F433558

General Info

Members Datasets Scaffolds Average Seq Length
396 258 388 154

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0019359|Ga0373936_0019359_1348_1860
Length 146
Sequence VSGAAKYYGKYRGTVVQNVDPEQRGRIQAMVPDVTNVVPGSWAVPCVPLAGKLMGTYLVPQIGAGVWIEYEQGDPDYPIWTGGFWGVGEVPALALTGNPASPSIVLQTGLQNSITLSDVPGPTGGIMLKSSTGAMILVNDVALTVL

Samples

Sample ID Description Type Environment
1 2734482264 Dyella sp. AD052 Isolate Unclassified
2 2738543009 Luteibacter sp. OK325 Isolate Unclassified
3 2739367700 Dyella sp. YR388 Isolate Unclassified
4 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
5 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
6 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
7 2928963466 Dyella japonica 1073 Isolate Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
175 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
176 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
177 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
182 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
187 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 1.26
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000707 3300002737 Bacteria 23218
2 rootH2_10030489 3300003320 Bacteria 4997
3 rootH2_10271950 3300003320 Unclassified 1036
4 rootL2_10054932 3300003322 Bacteria 5990
5 rootL2_10257985 3300003322 Unclassified 2208
6 rootH1_10284792 3300003323 Bacteria 4158
7 rootH1_10358618 3300003323 Bacteria 1720
8 Ga0055542_1000223 3300003762 Bacteria 68138
9 Ga0065165_1015936 3300005262 Bacteria 2841
10 Ga0065715_10549411 3300005293 Bacteria 709
11 Ga0065707_10089702 3300005295 Bacteria 4300
12 Ga0065707_10293949 3300005295 Bacteria 1019
13 Ga0070658_10188211 3300005327 Bacteria 1739
14 Ga0070683_100048561 3300005329 Bacteria 3924
15 Ga0070690_100045624 3300005330 Bacteria 2785
16 Ga0070670_100018852 3300005331 Bacteria 5917
17 Ga0070670_100029904 3300005331 Bacteria 4691
18 Ga0070670_100417635 3300005331 Bacteria 1186
19 Ga0070666_10131270 3300005335 Bacteria 1741
20 Ga0070689_100073803 3300005340 Bacteria 2669
21 Ga0070689_100726613 3300005340 Bacteria 869
22 Ga0070689_100901627 3300005340 Unclassified 782
23 Ga0070687_100178839 3300005343 Bacteria 1269
24 Ga0070687_100388576 3300005343 Unclassified 911
25 Ga0070668_100683215 3300005347 Unclassified 904
26 Ga0070669_100465239 3300005353 Bacteria 1044
27 Ga0070669_100641464 3300005353 Bacteria 893
28 Ga0070675_100435610 3300005354 Bacteria 1174
29 Ga0070674_100085475 3300005356 Bacteria 2264
30 Ga0070674_100771171 3300005356 Bacteria 828
31 Ga0070673_100579890 3300005364 Unclassified 1021
32 Ga0070667_100291114 3300005367 Bacteria 1468
33 Ga0070667_100707051 3300005367 Bacteria 933
34 Ga0070703_10331818 3300005406 Bacteria 643
35 Ga0070709_10013545 3300005434 Unclassified 4589
36 Ga0070714_100034209 3300005435 Unclassified 4254
37 Ga0070713_100016390 3300005436 Bacteria 5571
38 Ga0070713_100979776 3300005436 Bacteria 815
39 Ga0070710_10072397 3300005437 Unclassified 1990
40 Ga0070701_10048753 3300005438 Bacteria 2187
41 Ga0070701_10188807 3300005438 Unclassified 1211
42 Ga0070711_100059933 3300005439 Unclassified 2644
43 Ga0070711_100235256 3300005439 Bacteria 1430
44 Ga0070705_100109133 3300005440 Bacteria 1764
45 Ga0070705_101213671 3300005440 Bacteria 622
46 Ga0070700_100029553 3300005441 Bacteria 3269
47 Ga0070694_100073264 3300005444 Bacteria 2365
48 Ga0070694_100297183 3300005444 Bacteria 1236
49 Ga0070708_100000237 3300005445 Bacteria 40825
50 Ga0070708_100224138 3300005445 Unclassified 1764
51 Ga0070708_100823485 3300005445 Bacteria 872
52 Ga0070678_101102542 3300005456 Bacteria 733
53 Ga0068867_100836239 3300005459 Bacteria 824
54 Ga0070706_100001593 3300005467 Bacteria 23652
55 Ga0070707_100051028 3300005468 Bacteria 3965
56 Ga0070698_100001354 3300005471 Bacteria 27238
57 Ga0070698_100047475 3300005471 Bacteria 4389
58 Ga0070698_100220755 3300005471 Bacteria 1829
59 Ga0070699_100101623 3300005518 Bacteria 2521
60 Ga0070699_100171861 3300005518 Unclassified 1920
61 Ga0070699_101002069 3300005518 Unclassified 766
62 Ga0070679_100294754 3300005530 Bacteria 1573
63 Ga0070679_100747712 3300005530 Bacteria 921
64 Ga0070684_100100996 3300005535 Bacteria 2577
65 Ga0070684_100177314 3300005535 Bacteria 1937
66 Ga0070697_100000140 3300005536 Bacteria 58765
67 Ga0070697_100137905 3300005536 Bacteria 2049
68 Ga0070697_100886825 3300005536 Bacteria 791
69 Ga0070672_100077430 3300005543 Unclassified 2660
70 Ga0070672_100294219 3300005543 Bacteria 1375
71 Ga0070672_100335661 3300005543 Unclassified 1286
72 Ga0070686_100312496 3300005544 Bacteria 1169
73 Ga0070696_100325462 3300005546 Bacteria 1184
74 Ga0070696_100588739 3300005546 Bacteria 896
75 Ga0070693_100389172 3300005547 Bacteria 964
76 Ga0070665_100065612 3300005548 Bacteria 3641
77 Ga0070704_100017412 3300005549 Unclassified 4570
78 Ga0070704_101111319 3300005549 Bacteria 718
79 Ga0070704_101354321 3300005549 Unclassified 652
80 Ga0070704_101514600 3300005549 Unclassified 617
81 Ga0068855_100248334 3300005563 Bacteria 1985
82 Ga0068857_100312327 3300005577 Unclassified 1450
83 Ga0068857_100717005 3300005577 Bacteria 951
84 Ga0068857_101142520 3300005577 Unclassified 753
85 Ga0070702_100007398 3300005615 Bacteria 5257
86 Ga0068852_100343737 3300005616 Bacteria 1455
87 Ga0068852_101067372 3300005616 Unclassified 827
88 Ga0068859_100011283 3300005617 Bacteria 8991
89 Ga0068859_100014042 3300005617 Bacteria 8031
90 Ga0068859_100288921 3300005617 Bacteria 1732
91 Ga0068859_100645746 3300005617 Bacteria 1150
92 Ga0068859_100823594 3300005617 Unclassified 1015
93 Ga0068864_100001094 3300005618 Bacteria 22718
94 Ga0068864_100228454 3300005618 Unclassified 1720
95 Ga0068864_100483361 3300005618 Bacteria 1189
96 Ga0068864_101058919 3300005618 Bacteria 806
97 Ga0068866_10073404 3300005718 Unclassified 1815
98 Ga0068861_100208124 3300005719 Bacteria 1646
99 Ga0068870_10001396 3300005840 Bacteria 9746
100 Ga0068863_100628449 3300005841 Bacteria 1064
101 Ga0068858_100028754 3300005842 Bacteria 5162
102 Ga0068858_100215509 3300005842 Bacteria 1817
103 Ga0068858_100667810 3300005842 Bacteria 1010
104 Ga0068862_100017498 3300005844 Bacteria 5970
105 Ga0068862_100052003 3300005844 Bacteria 3504
106 Ga0068862_100052522 3300005844 Unclassified 3487
107 Ga0068862_101154603 3300005844 Unclassified 771
108 Ga0081455_10585280 3300005937 Bacteria 731
109 Ga0070717_10011421 3300006028 Bacteria 6744
110 Ga0075363_100143876 3300006048 Bacteria 1344
111 Ga0075364_10002574 3300006051 Bacteria 10168
112 Ga0070715_10206381 3300006163 Unclassified 1001
113 Ga0070712_100006993 3300006175 Bacteria 7033
114 Ga0070712_100085384 3300006175 Bacteria 2298
115 Ga0070712_100411240 3300006175 Bacteria 1119
116 Ga0075362_10034526 3300006177 Bacteria 2205
117 Ga0075367_10005535 3300006178 Bacteria 6288
118 Ga0075366_10024811 3300006195 Bacteria 3497
119 Ga0075366_10041900 3300006195 Bacteria 2711
120 Ga0075370_10006811 3300006353 Bacteria 5777
121 Ga0068871_100538251 3300006358 Bacteria 1056
122 Ga0068871_100653644 3300006358 Bacteria 960
123 Ga0075428_101086883 3300006844 Bacteria 845
124 Ga0075428_101247231 3300006844 Bacteria 783
125 Ga0075430_100155918 3300006846 Bacteria 1901
126 Ga0075431_100007947 3300006847 Bacteria 10574
127 Ga0075431_100943583 3300006847 Bacteria 831
128 Ga0075433_10840810 3300006852 Bacteria 801
129 Ga0075434_100022420 3300006871 Bacteria 6151
130 Ga0075434_100216644 3300006871 Bacteria 1935
131 Ga0075436_100051161 3300006914 Viruses 2851
132 Ga0075436_100238498 3300006914 Bacteria 1293
133 Ga0097620_100011281 3300006931 Bacteria 8991
134 Ga0097620_100014042 3300006931 Bacteria 8031
135 Ga0097620_100288920 3300006931 Bacteria 1732
136 Ga0097620_100645793 3300006931 Bacteria 1150
137 Ga0097620_100823597 3300006931 Unclassified 1015
138 Ga0105240_10011296 3300009093 Bacteria 12444
139 Ga0111539_10385697 3300009094 Bacteria 1631
140 Ga0105247_10270729 3300009101 Bacteria 1168
141 Ga0105247_10534634 3300009101 Bacteria 859
142 Ga0105247_10629515 3300009101 Bacteria 799
143 Ga0114129_10143042 3300009147 Bacteria 3277
144 Ga0114129_10398585 3300009147 Bacteria 1814
145 Ga0114129_10560851 3300009147 Bacteria 1484
146 Ga0105243_10000996 3300009148 Bacteria 26244
147 Ga0105241_10084903 3300009174 Unclassified 2487
148 Ga0105241_10437883 3300009174 Bacteria 1154
149 Ga0105241_10582581 3300009174 Unclassified 1008
150 Ga0105242_10159973 3300009176 Bacteria 1970
151 Ga0105242_10598744 3300009176 Bacteria 1064
152 Ga0105242_10969697 3300009176 Bacteria 856
153 Ga0105248_10068677 3300009177 Bacteria 3979
154 Ga0105248_10138786 3300009177 Bacteria 2742
155 Ga0105248_10264924 3300009177 Unclassified 1934
156 Ga0105237_10001683 3300009545 Bacteria 28617
157 Ga0105237_10533964 3300009545 Bacteria 1180
158 Ga0105238_10015271 3300009551 Bacteria 7777
159 Ga0105238_10182361 3300009551 Bacteria 2076
160 Ga0105238_10265110 3300009551 Unclassified 1698
161 Ga0105249_10623536 3300009553 Bacteria 1134
162 Ga0105249_10806776 3300009553 Bacteria 1003
163 Ga0105249_11086978 3300009553 Bacteria 870
164 Ga0105239_10002819 3300010375 Bacteria 21741
165 Ga0105239_10771897 3300010375 Bacteria 1101
166 Ga0157370_10608548 3300013104 Bacteria 1000
167 Ga0157369_11084006 3300013105 Bacteria 819
168 Ga0157378_10000015 3300013297 Bacteria 143601
169 Ga0157378_10218687 3300013297 Bacteria 1810
170 Ga0163162_10726149 3300013306 Bacteria 1114
171 Ga0157372_10032933 3300013307 Bacteria 5688
172 Ga0157372_10034586 3300013307 Bacteria 5556
173 Ga0157375_10006043 3300013308 Bacteria 10558
174 Ga0157375_10061307 3300013308 Unclassified 3734
175 Ga0157375_10399048 3300013308 Bacteria 1542
176 Ga0157375_12503321 3300013308 Bacteria 616
177 Ga0163163_10115414 3300014325 Bacteria 2717
178 Ga0163163_10123336 3300014325 Bacteria 2626
179 Ga0163163_11004943 3300014325 Bacteria 897
180 Ga0157380_10091353 3300014326 Bacteria 2513
181 Ga0157380_10224968 3300014326 Bacteria 1681
182 Ga0157380_10288848 3300014326 Unclassified 1505
183 Ga0157380_11911779 3300014326 Unclassified 654
184 Ga0157377_10232439 3300014745 Bacteria 1186
185 Ga0157379_10271898 3300014968 Bacteria 1541
186 Ga0157379_10361718 3300014968 Bacteria 1330
187 Ga0157376_10043523 3300014969 Bacteria 3685
188 Ga0157376_10073169 3300014969 Bacteria 2918
189 Ga0157376_10076551 3300014969 Bacteria 2859
190 Ga0157376_12068755 3300014969 Bacteria 607
191 Ga0182007_10094635 3300015262 Bacteria 985
192 Ga0163161_10175644 3300017792 Bacteria 1640
193 Ga0163161_10587002 3300017792 Bacteria 917
194 Ga0163161_10628759 3300017792 Bacteria 888
195 Ga0207697_10249697 3300025315 Bacteria 785
196 Ga0207653_10183191 3300025885 Bacteria 784
197 Ga0207692_10010443 3300025898 Bacteria 3912
198 Ga0207692_10075734 3300025898 Unclassified 1786
199 Ga0207710_10057290 3300025900 Bacteria 1760
200 Ga0207688_10174778 3300025901 Bacteria 1278
201 Ga0207680_10320618 3300025903 Bacteria 1083
202 Ga0207685_10085093 3300025905 Bacteria 1318
203 Ga0207643_10015698 3300025908 Bacteria 4124
204 Ga0207684_10001536 3300025910 Bacteria 24717
205 Ga0207684_10030053 3300025910 Bacteria 4626
206 Ga0207684_10962999 3300025910 Bacteria 715
207 Ga0207684_11189982 3300025910 Bacteria 631
208 Ga0207707_10557188 3300025912 Bacteria 973
209 Ga0207695_10028305 3300025913 Bacteria 6219
210 Ga0207671_10006284 3300025914 Bacteria 10609
211 Ga0207693_10010700 3300025915 Bacteria 7447
212 Ga0207693_10171851 3300025915 Bacteria 1706
213 Ga0207693_10330506 3300025915 Bacteria 1193
214 Ga0207663_10041856 3300025916 Unclassified 2795
215 Ga0207662_10029724 3300025918 Bacteria 3168
216 Ga0207662_10238788 3300025918 Bacteria 1189
217 Ga0207652_10286648 3300025921 Bacteria 1486
218 Ga0207681_10132693 3300025923 Bacteria 1844
219 Ga0207681_10151146 3300025923 Unclassified 1740
220 Ga0207694_10083657 3300025924 Bacteria 2509
221 Ga0207650_10021490 3300025925 Bacteria 4560
222 Ga0207650_10035327 3300025925 Bacteria 3628
223 Ga0207659_10099258 3300025926 Bacteria 2192
224 Ga0207659_10113553 3300025926 Bacteria 2063
225 Ga0207659_10290068 3300025926 Bacteria 1340
226 Ga0207687_10196379 3300025927 Bacteria 1574
227 Ga0207700_10228090 3300025928 Unclassified 1582
228 Ga0207664_10197518 3300025929 Unclassified 1735
229 Ga0207644_10425222 3300025931 Unclassified 1089
230 Ga0207706_10309720 3300025933 Bacteria 1375
231 Ga0207686_10125131 3300025934 Bacteria 1756
232 Ga0207709_10001187 3300025935 Bacteria 18824
233 Ga0207670_10159106 3300025936 Bacteria 1684
234 Ga0207691_10200110 3300025940 Unclassified 1739
235 Ga0207691_10381443 3300025940 Unclassified 1203
236 Ga0207691_10876272 3300025940 Bacteria 752
237 Ga0207711_10189654 3300025941 Unclassified 1873
238 Ga0207661_10126725 3300025944 Bacteria 2181
239 Ga0207651_10261681 3300025960 Bacteria 1421
240 Ga0207712_10473186 3300025961 Unclassified 1066
241 Ga0207658_10254854 3300025986 Bacteria 1493
242 Ga0207658_10370903 3300025986 Bacteria 1251
243 Ga0207678_10141699 3300026067 Bacteria 2052
244 Ga0207641_10249276 3300026088 Bacteria 1658
245 Ga0207648_10148300 3300026089 Bacteria 2070
246 Ga0207676_10234782 3300026095 Bacteria 1642
247 Ga0207676_10632053 3300026095 Unclassified 1031
248 Ga0207676_11233628 3300026095 Bacteria 742
249 Ga0207676_11333223 3300026095 Unclassified 713
250 Ga0207674_10116463 3300026116 Unclassified 2643
251 Ga0207674_10399289 3300026116 Unclassified 1329
252 Ga0207674_10846677 3300026116 Bacteria 882
253 Ga0207675_100568624 3300026118 Bacteria 1134
254 Ga0207675_100612747 3300026118 Bacteria 1092
255 Ga0207675_100930549 3300026118 Bacteria 886
256 Ga0207683_10977535 3300026121 Bacteria 786
257 Ga0207698_10701373 3300026142 Bacteria 1007
258 Ga0268265_10027580 3300028380 Unclassified 4055
259 Ga0268265_10028037 3300028380 Bacteria 4028
260 Ga0268265_10558318 3300028380 Bacteria 1088
261 Ga0268264_10052810 3300028381 Unclassified 3389
262 Ga0268264_10093358 3300028381 Bacteria 2599
263 Ga0268264_11544901 3300028381 Bacteria 674
264 Ga0316177_1045804 3300030731 Bacteria 987
265 Ga0307408_100362913 3300031548 Bacteria 1233
266 Ga0316576_10052011 3300031727 Bacteria 2982
267 Ga0307409_100592056 3300031995 Bacteria 1095
268 Ga0307416_100035412 3300032002 Bacteria 3812
269 Ga0307416_100124568 3300032002 Bacteria 2306
270 Ga0316583_10000989 3300032133 Bacteria 9138
271 Ga0373936_0019359 3300035113 Bacteria 2637
272 Ga0373939_0044604 3300035114 Bacteria 1350
273 Ga0373955_0115108 3300035172 Bacteria 1558
274 Ga0373955_0379631 3300035172 Bacteria 858
275 Ga0373935_0089201 3300035692 Bacteria 2016
276 Ga0373927_0449944 3300035695 Bacteria 851
277 Ga0373947_0126186 3300035725 Bacteria 1630
278 Ga0373947_0168781 3300035725 Bacteria 1419
279 Ga0373937_0001923 3300036401 Bacteria 17365
280 Ga0373937_0536538 3300036401 Bacteria 1111
281 Ga0316582_0172665 3300036647 Bacteria 1468
282 Ga0316584_0048353 3300036712 Bacteria 3178
283 Ga0373925_0634836 3300037068 Bacteria 880
284 Ga0395899_0023366 3300037312 Bacteria 4683
285 Ga0395900_0009078 3300037418 Bacteria 10191
286 Ga0395898_0025330 3300037466 Bacteria 5979
287 Ga0395901_0000661 3300038443 Bacteria 39682
288 Ga0395901_0948409 3300038443 Bacteria 839
289 Ga0400490_31829 3300038726 Bacteria 2212
290 Ga0400489_09922 3300039093 Bacteria 25644
291 Ga0439436_0039872 3300041404 Bacteria 1347
292 Ga0439447_078913 3300041407 Bacteria 761
293 Ga0439461_0005128 3300041410 Bacteria 2219
294 Ga0439466_0060080 3300041411 Bacteria 1226
295 Ga0439431_0115635 3300041997 Bacteria 745
296 Ga0439433_0000609 3300041999 Bacteria 6829
297 Ga0439442_008667 3300042002 Bacteria 2054
298 Ga0439432_000968 3300042006 Bacteria 10835
299 Ga0439449_0004082 3300042007 Bacteria 5652
300 Ga0439463_034029 3300042016 Bacteria 1289
301 Ga0450911_000004 3300042115 Bacteria 234537
302 Ga0450904_000210 3300042139 Bacteria 12706
303 Ga0439434_0010457 3300042435 Bacteria 2734
304 Ga0439435_0001633 3300042436 Bacteria 4216
305 Ga0439459_0031603 3300042438 Bacteria 1080
306 Ga0450893_0003084 3300042532 Bacteria 2619
307 Ga0439440_0021057 3300042993 Bacteria 1467
308 Ga0451576_0140474 3300045051 Bacteria 2519
309 Ga0466967_0107205 3300045976 Bacteria 2562
310 Ga0495592_0233315 3300046454 Bacteria 1224
311 Ga0495590_0001294 3300046457 Bacteria 10880
312 Ga0495629_0340681 3300046459 Bacteria 1024
313 Ga0495653_0089198 3300046463 Bacteria 2260
314 Ga0495580_0001795 3300046472 Bacteria 18858
315 Ga0495580_0484877 3300046472 Bacteria 826
316 Ga0495582_0267200 3300046473 Bacteria 981
317 Ga0495584_0177116 3300046491 Bacteria 1084
318 Ga0495608_0072219 3300046511 Bacteria 2251
319 Ga0495645_0006118 3300046543 Bacteria 8328
320 Ga0495667_0000715 3300046559 Bacteria 21273
321 Ga0495668_0515014 3300046616 Bacteria 660
322 Ga0495635_0002992 3300046663 Bacteria 11597
323 Ga0495657_0036301 3300046675 Bacteria 3407
324 Ga0495599_0053748 3300046678 Bacteria 2523
325 Ga0495599_0201671 3300046678 Bacteria 1222
326 Ga0495623_0094033 3300046679 Bacteria 1834
327 Ga0495646_0038283 3300046680 Unclassified 2962
328 Ga0495646_0319285 3300046680 Bacteria 818
329 Ga0495647_0099479 3300046681 Bacteria 1203
330 Ga0495613_0238244 3300046689 Bacteria 1273
331 Ga0495600_0053077 3300046809 Bacteria 2647
332 Ga0495600_0140403 3300046809 Bacteria 1567
333 Ga0495581_0396727 3300047315 Bacteria 805
334 Ga0495604_0051724 3300047317 Bacteria 3183
335 Ga0495604_0535643 3300047317 Bacteria 756
336 Ga0495680_0003225 3300047322 Bacteria 16201
337 Ga0495684_0053748 3300047471 Bacteria 3073
338 Ga0495684_0155582 3300047471 Bacteria 1707
339 Ga0495686_0002413 3300047472 Bacteria 17723
340 Ga0495602_0119016 3300048088 Bacteria 2129
341 Ga0496100_0113237 3300048903 Bacteria 1888
342 Ga0496107_0695857 3300048910 Unclassified 748
343 Ga0496108_0073481 3300048911 Bacteria 2887
344 Ga0496108_0348473 3300048911 Bacteria 1292
345 Ga0496112_0000122 3300048915 Bacteria 48608
346 Ga0496125_0072230 3300048928 Bacteria 2690
347 Ga0501031_0349345 3300049568 Bacteria 957
348 Ga0501032_0765723 3300049569 Bacteria 610
349 Ga0501036_0118628 3300049572 Bacteria 2234
350 Ga0501036_0914518 3300049572 Bacteria 720
351 Ga0501038_0169419 3300049574 Bacteria 1769
352 Ga0501039_0038010 3300049575 Bacteria 3718
353 Ga0501039_0093397 3300049575 Bacteria 2345
354 Ga0501040_0051755 3300049576 Bacteria 2809
355 Ga0501041_0004269 3300049577 Bacteria 8273
356 Ga0501042_0058561 3300049578 Bacteria 2750
357 Ga0501043_0148029 3300049579 Bacteria 1838
358 Ga0501048_0037352 3300049582 Bacteria 3488
359 Ga0501071_0353749 3300049587 Bacteria 1118
360 Ga0501072_0172202 3300049588 Bacteria 1727
361 Ga0501076_0022427 3300049592 Bacteria 4853
362 Ga0501235_043386 3300049669 Bacteria 1032
363 Ga0501079_0042715 3300049741 Bacteria 3500
364 Ga0501081_0418153 3300049743 Bacteria 994
365 Ga0501035_0144613 3300049822 Bacteria 2066
366 Ga0501045_0008831 3300049824 Bacteria 7039
367 Ga0501226_000003 3300049853 Bacteria 358977
368 nmdc:mga03683_4157_c1 3300050489 Bacteria 4763
369 nmdc:mga00v17_34193_c1 3300050491 Bacteria 3017
370 nmdc:mga0k408_26759_c1 3300050493 Bacteria 3272
371 nmdc:mga06z11_181208_c1 3300050494 Bacteria 1215
372 nmdc:mga05p37_1237564_c1 3300050507 Unclassified 767
373 nmdc:mga05p37_302649_c1 3300050507 Bacteria 1899
374 nmdc:mga0qj67_110089_c1 3300050509 Bacteria 2223
375 nmdc:mga06r32_10603_c1 3300050510 Bacteria 8310
376 nmdc:mga0n895_19806_c1 3300050512 Bacteria 6260
377 nmdc:mga0n895_90213_c1 3300050512 Bacteria 3066
378 nmdc:mga0rr50_94190_c1 3300050513 Bacteria 2338
379 nmdc:mga08x19_10974_c1 3300050514 Bacteria 5450
380 nmdc:mga08x19_314442_c1 3300050514 Bacteria 1089
381 nmdc:mga0a205_147027_c1 3300050515 Bacteria 2257
382 nmdc:mga0a205_267865_c1 3300050515 Bacteria 1585
383 nmdc:mga0a205_728638_c1 3300050515 Bacteria 841
384 nmdc:mga0a205_889333_c1 3300050515 Bacteria 737
385 Ga0500616_0000928 3300053153 Bacteria 32046
386 Ga0500616_0002505 3300053153 Bacteria 15205
387 Ga0501084_1096223 3300054114 Bacteria 668
388 Ga0530510_0006279 3300061734 Bacteria 8270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0765723 Ga0501032_0765723_27_488 129
2 3300046678 Ga0495599_0201671 Ga0495599_0201671_730_1200 132
3 iso_pu_bacteria 2734482264 2735836967 140
4 iso_pu_bacteria 2738543009 2739226412 140
5 iso_pu_bacteria 2739367700 2739731123 140
6 iso_pu_bacteria 2895395659 2895398981 140
7 iso_pu_bacteria 2928963466 2928967170 140
8 iso_pu_bacteria 2885192300 2885193918 141
9 iso_pu_bacteria 8057568493 8057574818 141
10 3300031995 Ga0307409_100592056 Ga0307409_1005920562 142
11 3300032002 Ga0307416_100035412 Ga0307416_1000354124 142
12 3300053153 Ga0500616_0002505 Ga0500616_0002505_7283_7795 142
13 iso_pu_bacteria 2808606373 2808903846 142
14 3300003322 rootL2_10257985 rootL2_102579852 143
15 3300005295 Ga0065707_10293949 Ga0065707_102939492 143
16 3300005330 Ga0070690_100045624 Ga0070690_1000456243 143
17 3300005335 Ga0070666_10131270 Ga0070666_101312701 143
18 3300005340 Ga0070689_100726613 Ga0070689_1007266131 143
19 3300005353 Ga0070669_100641464 Ga0070669_1006414642 143
20 3300005356 Ga0070674_100771171 Ga0070674_1007711712 143
21 3300005367 Ga0070667_100291114 Ga0070667_1002911143 143
22 3300005367 Ga0070667_100707051 Ga0070667_1007070512 143
23 3300005543 Ga0070672_100077430 Ga0070672_1000774304 143
24 3300005544 Ga0070686_100312496 Ga0070686_1003124962 143
25 3300005577 Ga0068857_101142520 Ga0068857_1011425201 143
26 3300005616 Ga0068852_101067372 Ga0068852_1010673722 143
27 3300005618 Ga0068864_101058919 Ga0068864_1010589192 143
28 3300005841 Ga0068863_100628449 Ga0068863_1006284492 143
29 3300005844 Ga0068862_100017498 Ga0068862_1000174987 143
30 3300009101 Ga0105247_10270729 Ga0105247_102707292 143
31 3300009176 Ga0105242_10159973 Ga0105242_101599732 143
32 3300009176 Ga0105242_10969697 Ga0105242_109696972 143
33 3300009551 Ga0105238_10265110 Ga0105238_102651102 143
34 3300013306 Ga0163162_10726149 Ga0163162_107261491 143
35 3300013308 Ga0157375_10061307 Ga0157375_100613074 143
36 3300014326 Ga0157380_10288848 Ga0157380_102888482 143
37 3300030731 Ga0316177_1045804 Ga0316177_10458042 143
38 3300035113 Ga0373936_0019359 Ga0373936_0019359_1348_1860 143
39 3300035172 Ga0373955_0115108 Ga0373955_0115108_750_1262 143
40 3300035692 Ga0373935_0089201 Ga0373935_0089201_1073_1585 143
41 3300035725 Ga0373947_0126186 Ga0373947_0126186_948_1460 143
42 3300036401 Ga0373937_0001923 Ga0373937_0001923_6575_7087 143
43 3300042016 Ga0439463_034029 Ga0439463_034029_499_1014 143
44 3300042993 Ga0439440_0021057 Ga0439440_0021057_134_649 143
45 3300046454 Ga0495592_0233315 Ga0495592_0233315_337_849 143
46 3300046463 Ga0495653_0089198 Ga0495653_0089198_823_1335 143
47 3300046473 Ga0495582_0267200 Ga0495582_0267200_410_925 143
48 3300046511 Ga0495608_0072219 Ga0495608_0072219_168_680 143
49 3300046559 Ga0495667_0000715 Ga0495667_0000715_13281_13793 143
50 3300046663 Ga0495635_0002992 Ga0495635_0002992_4480_4992 143
51 3300046675 Ga0495657_0036301 Ga0495657_0036301_2481_2993 143
52 3300046680 Ga0495646_0319285 Ga0495646_0319285_15_527 143
53 3300046809 Ga0495600_0053077 Ga0495600_0053077_814_1326 143
54 3300047317 Ga0495604_0535643 Ga0495604_0535643_112_624 143
55 3300047322 Ga0495680_0003225 Ga0495680_0003225_12842_13354 143
56 3300047471 Ga0495684_0053748 Ga0495684_0053748_2499_3011 143
57 3300048903 Ga0496100_0113237 Ga0496100_0113237_126_641 143
58 3300050515 nmdc:mga0a205_267865_c1 nmdc:mga0a205_267865_c1_750_1268 143
59 3300002737 JGI25162J39368_1000707 JGI25162J39368_100070712 144
60 3300003320 rootH2_10030489 rootH2_100304894 144
61 3300003320 rootH2_10271950 rootH2_102719502 144
62 3300003322 rootL2_10054932 rootL2_100549327 144
63 3300003323 rootH1_10284792 rootH1_102847926 144
64 3300003323 rootH1_10358618 rootH1_103586183 144
65 3300003762 Ga0055542_1000223 Ga0055542_100022321 144
66 3300005262 Ga0065165_1015936 Ga0065165_10159364 144
67 3300005293 Ga0065715_10549411 Ga0065715_105494111 144
68 3300005295 Ga0065707_10089702 Ga0065707_100897022 144
69 3300005327 Ga0070658_10188211 Ga0070658_101882112 144
70 3300005329 Ga0070683_100048561 Ga0070683_1000485614 144
71 3300005331 Ga0070670_100018852 Ga0070670_1000188526 144
72 3300005331 Ga0070670_100029904 Ga0070670_1000299044 144
73 3300005331 Ga0070670_100417635 Ga0070670_1004176352 144
74 3300005340 Ga0070689_100073803 Ga0070689_1000738031 144
75 3300005340 Ga0070689_100901627 Ga0070689_1009016272 144
76 3300005343 Ga0070687_100178839 Ga0070687_1001788392 144
77 3300005343 Ga0070687_100388576 Ga0070687_1003885762 144
78 3300005347 Ga0070668_100683215 Ga0070668_1006832151 144
79 3300005353 Ga0070669_100465239 Ga0070669_1004652392 144
80 3300005354 Ga0070675_100435610 Ga0070675_1004356102 144
81 3300005356 Ga0070674_100085475 Ga0070674_1000854753 144
82 3300005364 Ga0070673_100579890 Ga0070673_1005798902 144
83 3300005406 Ga0070703_10331818 Ga0070703_103318181 144
84 3300005434 Ga0070709_10013545 Ga0070709_100135452 144
85 3300005435 Ga0070714_100034209 Ga0070714_1000342092 144
86 3300005436 Ga0070713_100016390 Ga0070713_1000163903 144
87 3300005436 Ga0070713_100979776 Ga0070713_1009797762 144
88 3300005437 Ga0070710_10072397 Ga0070710_100723973 144
89 3300005438 Ga0070701_10048753 Ga0070701_100487533 144
90 3300005438 Ga0070701_10188807 Ga0070701_101888071 144
91 3300005439 Ga0070711_100059933 Ga0070711_1000599334 144
92 3300005439 Ga0070711_100235256 Ga0070711_1002352562 144
93 3300005440 Ga0070705_100109133 Ga0070705_1001091332 144
94 3300005440 Ga0070705_101213671 Ga0070705_1012136711 144
95 3300005441 Ga0070700_100029553 Ga0070700_1000295534 144
96 3300005444 Ga0070694_100073264 Ga0070694_1000732643 144
97 3300005444 Ga0070694_100297183 Ga0070694_1002971831 144
98 3300005445 Ga0070708_100000237 Ga0070708_10000023716 144
99 3300005445 Ga0070708_100224138 Ga0070708_1002241381 144
100 3300005445 Ga0070708_100823485 Ga0070708_1008234851 144
101 3300005456 Ga0070678_101102542 Ga0070678_1011025421 144
102 3300005459 Ga0068867_100836239 Ga0068867_1008362392 144
103 3300005467 Ga0070706_100001593 Ga0070706_10000159313 144
104 3300005468 Ga0070707_100051028 Ga0070707_1000510284 144
105 3300005471 Ga0070698_100001354 Ga0070698_10000135412 144
106 3300005471 Ga0070698_100047475 Ga0070698_1000474751 144
107 3300005471 Ga0070698_100220755 Ga0070698_1002207552 144
108 3300005518 Ga0070699_100101623 Ga0070699_1001016232 144
109 3300005518 Ga0070699_100171861 Ga0070699_1001718612 144
110 3300005518 Ga0070699_101002069 Ga0070699_1010020692 144
111 3300005530 Ga0070679_100294754 Ga0070679_1002947542 144
112 3300005530 Ga0070679_100747712 Ga0070679_1007477122 144
113 3300005535 Ga0070684_100100996 Ga0070684_1001009964 144
114 3300005535 Ga0070684_100177314 Ga0070684_1001773143 144
115 3300005536 Ga0070697_100000140 Ga0070697_10000014024 144
116 3300005536 Ga0070697_100137905 Ga0070697_1001379052 144
117 3300005536 Ga0070697_100886825 Ga0070697_1008868251 144
118 3300005543 Ga0070672_100294219 Ga0070672_1002942192 144
119 3300005543 Ga0070672_100335661 Ga0070672_1003356612 144
120 3300005546 Ga0070696_100325462 Ga0070696_1003254622 144
121 3300005546 Ga0070696_100588739 Ga0070696_1005887392 144
122 3300005547 Ga0070693_100389172 Ga0070693_1003891721 144
123 3300005548 Ga0070665_100065612 Ga0070665_1000656121 144
124 3300005549 Ga0070704_100017412 Ga0070704_1000174123 144
125 3300005549 Ga0070704_101111319 Ga0070704_1011113191 144
126 3300005549 Ga0070704_101354321 Ga0070704_1013543211 144
127 3300005549 Ga0070704_101514600 Ga0070704_1015146001 144
128 3300005563 Ga0068855_100248334 Ga0068855_1002483342 144
129 3300005577 Ga0068857_100312327 Ga0068857_1003123274 144
130 3300005577 Ga0068857_100717005 Ga0068857_1007170052 144
131 3300005615 Ga0070702_100007398 Ga0070702_1000073984 144
132 3300005616 Ga0068852_100343737 Ga0068852_1003437373 144
133 3300005617 Ga0068859_100011283 Ga0068859_1000112837 144
134 3300005617 Ga0068859_100014042 Ga0068859_1000140426 144
135 3300005617 Ga0068859_100288921 Ga0068859_1002889213 144
136 3300005617 Ga0068859_100645746 Ga0068859_1006457462 144
137 3300005617 Ga0068859_100823594 Ga0068859_1008235942 144
138 3300005618 Ga0068864_100001094 Ga0068864_10000109410 144
139 3300005618 Ga0068864_100228454 Ga0068864_1002284542 144
140 3300005618 Ga0068864_100483361 Ga0068864_1004833612 144
141 3300005718 Ga0068866_10073404 Ga0068866_100734042 144
142 3300005719 Ga0068861_100208124 Ga0068861_1002081242 144
143 3300005840 Ga0068870_10001396 Ga0068870_100013963 144
144 3300005842 Ga0068858_100028754 Ga0068858_1000287543 144
145 3300005842 Ga0068858_100215509 Ga0068858_1002155092 144
146 3300005842 Ga0068858_100667810 Ga0068858_1006678102 144
147 3300005844 Ga0068862_100052003 Ga0068862_1000520034 144
148 3300005844 Ga0068862_100052522 Ga0068862_1000525224 144
149 3300005844 Ga0068862_101154603 Ga0068862_1011546031 144
150 3300005937 Ga0081455_10585280 Ga0081455_105852802 144
151 3300006028 Ga0070717_10011421 Ga0070717_100114215 144
152 3300006048 Ga0075363_100143876 Ga0075363_1001438761 144
153 3300006051 Ga0075364_10002574 Ga0075364_100025747 144
154 3300006163 Ga0070715_10206381 Ga0070715_102063812 144
155 3300006175 Ga0070712_100006993 Ga0070712_1000069935 144
156 3300006175 Ga0070712_100085384 Ga0070712_1000853842 144
157 3300006175 Ga0070712_100411240 Ga0070712_1004112402 144
158 3300006177 Ga0075362_10034526 Ga0075362_100345261 144
159 3300006178 Ga0075367_10005535 Ga0075367_100055355 144
160 3300006195 Ga0075366_10024811 Ga0075366_100248112 144
161 3300006195 Ga0075366_10041900 Ga0075366_100419002 144
162 3300006353 Ga0075370_10006811 Ga0075370_100068115 144
163 3300006358 Ga0068871_100538251 Ga0068871_1005382512 144
164 3300006358 Ga0068871_100653644 Ga0068871_1006536442 144
165 3300006844 Ga0075428_101086883 Ga0075428_1010868832 144
166 3300006844 Ga0075428_101247231 Ga0075428_1012472311 144
167 3300006846 Ga0075430_100155918 Ga0075430_1001559184 144
168 3300006847 Ga0075431_100007947 Ga0075431_1000079477 144
169 3300006847 Ga0075431_100943583 Ga0075431_1009435831 144
170 3300006852 Ga0075433_10840810 Ga0075433_108408101 144
171 3300006871 Ga0075434_100022420 Ga0075434_1000224206 144
172 3300006871 Ga0075434_100216644 Ga0075434_1002166444 144
173 3300006914 Ga0075436_100051161 Ga0075436_1000511615 144
174 3300006914 Ga0075436_100238498 Ga0075436_1002384982 144
175 3300006931 Ga0097620_100011281 Ga0097620_1000112815 144
176 3300006931 Ga0097620_100014042 Ga0097620_1000140426 144
177 3300006931 Ga0097620_100288920 Ga0097620_1002889202 144
178 3300006931 Ga0097620_100645793 Ga0097620_1006457932 144
179 3300006931 Ga0097620_100823597 Ga0097620_1008235972 144
180 3300009093 Ga0105240_10011296 Ga0105240_100112966 144
181 3300009094 Ga0111539_10385697 Ga0111539_103856972 144
182 3300009101 Ga0105247_10534634 Ga0105247_105346342 144
183 3300009101 Ga0105247_10629515 Ga0105247_106295152 144
184 3300009147 Ga0114129_10143042 Ga0114129_101430424 144
185 3300009147 Ga0114129_10398585 Ga0114129_103985852 144
186 3300009147 Ga0114129_10560851 Ga0114129_105608513 144
187 3300009148 Ga0105243_10000996 Ga0105243_1000099622 144
188 3300009174 Ga0105241_10084903 Ga0105241_100849032 144
189 3300009174 Ga0105241_10437883 Ga0105241_104378832 144
190 3300009174 Ga0105241_10582581 Ga0105241_105825812 144
191 3300009176 Ga0105242_10598744 Ga0105242_105987442 144
192 3300009177 Ga0105248_10068677 Ga0105248_100686772 144
193 3300009177 Ga0105248_10138786 Ga0105248_101387863 144
194 3300009177 Ga0105248_10264924 Ga0105248_102649242 144
195 3300009545 Ga0105237_10001683 Ga0105237_1000168323 144
196 3300009545 Ga0105237_10533964 Ga0105237_105339642 144
197 3300009551 Ga0105238_10015271 Ga0105238_100152716 144
198 3300009551 Ga0105238_10182361 Ga0105238_101823612 144
199 3300009553 Ga0105249_10623536 Ga0105249_106235363 144
200 3300009553 Ga0105249_10806776 Ga0105249_108067762 144
201 3300009553 Ga0105249_11086978 Ga0105249_110869782 144
202 3300010375 Ga0105239_10002819 Ga0105239_100028196 144
203 3300010375 Ga0105239_10771897 Ga0105239_107718972 144
204 3300013104 Ga0157370_10608548 Ga0157370_106085481 144
205 3300013105 Ga0157369_11084006 Ga0157369_110840061 144
206 3300013297 Ga0157378_10000015 Ga0157378_1000001598 144
207 3300013297 Ga0157378_10218687 Ga0157378_102186872 144
208 3300013307 Ga0157372_10032933 Ga0157372_100329335 144
209 3300013307 Ga0157372_10034586 Ga0157372_100345864 144
210 3300013308 Ga0157375_10006043 Ga0157375_100060431 144
211 3300013308 Ga0157375_10399048 Ga0157375_103990481 144
212 3300013308 Ga0157375_12503321 Ga0157375_125033211 144
213 3300014325 Ga0163163_10115414 Ga0163163_101154144 144
214 3300014325 Ga0163163_10123336 Ga0163163_101233362 144
215 3300014325 Ga0163163_11004943 Ga0163163_110049433 144
216 3300014326 Ga0157380_10091353 Ga0157380_100913531 144
217 3300014326 Ga0157380_10224968 Ga0157380_102249682 144
218 3300014326 Ga0157380_11911779 Ga0157380_119117792 144
219 3300014745 Ga0157377_10232439 Ga0157377_102324391 144
220 3300014968 Ga0157379_10271898 Ga0157379_102718982 144
221 3300014968 Ga0157379_10361718 Ga0157379_103617182 144
222 3300014969 Ga0157376_10043523 Ga0157376_100435232 144
223 3300014969 Ga0157376_10073169 Ga0157376_100731692 144
224 3300014969 Ga0157376_10076551 Ga0157376_100765515 144
225 3300014969 Ga0157376_12068755 Ga0157376_120687551 144
226 3300015262 Ga0182007_10094635 Ga0182007_100946351 144
227 3300017792 Ga0163161_10175644 Ga0163161_101756444 144
228 3300017792 Ga0163161_10587002 Ga0163161_105870021 144
229 3300017792 Ga0163161_10628759 Ga0163161_106287591 144
230 3300025315 Ga0207697_10249697 Ga0207697_102496971 144
231 3300025885 Ga0207653_10183191 Ga0207653_101831912 144
232 3300025898 Ga0207692_10010443 Ga0207692_100104435 144
233 3300025898 Ga0207692_10075734 Ga0207692_100757342 144
234 3300025900 Ga0207710_10057290 Ga0207710_100572904 144
235 3300025901 Ga0207688_10174778 Ga0207688_101747781 144
236 3300025903 Ga0207680_10320618 Ga0207680_103206181 144
237 3300025905 Ga0207685_10085093 Ga0207685_100850932 144
238 3300025908 Ga0207643_10015698 Ga0207643_100156985 144
239 3300025910 Ga0207684_10001536 Ga0207684_1000153616 144
240 3300025910 Ga0207684_10030053 Ga0207684_100300535 144
241 3300025910 Ga0207684_10962999 Ga0207684_109629991 144
242 3300025910 Ga0207684_11189982 Ga0207684_111899821 144
243 3300025912 Ga0207707_10557188 Ga0207707_105571881 144
244 3300025913 Ga0207695_10028305 Ga0207695_100283052 144
245 3300025914 Ga0207671_10006284 Ga0207671_100062844 144
246 3300025915 Ga0207693_10010700 Ga0207693_100107005 144
247 3300025915 Ga0207693_10171851 Ga0207693_101718514 144
248 3300025915 Ga0207693_10330506 Ga0207693_103305061 144
249 3300025916 Ga0207663_10041856 Ga0207663_100418563 144
250 3300025918 Ga0207662_10029724 Ga0207662_100297242 144
251 3300025918 Ga0207662_10238788 Ga0207662_102387882 144
252 3300025921 Ga0207652_10286648 Ga0207652_102866483 144
253 3300025923 Ga0207681_10132693 Ga0207681_101326933 144
254 3300025923 Ga0207681_10151146 Ga0207681_101511462 144
255 3300025924 Ga0207694_10083657 Ga0207694_100836573 144
256 3300025925 Ga0207650_10021490 Ga0207650_100214904 144
257 3300025925 Ga0207650_10035327 Ga0207650_100353274 144
258 3300025926 Ga0207659_10099258 Ga0207659_100992583 144
259 3300025926 Ga0207659_10113553 Ga0207659_101135533 144
260 3300025926 Ga0207659_10290068 Ga0207659_102900682 144
261 3300025927 Ga0207687_10196379 Ga0207687_101963792 144
262 3300025928 Ga0207700_10228090 Ga0207700_102280903 144
263 3300025929 Ga0207664_10197518 Ga0207664_101975184 144
264 3300025931 Ga0207644_10425222 Ga0207644_104252222 144
265 3300025933 Ga0207706_10309720 Ga0207706_103097202 144
266 3300025934 Ga0207686_10125131 Ga0207686_101251313 144
267 3300025935 Ga0207709_10001187 Ga0207709_100011874 144
268 3300025936 Ga0207670_10159106 Ga0207670_101591062 144
269 3300025940 Ga0207691_10200110 Ga0207691_102001103 144
270 3300025940 Ga0207691_10381443 Ga0207691_103814432 144
271 3300025940 Ga0207691_10876272 Ga0207691_108762721 144
272 3300025941 Ga0207711_10189654 Ga0207711_101896542 144
273 3300025944 Ga0207661_10126725 Ga0207661_101267254 144
274 3300025960 Ga0207651_10261681 Ga0207651_102616812 144
275 3300025961 Ga0207712_10473186 Ga0207712_104731861 144
276 3300025986 Ga0207658_10254854 Ga0207658_102548542 144
277 3300025986 Ga0207658_10370903 Ga0207658_103709031 144
278 3300026067 Ga0207678_10141699 Ga0207678_101416992 144
279 3300026088 Ga0207641_10249276 Ga0207641_102492762 144
280 3300026089 Ga0207648_10148300 Ga0207648_101483002 144
281 3300026095 Ga0207676_10234782 Ga0207676_102347822 144
282 3300026095 Ga0207676_10632053 Ga0207676_106320531 144
283 3300026095 Ga0207676_11233628 Ga0207676_112336282 144
284 3300026095 Ga0207676_11333223 Ga0207676_113332231 144
285 3300026116 Ga0207674_10116463 Ga0207674_101164631 144
286 3300026116 Ga0207674_10399289 Ga0207674_103992891 144
287 3300026116 Ga0207674_10846677 Ga0207674_108466771 144
288 3300026118 Ga0207675_100568624 Ga0207675_1005686242 144
289 3300026118 Ga0207675_100612747 Ga0207675_1006127472 144
290 3300026118 Ga0207675_100930549 Ga0207675_1009305491 144
291 3300026121 Ga0207683_10977535 Ga0207683_109775352 144
292 3300026142 Ga0207698_10701373 Ga0207698_107013732 144
293 3300028380 Ga0268265_10027580 Ga0268265_100275804 144
294 3300028380 Ga0268265_10028037 Ga0268265_100280372 144
295 3300028380 Ga0268265_10558318 Ga0268265_105583182 144
296 3300028381 Ga0268264_10052810 Ga0268264_100528104 144
297 3300028381 Ga0268264_10093358 Ga0268264_100933584 144
298 3300028381 Ga0268264_11544901 Ga0268264_115449011 144
299 3300031548 Ga0307408_100362913 Ga0307408_1003629133 144
300 3300031727 Ga0316576_10052011 Ga0316576_100520114 144
301 3300032002 Ga0307416_100124568 Ga0307416_1001245683 144
302 3300032133 Ga0316583_10000989 Ga0316583_100009892 144
303 3300035114 Ga0373939_0044604 Ga0373939_0044604_40_555 144
304 3300035172 Ga0373955_0379631 Ga0373955_0379631_193_720 144
305 3300035695 Ga0373927_0449944 Ga0373927_0449944_262_789 144
306 3300035725 Ga0373947_0168781 Ga0373947_0168781_881_1408 144
307 3300036401 Ga0373937_0536538 Ga0373937_0536538_357_863 144
308 3300036647 Ga0316582_0172665 Ga0316582_0172665_366_881 144
309 3300036712 Ga0316584_0048353 Ga0316584_0048353_1953_2468 144
310 3300037068 Ga0373925_0634836 Ga0373925_0634836_323_850 144
311 3300037312 Ga0395899_0023366 Ga0395899_0023366_3439_3948 144
312 3300037418 Ga0395900_0009078 Ga0395900_0009078_2123_2632 144
313 3300037466 Ga0395898_0025330 Ga0395898_0025330_1033_1542 144
314 3300038443 Ga0395901_0000661 Ga0395901_0000661_3963_4472 144
315 3300038443 Ga0395901_0948409 Ga0395901_0948409_80_595 144
316 3300038726 Ga0400490_31829 Ga0400490_31829_353_868 144
317 3300039093 Ga0400489_09922 Ga0400489_09922_12288_12803 144
318 3300041404 Ga0439436_0039872 Ga0439436_0039872_408_923 144
319 3300041407 Ga0439447_078913 Ga0439447_078913_175_684 144
320 3300041410 Ga0439461_0005128 Ga0439461_0005128_429_938 144
321 3300041411 Ga0439466_0060080 Ga0439466_0060080_648_1157 144
322 3300041997 Ga0439431_0115635 Ga0439431_0115635_36_548 144
323 3300041999 Ga0439433_0000609 Ga0439433_0000609_5484_5993 144
324 3300042002 Ga0439442_008667 Ga0439442_008667_1186_1695 144
325 3300042006 Ga0439432_000968 Ga0439432_000968_1903_2412 144
326 3300042007 Ga0439449_0004082 Ga0439449_0004082_1318_1827 144
327 3300042115 Ga0450911_000004 Ga0450911_000004_78048_78560 144
328 3300042139 Ga0450904_000210 Ga0450904_000210_10722_11234 144
329 3300042435 Ga0439434_0010457 Ga0439434_0010457_1024_1533 144
330 3300042436 Ga0439435_0001633 Ga0439435_0001633_876_1388 144
331 3300042438 Ga0439459_0031603 Ga0439459_0031603_299_811 144
332 3300042532 Ga0450893_0003084 Ga0450893_0003084_1393_1905 144
333 3300045051 Ga0451576_0140474 Ga0451576_0140474_519_1031 144
334 3300045976 Ga0466967_0107205 Ga0466967_0107205_1369_1887 144
335 3300046457 Ga0495590_0001294 Ga0495590_0001294_2692_3210 144
336 3300046459 Ga0495629_0340681 Ga0495629_0340681_327_839 144
337 3300046472 Ga0495580_0001795 Ga0495580_0001795_879_1385 144
338 3300046472 Ga0495580_0484877 Ga0495580_0484877_219_743 144
339 3300046491 Ga0495584_0177116 Ga0495584_0177116_459_971 144
340 3300046543 Ga0495645_0006118 Ga0495645_0006118_3560_4066 144
341 3300046616 Ga0495668_0515014 Ga0495668_0515014_39_557 144
342 3300046678 Ga0495599_0053748 Ga0495599_0053748_704_1210 144
343 3300046679 Ga0495623_0094033 Ga0495623_0094033_822_1328 144
344 3300046680 Ga0495646_0038283 Ga0495646_0038283_692_1198 144
345 3300046681 Ga0495647_0099479 Ga0495647_0099479_519_1031 144
346 3300046689 Ga0495613_0238244 Ga0495613_0238244_444_950 144
347 3300046809 Ga0495600_0140403 Ga0495600_0140403_699_1205 144
348 3300047315 Ga0495581_0396727 Ga0495581_0396727_259_777 144
349 3300047317 Ga0495604_0051724 Ga0495604_0051724_989_1495 144
350 3300047471 Ga0495684_0155582 Ga0495684_0155582_594_1100 144
351 3300047472 Ga0495686_0002413 Ga0495686_0002413_16535_17044 144
352 3300048088 Ga0495602_0119016 Ga0495602_0119016_725_1231 144
353 3300048910 Ga0496107_0695857 Ga0496107_0695857_176_718 144
354 3300048911 Ga0496108_0073481 Ga0496108_0073481_1540_2052 144
355 3300048911 Ga0496108_0348473 Ga0496108_0348473_303_818 144
356 3300048915 Ga0496112_0000122 Ga0496112_0000122_11529_12038 144
357 3300048928 Ga0496125_0072230 Ga0496125_0072230_1372_1881 144
358 3300049568 Ga0501031_0349345 Ga0501031_0349345_391_906 144
359 3300049572 Ga0501036_0118628 Ga0501036_0118628_701_1216 144
360 3300049572 Ga0501036_0914518 Ga0501036_0914518_135_650 144
361 3300049574 Ga0501038_0169419 Ga0501038_0169419_444_959 144
362 3300049575 Ga0501039_0038010 Ga0501039_0038010_2055_2570 144
363 3300049575 Ga0501039_0093397 Ga0501039_0093397_1055_1570 144
364 3300049576 Ga0501040_0051755 Ga0501040_0051755_1077_1592 144
365 3300049577 Ga0501041_0004269 Ga0501041_0004269_5132_5647 144
366 3300049578 Ga0501042_0058561 Ga0501042_0058561_1106_1621 144
367 3300049579 Ga0501043_0148029 Ga0501043_0148029_942_1457 144
368 3300049582 Ga0501048_0037352 Ga0501048_0037352_559_1074 144
369 3300049587 Ga0501071_0353749 Ga0501071_0353749_106_621 144
370 3300049588 Ga0501072_0172202 Ga0501072_0172202_53_568 144
371 3300049592 Ga0501076_0022427 Ga0501076_0022427_1103_1618 144
372 3300049669 Ga0501235_043386 Ga0501235_043386_495_1016 144
373 3300049741 Ga0501079_0042715 Ga0501079_0042715_1833_2348 144
374 3300049743 Ga0501081_0418153 Ga0501081_0418153_269_784 144
375 3300049822 Ga0501035_0144613 Ga0501035_0144613_1326_1832 144
376 3300049824 Ga0501045_0008831 Ga0501045_0008831_5404_5919 144
377 3300049853 Ga0501226_000003 Ga0501226_000003_107164_107676 144
378 3300050489 nmdc:mga03683_4157_c1 nmdc:mga03683_4157_c1_2009_2515 144
379 3300050491 nmdc:mga00v17_34193_c1 nmdc:mga00v17_34193_c1_616_1122 144
380 3300050493 nmdc:mga0k408_26759_c1 nmdc:mga0k408_26759_c1_999_1505 144
381 3300050494 nmdc:mga06z11_181208_c1 nmdc:mga06z11_181208_c1_136_642 144
382 3300050507 nmdc:mga05p37_1237564_c1 nmdc:mga05p37_1237564_c1_188_703 144
383 3300050507 nmdc:mga05p37_302649_c1 nmdc:mga05p37_302649_c1_673_1188 144
384 3300050509 nmdc:mga0qj67_110089_c1 nmdc:mga0qj67_110089_c1_1586_2101 144
385 3300050510 nmdc:mga06r32_10603_c1 nmdc:mga06r32_10603_c1_659_1174 144
386 3300050512 nmdc:mga0n895_19806_c1 nmdc:mga0n895_19806_c1_1545_2060 144
387 3300050512 nmdc:mga0n895_90213_c1 nmdc:mga0n895_90213_c1_2397_2912 144
388 3300050513 nmdc:mga0rr50_94190_c1 nmdc:mga0rr50_94190_c1_1458_1973 144
389 3300050514 nmdc:mga08x19_10974_c1 nmdc:mga08x19_10974_c1_2260_2775 144
390 3300050514 nmdc:mga08x19_314442_c1 nmdc:mga08x19_314442_c1_377_892 144
391 3300050515 nmdc:mga0a205_147027_c1 nmdc:mga0a205_147027_c1_1000_1515 144
392 3300050515 nmdc:mga0a205_728638_c1 nmdc:mga0a205_728638_c1_142_657 144
393 3300050515 nmdc:mga0a205_889333_c1 nmdc:mga0a205_889333_c1_170_685 144
394 3300053153 Ga0500616_0000928 Ga0500616_0000928_18175_18702 144
395 3300054114 Ga0501084_1096223 Ga0501084_1096223_123_638 144
396 3300061734 Ga0530510_0006279 Ga0530510_0006279_1135_1650 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04717

Phage_base_V

Type VI secretion system/phage-baseplate injector OB domain

11

85

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ql5-assembly1.cif.gz_A crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4 0.7456 6 81
3jam-assembly1.cif.gz_i cryoem structure of 40s-eif1a-eif1 complex from yeast 0.7251 1 81
1hr0-assembly1.cif.gz_W crystal structure of initiation factor if1 bound to the 30s ribosomal subunit 0.7229 6 77
2n3s-assembly1.cif.gz_A nmr assignments and structure of translation initiation factor if-1 from burkholderia thailandensis e264. 0.718 6 81
6zu9-assembly1.cif.gz_A structure of a yeast abce1-bound 48s initiation complex 0.7176 4 81
ID Description Score Start End Superfamily
3fvqA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7837 6 66 2.40.50.470
af_Q8II01_677_864_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7707 5 36 2.40.50.90
3i4oA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7192 7 81 2.40.50.140
af_P46618_9_92_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7099 5 90 2.40.50.140
af_Q8IQ13_17_92_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6875 7 81 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A321LET6-F1-model_v4 Baseplate assembly protein 0.8881 1 144
AF-A0A1H9C3A2-F1-model_v4 Gp5/Type VI secretion system Vgr protein OB-fold domain-containing protein 0.8842 2 144
AF-A0A321LET6-F1-model_v4 Baseplate assembly protein 0.8824 1 144
AF-A0A4S3KCW2-F1-model_v4 Baseplate assembly protein 0.8759 1 144
AF-A0A7Y8KWG7-F1-model_v4 Baseplate assembly protein 0.8746 12 144

Feature Viewer

pLDDT pTM Quality
78.39 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map