F433631

General Info

Members Datasets Scaffolds Average Seq Length
396 197 792 223

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_777683_c1|nmdc:mga08y16_777683_c1_144_911
Length 255
Sequence VARDAVEADERRCAPVAPFVEMEPHPFAGLSAVLAVLYDIHGNLPALENVLEDAEAAGATAYLLGGDFASWSPWPHETIERLRMLPETTWIRGNGERWLREPPLDRPEVVETIEGADSGLGTNEGWLYSLQASAELDGVLYVHGCPLRDDDSFGQAPSLEDPARLNGVRDRTVVFGHSHLQFRRPGPDGTTLLNPGSVGMPLDGDVRAAYALRRPDGEFEFRRVEFDTERAAAAYEERVPGFGPFAAARIRRGSD

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 13.13
Rhizosphere 85.86
Stem 0
Stem Tuber 0
Unclassified 11.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_777683_c1 3300050511 Bacteria 952
2 Ga0070676_10293969 3300005328 Unclassified 1099
3 Ga0070683_100005108 3300005329 Bacteria 10914
4 Ga0070683_100084560 3300005329 Bacteria 2973
5 Ga0070690_100252515 3300005330 Unclassified 1248
6 Ga0068869_100145030 3300005334 Bacteria 1837
7 Ga0070680_100034085 3300005336 Bacteria 4105
8 Ga0070680_100060201 3300005336 Bacteria 3107
9 Ga0070682_100010991 3300005337 Bacteria 5160
10 Ga0070682_100856774 3300005337 Unclassified 743
11 Ga0068868_100087966 3300005338 Bacteria 2499
12 Ga0070689_100207567 3300005340 Bacteria 1602
13 Ga0070689_100267265 3300005340 Bacteria 1415
14 Ga0070691_10021412 3300005341 Bacteria 2992
15 Ga0070692_10008356 3300005345 Bacteria 4615
16 Ga0070668_100018621 3300005347 Bacteria 5214
17 Ga0070668_100095903 3300005347 Bacteria 2343
18 Ga0070669_100891977 3300005353 Bacteria 759
19 Ga0070675_100057647 3300005354 Bacteria 3203
20 Ga0070674_100002922 3300005356 Bacteria 9469
21 Ga0070673_100390283 3300005364 Unclassified 1243
22 Ga0070688_100008780 3300005365 Bacteria 5501
23 Ga0070659_100048212 3300005366 Bacteria 3345
24 Ga0070667_100101535 3300005367 Bacteria 2485
25 Ga0070709_10044462 3300005434 Archaea 2750
26 Ga0070714_100173545 3300005435 Bacteria 1958
27 Ga0070713_100308710 3300005436 Bacteria 1458
28 Ga0070710_10006595 3300005437 Bacteria 5581
29 Ga0070701_10016823 3300005438 Bacteria 3407
30 Ga0070711_100139996 3300005439 Bacteria 1813
31 Ga0070705_100252485 3300005440 Unclassified 1239
32 Ga0070705_100301391 3300005440 Bacteria 1148
33 Ga0070705_100577395 3300005440 Bacteria 866
34 Ga0070708_100102405 3300005445 Bacteria 2623
35 Ga0070708_100110933 3300005445 Bacteria 2521
36 Ga0070708_100149367 3300005445 Bacteria 2172
37 Ga0070663_100010832 3300005455 Bacteria 5696
38 Ga0070662_100118718 3300005457 Bacteria 2025
39 Ga0070681_10018428 3300005458 Bacteria 6977
40 Ga0068867_100152104 3300005459 Bacteria 1818
41 Ga0070685_10003003 3300005466 Bacteria 8600
42 Ga0070706_100016309 3300005467 Bacteria 6863
43 Ga0070706_100038403 3300005467 Bacteria 4419
44 Ga0070707_100002679 3300005468 Bacteria 16930
45 Ga0070707_100006145 3300005468 Bacteria 11192
46 Ga0070707_100190902 3300005468 Bacteria 1997
47 Ga0070698_100008530 3300005471 Bacteria 11060
48 Ga0070698_100028053 3300005471 Bacteria 5851
49 Ga0070698_100030472 3300005471 Bacteria 5592
50 Ga0070698_100077255 3300005471 Bacteria 3330
51 Ga0070699_100016142 3300005518 Bacteria 6410
52 Ga0070699_100278846 3300005518 Bacteria 1497
53 Ga0070679_100029761 3300005530 Bacteria 5387
54 Ga0070679_100685152 3300005530 Unclassified 968
55 Ga0070684_100202550 3300005535 Bacteria 1808
56 Ga0070684_100284921 3300005535 Bacteria 1514
57 Ga0070697_100081050 3300005536 Bacteria 2674
58 Ga0070697_100143922 3300005536 Bacteria 2006
59 Ga0070697_100296350 3300005536 Bacteria 1390
60 Ga0068853_100649314 3300005539 Bacteria 1004
61 Ga0070686_100002266 3300005544 Bacteria 10613
62 Ga0070686_100062823 3300005544 Bacteria 2404
63 Ga0070695_100047867 3300005545 Bacteria 2733
64 Ga0070695_100219170 3300005545 Bacteria 1370
65 Ga0070696_100004361 3300005546 Bacteria 9426
66 Ga0070696_100081807 3300005546 Bacteria 2288
67 Ga0070696_100244858 3300005546 Unclassified 1354
68 Ga0070665_100032889 3300005548 Bacteria 5218
69 Ga0070704_100289416 3300005549 Viruses 1361
70 Ga0070704_100355415 3300005549 Bacteria 1238
71 Ga0068855_100022103 3300005563 Bacteria 7624
72 Ga0068855_100137157 3300005563 Bacteria 2790
73 Ga0068855_100236294 3300005563 Bacteria 2044
74 Ga0068854_100108420 3300005578 Bacteria 2091
75 Ga0068856_100007363 3300005614 Bacteria 10740
76 Ga0068856_100064498 3300005614 Bacteria 3619
77 Ga0070702_100000663 3300005615 Bacteria 12853
78 Ga0070702_100035022 3300005615 Bacteria 2771
79 Ga0070702_100268473 3300005615 Unclassified 1165
80 Ga0068852_100012004 3300005616 Bacteria 6554
81 Ga0068859_100015862 3300005617 Bacteria 7571
82 Ga0068864_100750824 3300005618 Bacteria 956
83 Ga0068866_10001111 3300005718 Bacteria 11823
84 Ga0068866_10038588 3300005718 Bacteria 2353
85 Ga0068861_100005826 3300005719 Bacteria 8366
86 Ga0068861_100038847 3300005719 Bacteria 3549
87 Ga0068861_100067186 3300005719 Bacteria 2766
88 Ga0068863_100139385 3300005841 Bacteria 2318
89 Ga0068863_100401213 3300005841 Bacteria 1341
90 Ga0068858_101134645 3300005842 Unclassified 768
91 Ga0081455_10032199 3300005937 Bacteria 4729
92 Ga0081455_10219715 3300005937 Bacteria 1409
93 Ga0081538_10000218 3300005981 Bacteria 64601
94 Ga0081540_1007144 3300005983 Bacteria 8011
95 Ga0081540_1076021 3300005983 Unclassified 1532
96 Ga0081539_10016512 3300005985 Bacteria 5261
97 Ga0081539_10017867 3300005985 Bacteria 4952
98 Ga0075365_10008523 3300006038 Bacteria 5829
99 Ga0097621_100006395 3300006237 Bacteria 8361
100 Ga0068871_100018197 3300006358 Bacteria 5335
101 Ga0075428_100017878 3300006844 Bacteria 7834
102 Ga0075428_100149521 3300006844 Bacteria 2537
103 Ga0075428_100672690 3300006844 Bacteria 1103
104 Ga0075428_100735563 3300006844 Unclassified 1050
105 Ga0075431_100845771 3300006847 Bacteria 886
106 Ga0075431_100912977 3300006847 Bacteria 847
107 Ga0075433_10265715 3300006852 Unclassified 1521
108 Ga0075434_100230129 3300006871 Unclassified 1873
109 Ga0075434_100243811 3300006871 Bacteria 1817
110 Ga0075434_100269024 3300006871 Bacteria 1724
111 Ga0068865_100701108 3300006881 Unclassified 865
112 Ga0075436_100170865 3300006914 Bacteria 1535
113 Ga0097620_100015862 3300006931 Bacteria 7571
114 Ga0075435_100035478 3300007076 Bacteria 3958
115 Ga0111539_10051792 3300009094 Bacteria 4888
116 Ga0111539_10282290 3300009094 Bacteria 1932
117 Ga0111539_10412074 3300009094 Bacteria 1574
118 Ga0105245_10005009 3300009098 Bacteria 11643
119 Ga0105245_10202176 3300009098 Viruses 1908
120 Ga0105245_10285131 3300009098 Bacteria 1616
121 Ga0105245_10424604 3300009098 Bacteria 1333
122 Ga0105245_10696571 3300009098 Unclassified 1049
123 Ga0105245_10696960 3300009098 Bacteria 1048
124 Ga0114129_10117350 3300009147 Bacteria 3667
125 Ga0114129_11270147 3300009147 Bacteria 914
126 Ga0105243_10014145 3300009148 Bacteria 6036
127 Ga0105243_10029882 3300009148 Bacteria 4193
128 Ga0105243_10247655 3300009148 Bacteria 1589
129 Ga0105241_10465525 3300009174 Bacteria 1121
130 Ga0105242_10003350 3300009176 Bacteria 12464
131 Ga0105242_10575935 3300009176 Bacteria 1083
132 Ga0105248_10036786 3300009177 Bacteria 5475
133 Ga0105248_10690423 3300009177 Unclassified 1152
134 Ga0105248_11224566 3300009177 Bacteria 849
135 Ga0105249_10032056 3300009553 Bacteria 4753
136 Ga0105249_10050048 3300009553 Bacteria 3810
137 Ga0105239_10011750 3300010375 Bacteria 9774
138 Ga0105239_10216036 3300010375 Viruses 2150
139 Ga0105239_10267930 3300010375 Unclassified 1920
140 Ga0105246_10110634 3300011119 Bacteria 2018
141 Ga0157338_1002800 3300012515 Bacteria 1399
142 Ga0157369_10217270 3300013105 Bacteria 2002
143 Ga0157374_10005632 3300013296 Bacteria 10556
144 Ga0157378_10510108 3300013297 Unclassified 1203
145 Ga0163162_10015512 3300013306 Bacteria 7446
146 Ga0163162_10067238 3300013306 Bacteria 3634
147 Ga0163162_10122007 3300013306 Bacteria 2711
148 Ga0157375_10011961 3300013308 Bacteria 7683
149 Ga0157375_10108437 3300013308 Bacteria 2871
150 Ga0163163_10016823 3300014325 Bacteria 6807
151 Ga0157380_10059783 3300014326 Bacteria 3043
152 Ga0157380_10544389 3300014326 Bacteria 1137
153 Ga0157377_10000879 3300014745 Bacteria 12505
154 Ga0157377_10098562 3300014745 Unclassified 1737
155 Ga0157379_10037839 3300014968 Bacteria 4303
156 Ga0157376_10301856 3300014969 Unclassified 1516
157 Ga0163161_10166064 3300017792 Bacteria 1685
158 Ga0163161_10677881 3300017792 Viruses 856
159 Ga0207653_10041887 3300025885 Bacteria 1505
160 Ga0207692_10010949 3300025898 Bacteria 3840
161 Ga0207688_10102497 3300025901 Bacteria 1654
162 Ga0207647_10025023 3300025904 Bacteria 3930
163 Ga0207699_10044119 3300025906 Bacteria 2594
164 Ga0207684_10014957 3300025910 Bacteria 6679
165 Ga0207684_10072573 3300025910 Bacteria 2923
166 Ga0207707_10041059 3300025912 Archaea 4039
167 Ga0207693_10000468 3300025915 Bacteria 36863
168 Ga0207693_10083504 3300025915 Bacteria 2502
169 Ga0207693_10205289 3300025915 Bacteria 1549
170 Ga0207660_10024727 3300025917 Bacteria 4069
171 Ga0207657_10044021 3300025919 Bacteria 3927
172 Ga0207652_10069547 3300025921 Bacteria 3056
173 Ga0207652_10361843 3300025921 Bacteria 1309
174 Ga0207646_10002982 3300025922 Bacteria 19556
175 Ga0207646_10016098 3300025922 Bacteria 7027
176 Ga0207646_10860400 3300025922 Unclassified 805
177 Ga0207694_10438445 3300025924 Bacteria 1090
178 Ga0207687_10040446 3300025927 Bacteria 3196
179 Ga0207687_10046130 3300025927 Bacteria 3016
180 Ga0207687_10069555 3300025927 Bacteria 2511
181 Ga0207687_10142172 3300025927 Bacteria 1822
182 Ga0207687_10387942 3300025927 Unclassified 1146
183 Ga0207700_10268071 3300025928 Bacteria 1465
184 Ga0207690_10109220 3300025932 Bacteria 1989
185 Ga0207706_10007736 3300025933 Bacteria 9920
186 Ga0207706_10097349 3300025933 Bacteria 2588
187 Ga0207686_10002592 3300025934 Bacteria 9812
188 Ga0207686_10174445 3300025934 Bacteria 1519
189 Ga0207709_10024298 3300025935 Bacteria 3459
190 Ga0207709_10035103 3300025935 Bacteria 2962
191 Ga0207670_10014689 3300025936 Bacteria 4656
192 Ga0207669_10037081 3300025937 Bacteria 2793
193 Ga0207704_10059138 3300025938 Bacteria 2364
194 Ga0207704_10690138 3300025938 Bacteria 844
195 Ga0207665_10138693 3300025939 Unclassified 1732
196 Ga0207691_10004591 3300025940 Bacteria 13375
197 Ga0207711_10251408 3300025941 Unclassified 1623
198 Ga0207689_10540707 3300025942 Unclassified 978
199 Ga0207667_10174860 3300025949 Bacteria 2206
200 Ga0207667_10326228 3300025949 Viruses 1568
201 Ga0207651_10110864 3300025960 Bacteria 2060
202 Ga0207651_10228523 3300025960 Bacteria 1509
203 Ga0207712_10018877 3300025961 Bacteria 4497
204 Ga0207712_10038955 3300025961 Bacteria 3253
205 Ga0207668_10005999 3300025972 Bacteria 7161
206 Ga0207668_10072368 3300025972 Bacteria 2466
207 Ga0207677_10069095 3300026023 Archaea 2483
208 Ga0207677_10101865 3300026023 Bacteria 2115
209 Ga0207677_10275839 3300026023 Unclassified 1378
210 Ga0207677_10410109 3300026023 Bacteria 1151
211 Ga0207639_10014247 3300026041 Bacteria 5585
212 Ga0207639_10574847 3300026041 Bacteria 1037
213 Ga0207708_10013744 3300026075 Bacteria 6049
214 Ga0207708_10579359 3300026075 Bacteria 949
215 Ga0207702_10122973 3300026078 Bacteria 2325
216 Ga0207641_10655709 3300026088 Bacteria 1031
217 Ga0207648_10003561 3300026089 Bacteria 16283
218 Ga0207648_10609550 3300026089 Unclassified 1007
219 Ga0207675_100000907 3300026118 Bacteria 29583
220 Ga0207675_100000929 3300026118 Bacteria 29254
221 Ga0207675_100035822 3300026118 Bacteria 4629
222 Ga0207683_10009539 3300026121 Bacteria 8272
223 Ga0207698_10267731 3300026142 Bacteria 1573
224 Ga0207428_10207458 3300027907 Unclassified 1473
225 Ga0268264_10057748 3300028381 Bacteria 3246
226 Ga0307409_100040027 3300031995 Bacteria 3485
227 Ga0307415_100128348 3300032126 Bacteria 1915
228 Ga0373945_0006147 3300035116 Bacteria 3862
229 Ga0373925_0209659 3300037068 Bacteria 1552
230 Ga0395899_0000862 3300037312 Bacteria 28881
231 Ga0395899_0004110 3300037312 Bacteria 11460
232 Ga0395899_0007082 3300037312 Bacteria 8680
233 Ga0395899_0018252 3300037312 Bacteria 5336
234 Ga0395899_0027929 3300037312 Bacteria 4250
235 Ga0395899_0039155 3300037312 Bacteria 3550
236 Ga0395899_0070068 3300037312 Bacteria 2566
237 Ga0395899_0087399 3300037312 Bacteria 2263
238 Ga0395899_0094456 3300037312 Bacteria 2164
239 Ga0395899_0096671 3300037312 Bacteria 2135
240 Ga0395899_0235759 3300037312 Bacteria 1261
241 Ga0395900_0000528 3300037418 Bacteria 53945
242 Ga0395900_0001266 3300037418 Bacteria 30887
243 Ga0395900_0003881 3300037418 Bacteria 15977
244 Ga0395900_0005059 3300037418 Bacteria 13833
245 Ga0395900_0045796 3300037418 Bacteria 4505
246 Ga0395900_0055171 3300037418 Archaea 4091
247 Ga0395900_0068564 3300037418 Bacteria 3645
248 Ga0395900_0083588 3300037418 Bacteria 3280
249 Ga0395900_0179811 3300037418 Bacteria 2150
250 Ga0395900_0201256 3300037418 Bacteria 2015
251 Ga0395900_0223378 3300037418 Bacteria 1897
252 Ga0395900_0437565 3300037418 Bacteria 1266
253 Ga0395900_0752908 3300037418 Unclassified 904
254 Ga0395898_0003303 3300037466 Bacteria 18113
255 Ga0395898_0005448 3300037466 Bacteria 13753
256 Ga0395898_0008177 3300037466 Bacteria 11073
257 Ga0395898_0008250 3300037466 Bacteria 11015
258 Ga0395898_0016481 3300037466 Bacteria 7558
259 Ga0395898_0018085 3300037466 Bacteria 7191
260 Ga0395898_0095009 3300037466 Bacteria 2864
261 Ga0395898_0101084 3300037466 Unclassified 2769
262 Ga0395898_0123633 3300037466 Bacteria 2479
263 Ga0395898_0131445 3300037466 Bacteria 2397
264 Ga0395898_0140548 3300037466 Unclassified 2311
265 Ga0395898_0201823 3300037466 Bacteria 1898
266 Ga0395898_0223448 3300037466 Bacteria 1796
267 Ga0395898_0245746 3300037466 Bacteria 1706
268 Ga0395898_0266338 3300037466 Bacteria 1634
269 Ga0395898_0279307 3300037466 Bacteria 1593
270 Ga0395898_0477220 3300037466 Bacteria 1187
271 Ga0395905_0001388 3300037471 Bacteria 29372
272 Ga0395905_0001564 3300037471 Bacteria 27335
273 Ga0395905_0006871 3300037471 Bacteria 11379
274 Ga0395905_0012676 3300037471 Bacteria 8110
275 Ga0395905_0022508 3300037471 Bacteria 5961
276 Ga0395905_0024141 3300037471 Bacteria 5738
277 Ga0395905_0066158 3300037471 Bacteria 3384
278 Ga0395905_0082094 3300037471 Bacteria 3020
279 Ga0395905_0083203 3300037471 Bacteria 2998
280 Ga0395905_0089722 3300037471 Bacteria 2881
281 Ga0395905_0106963 3300037471 Bacteria 2626
282 Ga0395905_0179792 3300037471 Bacteria 1986
283 Ga0395905_0364415 3300037471 Bacteria 1338
284 Ga0395905_0387257 3300037471 Unclassified 1292
285 Ga0395905_0505907 3300037471 Bacteria 1108
286 Ga0395901_0001886 3300038443 Bacteria 21635
287 Ga0395901_0002270 3300038443 Bacteria 19615
288 Ga0395901_0002908 3300038443 Bacteria 17295
289 Ga0395901_0003745 3300038443 Bacteria 15320
290 Ga0395901_0004773 3300038443 Bacteria 13676
291 Ga0395901_0006515 3300038443 Bacteria 11811
292 Ga0395901_0016768 3300038443 Bacteria 7464
293 Ga0395901_0020287 3300038443 Bacteria 6803
294 Ga0395901_0042772 3300038443 Bacteria 4698
295 Ga0395901_0113841 3300038443 Bacteria 2841
296 Ga0395901_0126738 3300038443 Bacteria 2683
297 Ga0395901_0190871 3300038443 Bacteria 2148
298 Ga0395901_0661666 3300038443 Bacteria 1046
299 Ga0395901_0755923 3300038443 Bacteria 965
300 Ga0395901_0757482 3300038443 Unclassified 963
301 Ga0439463_057916 3300042016 Bacteria 990
302 Ga0439460_0112886 3300042461 Bacteria 883
303 Ga0466964_0010356 3300044706 Bacteria 3517
304 Ga0466960_0090735 3300044901 Bacteria 1557
305 Ga0451576_0381139 3300045051 Bacteria 1478
306 Ga0495603_0345023 3300046455 Unclassified 854
307 Ga0495580_0290838 3300046472 Unclassified 1114
308 Ga0495605_0032486 3300046474 Bacteria 2657
309 Ga0495639_0070634 3300046475 Bacteria 1613
310 Ga0495662_0249411 3300046476 Archaea 874
311 Ga0495631_0099737 3300046518 Unclassified 1250
312 Ga0495666_0047519 3300046526 Bacteria 2067
313 Ga0495642_0090954 3300046528 Unclassified 1292
314 Ga0495609_0051021 3300046538 Bacteria 1843
315 Ga0495656_0105445 3300046615 Bacteria 1310
316 Ga0495668_0095133 3300046616 Bacteria 1631
317 Ga0495661_0254944 3300046665 Unclassified 894
318 Ga0495647_0211420 3300046681 Unclassified 853
319 Ga0495624_0070027 3300046690 Bacteria 2184
320 Ga0495670_0060120 3300046691 Bacteria 1909
321 Ga0495670_0294839 3300046691 Bacteria 869
322 Ga0495581_0000417 3300047315 Bacteria 21522
323 Ga0495676_0036472 3300047321 Bacteria 4105
324 Ga0495683_0217413 3300047323 Unclassified 854
325 Ga0495677_0039796 3300047445 Bacteria 1719
326 Ga0496100_0033276 3300048903 Bacteria 3224
327 Ga0496100_0458131 3300048903 Unclassified 978
328 Ga0496101_0024022 3300048904 Bacteria 4217
329 Ga0496101_0026024 3300048904 Bacteria 4065
330 Ga0496101_0026048 3300048904 Bacteria 4063
331 Ga0496101_0529912 3300048904 Bacteria 931
332 Ga0496102_0026091 3300048905 Bacteria 5208
333 Ga0496102_0494076 3300048905 Bacteria 1145
334 Ga0496103_0006813 3300048906 Bacteria 6820
335 Ga0496104_0025755 3300048907 Bacteria 5424
336 Ga0496104_0035761 3300048907 Bacteria 4639
337 Ga0496104_0092364 3300048907 Bacteria 2894
338 Ga0496104_0186544 3300048907 Bacteria 1985
339 Ga0496104_0228394 3300048907 Bacteria 1773
340 Ga0496105_0067870 3300048908 Bacteria 2945
341 Ga0496105_0546389 3300048908 Unclassified 904
342 Ga0496106_0017688 3300048909 Bacteria 5271
343 Ga0496106_0272534 3300048909 Bacteria 1355
344 Ga0496107_0009086 3300048910 Bacteria 6889
345 Ga0496107_0411456 3300048910 Unclassified 1006
346 Ga0496108_0005018 3300048911 Bacteria 10693
347 Ga0496108_0024897 3300048911 Bacteria 4929
348 Ga0496108_0051389 3300048911 Bacteria 3453
349 Ga0496108_0052866 3300048911 Bacteria 3405
350 Ga0496108_0366169 3300048911 Bacteria 1258
351 Ga0496109_0000534 3300048912 Bacteria 32226
352 Ga0496109_0001239 3300048912 Bacteria 21163
353 Ga0496109_0083785 3300048912 Bacteria 2940
354 Ga0496109_0995389 3300048912 Unclassified 776
355 Ga0496110_0000277 3300048913 Bacteria 33321
356 Ga0496110_0016945 3300048913 Bacteria 6089
357 Ga0496110_0021631 3300048913 Bacteria 5450
358 Ga0496110_0109565 3300048913 Bacteria 2480
359 Ga0496110_0126689 3300048913 Bacteria 2304
360 Ga0496110_0343204 3300048913 Bacteria 1360
361 Ga0496111_0002274 3300048914 Bacteria 11542
362 Ga0496111_0003959 3300048914 Bacteria 9293
363 Ga0496111_0010447 3300048914 Bacteria 6230
364 Ga0496111_0047108 3300048914 Bacteria 3104
365 Ga0496111_0153628 3300048914 Bacteria 1708
366 Ga0496112_0000434 3300048915 Bacteria 27667
367 Ga0496112_0000670 3300048915 Bacteria 23864
368 Ga0496112_0133549 3300048915 Bacteria 2452
369 Ga0496112_0600123 3300048915 Bacteria 1033
370 Ga0496113_0001165 3300048916 Bacteria 14346
371 Ga0496113_0025415 3300048916 Bacteria 4221
372 Ga0496113_0222798 3300048916 Unclassified 1503
373 Ga0496113_0853381 3300048916 Bacteria 722
374 Ga0496114_0008013 3300048917 Bacteria 8359
375 Ga0496114_0023835 3300048917 Bacteria 4994
376 Ga0496115_0022859 3300048918 Bacteria 4849
377 Ga0496115_0152198 3300048918 Bacteria 1910
378 Ga0501070_0016304 3300049586 Bacteria 6241
379 Ga0501075_0095749 3300049591 Bacteria 2253
380 Ga0501079_0386982 3300049741 Bacteria 1097
381 nmdc:mga00v17_96299_c1 3300050491 Bacteria 1864
382 nmdc:mga0yw44_43321_c1 3300050492 Bacteria 2687
383 nmdc:mga06z11_299264_c1 3300050494 Bacteria 956
384 nmdc:mga05p37_120107_c1 3300050507 Bacteria 3229
385 nmdc:mga05p37_260754_c1 3300050507 Bacteria 2074
386 nmdc:mga09592_675335_c1 3300050508 Bacteria 881
387 nmdc:mga0qj67_434733_c1 3300050509 Bacteria 1058
388 nmdc:mga06r32_339997_c1 3300050510 Bacteria 1486
389 nmdc:mga08y16_381771_c1 3300050511 Bacteria 1444
390 nmdc:mga08y16_62124_c1 3300050511 Bacteria 3901
391 nmdc:mga0n895_275841_c1 3300050512 Unclassified 1705
392 nmdc:mga0n895_544911_c1 3300050512 Bacteria 1166
393 nmdc:mga08x19_328441_c1 3300050514 Bacteria 1065
394 nmdc:mga0a205_280113_c1 3300050515 Bacteria 1543
395 Ga0530510_0030698 3300061734 Bacteria 3861
396 Ga0530510_0068628 3300061734 Bacteria 2572
397 nmdc:mga08y16_777683_c1
398 Ga0070676_10293969
399 Ga0070683_100005108
400 Ga0070683_100084560
401 Ga0070690_100252515
402 Ga0068869_100145030
403 Ga0070680_100034085
404 Ga0070680_100060201
405 Ga0070682_100010991
406 Ga0070682_100856774
407 Ga0068868_100087966
408 Ga0070689_100207567
409 Ga0070689_100267265
410 Ga0070691_10021412
411 Ga0070692_10008356
412 Ga0070668_100018621
413 Ga0070668_100095903
414 Ga0070669_100891977
415 Ga0070675_100057647
416 Ga0070674_100002922
417 Ga0070673_100390283
418 Ga0070688_100008780
419 Ga0070659_100048212
420 Ga0070667_100101535
421 Ga0070709_10044462
422 Ga0070714_100173545
423 Ga0070713_100308710
424 Ga0070710_10006595
425 Ga0070701_10016823
426 Ga0070711_100139996
427 Ga0070705_100252485
428 Ga0070705_100301391
429 Ga0070705_100577395
430 Ga0070708_100102405
431 Ga0070708_100110933
432 Ga0070708_100149367
433 Ga0070663_100010832
434 Ga0070662_100118718
435 Ga0070681_10018428
436 Ga0068867_100152104
437 Ga0070685_10003003
438 Ga0070706_100016309
439 Ga0070706_100038403
440 Ga0070707_100002679
441 Ga0070707_100006145
442 Ga0070707_100190902
443 Ga0070698_100008530
444 Ga0070698_100028053
445 Ga0070698_100030472
446 Ga0070698_100077255
447 Ga0070699_100016142
448 Ga0070699_100278846
449 Ga0070679_100029761
450 Ga0070679_100685152
451 Ga0070684_100202550
452 Ga0070684_100284921
453 Ga0070697_100081050
454 Ga0070697_100143922
455 Ga0070697_100296350
456 Ga0068853_100649314
457 Ga0070686_100002266
458 Ga0070686_100062823
459 Ga0070695_100047867
460 Ga0070695_100219170
461 Ga0070696_100004361
462 Ga0070696_100081807
463 Ga0070696_100244858
464 Ga0070665_100032889
465 Ga0070704_100289416
466 Ga0070704_100355415
467 Ga0068855_100022103
468 Ga0068855_100137157
469 Ga0068855_100236294
470 Ga0068854_100108420
471 Ga0068856_100007363
472 Ga0068856_100064498
473 Ga0070702_100000663
474 Ga0070702_100035022
475 Ga0070702_100268473
476 Ga0068852_100012004
477 Ga0068859_100015862
478 Ga0068864_100750824
479 Ga0068866_10001111
480 Ga0068866_10038588
481 Ga0068861_100005826
482 Ga0068861_100038847
483 Ga0068861_100067186
484 Ga0068863_100139385
485 Ga0068863_100401213
486 Ga0068858_101134645
487 Ga0081455_10032199
488 Ga0081455_10219715
489 Ga0081538_10000218
490 Ga0081540_1007144
491 Ga0081540_1076021
492 Ga0081539_10016512
493 Ga0081539_10017867
494 Ga0075365_10008523
495 Ga0097621_100006395
496 Ga0068871_100018197
497 Ga0075428_100017878
498 Ga0075428_100149521
499 Ga0075428_100672690
500 Ga0075428_100735563
501 Ga0075431_100845771
502 Ga0075431_100912977
503 Ga0075433_10265715
504 Ga0075434_100230129
505 Ga0075434_100243811
506 Ga0075434_100269024
507 Ga0068865_100701108
508 Ga0075436_100170865
509 Ga0097620_100015862
510 Ga0075435_100035478
511 Ga0111539_10051792
512 Ga0111539_10282290
513 Ga0111539_10412074
514 Ga0105245_10005009
515 Ga0105245_10202176
516 Ga0105245_10285131
517 Ga0105245_10424604
518 Ga0105245_10696571
519 Ga0105245_10696960
520 Ga0114129_10117350
521 Ga0114129_11270147
522 Ga0105243_10014145
523 Ga0105243_10029882
524 Ga0105243_10247655
525 Ga0105241_10465525
526 Ga0105242_10003350
527 Ga0105242_10575935
528 Ga0105248_10036786
529 Ga0105248_10690423
530 Ga0105248_11224566
531 Ga0105249_10032056
532 Ga0105249_10050048
533 Ga0105239_10011750
534 Ga0105239_10216036
535 Ga0105239_10267930
536 Ga0105246_10110634
537 Ga0157338_1002800
538 Ga0157369_10217270
539 Ga0157374_10005632
540 Ga0157378_10510108
541 Ga0163162_10015512
542 Ga0163162_10067238
543 Ga0163162_10122007
544 Ga0157375_10011961
545 Ga0157375_10108437
546 Ga0163163_10016823
547 Ga0157380_10059783
548 Ga0157380_10544389
549 Ga0157377_10000879
550 Ga0157377_10098562
551 Ga0157379_10037839
552 Ga0157376_10301856
553 Ga0163161_10166064
554 Ga0163161_10677881
555 Ga0207653_10041887
556 Ga0207692_10010949
557 Ga0207688_10102497
558 Ga0207647_10025023
559 Ga0207699_10044119
560 Ga0207684_10014957
561 Ga0207684_10072573
562 Ga0207707_10041059
563 Ga0207693_10000468
564 Ga0207693_10083504
565 Ga0207693_10205289
566 Ga0207660_10024727
567 Ga0207657_10044021
568 Ga0207652_10069547
569 Ga0207652_10361843
570 Ga0207646_10002982
571 Ga0207646_10016098
572 Ga0207646_10860400
573 Ga0207694_10438445
574 Ga0207687_10040446
575 Ga0207687_10046130
576 Ga0207687_10069555
577 Ga0207687_10142172
578 Ga0207687_10387942
579 Ga0207700_10268071
580 Ga0207690_10109220
581 Ga0207706_10007736
582 Ga0207706_10097349
583 Ga0207686_10002592
584 Ga0207686_10174445
585 Ga0207709_10024298
586 Ga0207709_10035103
587 Ga0207670_10014689
588 Ga0207669_10037081
589 Ga0207704_10059138
590 Ga0207704_10690138
591 Ga0207665_10138693
592 Ga0207691_10004591
593 Ga0207711_10251408
594 Ga0207689_10540707
595 Ga0207667_10174860
596 Ga0207667_10326228
597 Ga0207651_10110864
598 Ga0207651_10228523
599 Ga0207712_10018877
600 Ga0207712_10038955
601 Ga0207668_10005999
602 Ga0207668_10072368
603 Ga0207677_10069095
604 Ga0207677_10101865
605 Ga0207677_10275839
606 Ga0207677_10410109
607 Ga0207639_10014247
608 Ga0207639_10574847
609 Ga0207708_10013744
610 Ga0207708_10579359
611 Ga0207702_10122973
612 Ga0207641_10655709
613 Ga0207648_10003561
614 Ga0207648_10609550
615 Ga0207675_100000907
616 Ga0207675_100000929
617 Ga0207675_100035822
618 Ga0207683_10009539
619 Ga0207698_10267731
620 Ga0207428_10207458
621 Ga0268264_10057748
622 Ga0307409_100040027
623 Ga0307415_100128348
624 Ga0373945_0006147
625 Ga0373925_0209659
626 Ga0395899_0000862
627 Ga0395899_0004110
628 Ga0395899_0007082
629 Ga0395899_0018252
630 Ga0395899_0027929
631 Ga0395899_0039155
632 Ga0395899_0070068
633 Ga0395899_0087399
634 Ga0395899_0094456
635 Ga0395899_0096671
636 Ga0395899_0235759
637 Ga0395900_0000528
638 Ga0395900_0001266
639 Ga0395900_0003881
640 Ga0395900_0005059
641 Ga0395900_0045796
642 Ga0395900_0055171
643 Ga0395900_0068564
644 Ga0395900_0083588
645 Ga0395900_0179811
646 Ga0395900_0201256
647 Ga0395900_0223378
648 Ga0395900_0437565
649 Ga0395900_0752908
650 Ga0395898_0003303
651 Ga0395898_0005448
652 Ga0395898_0008177
653 Ga0395898_0008250
654 Ga0395898_0016481
655 Ga0395898_0018085
656 Ga0395898_0095009
657 Ga0395898_0101084
658 Ga0395898_0123633
659 Ga0395898_0131445
660 Ga0395898_0140548
661 Ga0395898_0201823
662 Ga0395898_0223448
663 Ga0395898_0245746
664 Ga0395898_0266338
665 Ga0395898_0279307
666 Ga0395898_0477220
667 Ga0395905_0001388
668 Ga0395905_0001564
669 Ga0395905_0006871
670 Ga0395905_0012676
671 Ga0395905_0022508
672 Ga0395905_0024141
673 Ga0395905_0066158
674 Ga0395905_0082094
675 Ga0395905_0083203
676 Ga0395905_0089722
677 Ga0395905_0106963
678 Ga0395905_0179792
679 Ga0395905_0364415
680 Ga0395905_0387257
681 Ga0395905_0505907
682 Ga0395901_0001886
683 Ga0395901_0002270
684 Ga0395901_0002908
685 Ga0395901_0003745
686 Ga0395901_0004773
687 Ga0395901_0006515
688 Ga0395901_0016768
689 Ga0395901_0020287
690 Ga0395901_0042772
691 Ga0395901_0113841
692 Ga0395901_0126738
693 Ga0395901_0190871
694 Ga0395901_0661666
695 Ga0395901_0755923
696 Ga0395901_0757482
697 Ga0439463_057916
698 Ga0439460_0112886
699 Ga0466964_0010356
700 Ga0466960_0090735
701 Ga0451576_0381139
702 Ga0495603_0345023
703 Ga0495580_0290838
704 Ga0495605_0032486
705 Ga0495639_0070634
706 Ga0495662_0249411
707 Ga0495631_0099737
708 Ga0495666_0047519
709 Ga0495642_0090954
710 Ga0495609_0051021
711 Ga0495656_0105445
712 Ga0495668_0095133
713 Ga0495661_0254944
714 Ga0495647_0211420
715 Ga0495624_0070027
716 Ga0495670_0060120
717 Ga0495670_0294839
718 Ga0495581_0000417
719 Ga0495676_0036472
720 Ga0495683_0217413
721 Ga0495677_0039796
722 Ga0496100_0033276
723 Ga0496100_0458131
724 Ga0496101_0024022
725 Ga0496101_0026024
726 Ga0496101_0026048
727 Ga0496101_0529912
728 Ga0496102_0026091
729 Ga0496102_0494076
730 Ga0496103_0006813
731 Ga0496104_0025755
732 Ga0496104_0035761
733 Ga0496104_0092364
734 Ga0496104_0186544
735 Ga0496104_0228394
736 Ga0496105_0067870
737 Ga0496105_0546389
738 Ga0496106_0017688
739 Ga0496106_0272534
740 Ga0496107_0009086
741 Ga0496107_0411456
742 Ga0496108_0005018
743 Ga0496108_0024897
744 Ga0496108_0051389
745 Ga0496108_0052866
746 Ga0496108_0366169
747 Ga0496109_0000534
748 Ga0496109_0001239
749 Ga0496109_0083785
750 Ga0496109_0995389
751 Ga0496110_0000277
752 Ga0496110_0016945
753 Ga0496110_0021631
754 Ga0496110_0109565
755 Ga0496110_0126689
756 Ga0496110_0343204
757 Ga0496111_0002274
758 Ga0496111_0003959
759 Ga0496111_0010447
760 Ga0496111_0047108
761 Ga0496111_0153628
762 Ga0496112_0000434
763 Ga0496112_0000670
764 Ga0496112_0133549
765 Ga0496112_0600123
766 Ga0496113_0001165
767 Ga0496113_0025415
768 Ga0496113_0222798
769 Ga0496113_0853381
770 Ga0496114_0008013
771 Ga0496114_0023835
772 Ga0496115_0022859
773 Ga0496115_0152198
774 Ga0501070_0016304
775 Ga0501075_0095749
776 Ga0501079_0386982
777 nmdc:mga00v17_96299_c1
778 nmdc:mga0yw44_43321_c1
779 nmdc:mga06z11_299264_c1
780 nmdc:mga05p37_120107_c1
781 nmdc:mga05p37_260754_c1
782 nmdc:mga09592_675335_c1
783 nmdc:mga0qj67_434733_c1
784 nmdc:mga06r32_339997_c1
785 nmdc:mga08y16_381771_c1
786 nmdc:mga08y16_62124_c1
787 nmdc:mga0n895_275841_c1
788 nmdc:mga0n895_544911_c1
789 nmdc:mga08x19_328441_c1
790 nmdc:mga0a205_280113_c1
791 Ga0530510_0030698
792 Ga0530510_0068628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

33

216

0.75

PF00149

Metallophos

Calcineurin-like phosphoesterase

33

187

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8401 2 221
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8231 2 221
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8051 2 222
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8031 2 222
3rqz-assembly3.cif.gz_C crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8013 2 222
ID Description Score Start End Superfamily
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8345 1 222 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8241 1 222 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8031 2 222 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7902 2 222 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7876 1 222 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A538KYL9-F1-model_v4 Metallophosphoesterase family protein 0.9909 1 224 GO:0005737
GO:0016791
AF-A0A538KYL9-F1-model_v4 Metallophosphoesterase family protein 0.9865 1 224 GO:0005737
GO:0016791
AF-A0A7W1KBG5-F1-model_v4 Metallophosphoesterase 0.9668 1 66 GO:0016787
AF-H0E429-F1-model_v4 Metallophosphoesterase 0.957 1 223 GO:0005737
GO:0016791
AF-A0A7W1GMF6-F1-model_v4 Metallophosphoesterase family protein 0.9527 87 224

Map