0009058
GO:0030170
AF-A0A0K1QGR7-F1-model_v4 Putative aminotransferase 0.98 1 386 GO:0008483
GO:0009058
GO:0030170
AF-A0A0F2QZS4-F1-model_v4 alanine transaminase (EC 2.6.1.2) 0.975 3 383 GO:0008483
GO:0009058
GO:0030170
AF-A0A7V3VVK8-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.9677 3 382 GO:0008483
GO:0009058
GO:0030170
AF-A0A534QBH0-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.9657 3 383 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.92 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map