F433558
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 396 | 258 | 388 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0019359|Ga0373936_0019359_1348_1860 |
| Length | 146 |
| Sequence | VSGAAKYYGKYRGTVVQNVDPEQRGRIQAMVPDVTNVVPGSWAVPCVPLAGKLMGTYLVPQIGAGVWIEYEQGDPDYPIWTGGFWGVGEVPALALTGNPASPSIVLQTGLQNSITLSDVPGPTGGIMLKSSTGAMILVNDVALTVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 2 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 3 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 4 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 5 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 6 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 7 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 160 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 168 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 175 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 176 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 177 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 178 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 179 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 180 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 181 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 182 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 183 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 184 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 185 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 186 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 187 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 188 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 189 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 190 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 191 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 192 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 245 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 246 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 247 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 256 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 258 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 0 |
| Isolates | 2.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.04 |
| Nodule | 0 |
| Rhizoplane | 1.26 |
| Rhizosphere | 90.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000707 | 3300002737 | Bacteria | 23218 |
| 2 | rootH2_10030489 | 3300003320 | Bacteria | 4997 |
| 3 | rootH2_10271950 | 3300003320 | Unclassified | 1036 |
| 4 | rootL2_10054932 | 3300003322 | Bacteria | 5990 |
| 5 | rootL2_10257985 | 3300003322 | Unclassified | 2208 |
| 6 | rootH1_10284792 | 3300003323 | Bacteria | 4158 |
| 7 | rootH1_10358618 | 3300003323 | Bacteria | 1720 |
| 8 | Ga0055542_1000223 | 3300003762 | Bacteria | 68138 |
| 9 | Ga0065165_1015936 | 3300005262 | Bacteria | 2841 |
| 10 | Ga0065715_10549411 | 3300005293 | Bacteria | 709 |
| 11 | Ga0065707_10089702 | 3300005295 | Bacteria | 4300 |
| 12 | Ga0065707_10293949 | 3300005295 | Bacteria | 1019 |
| 13 | Ga0070658_10188211 | 3300005327 | Bacteria | 1739 |
| 14 | Ga0070683_100048561 | 3300005329 | Bacteria | 3924 |
| 15 | Ga0070690_100045624 | 3300005330 | Bacteria | 2785 |
| 16 | Ga0070670_100018852 | 3300005331 | Bacteria | 5917 |
| 17 | Ga0070670_100029904 | 3300005331 | Bacteria | 4691 |
| 18 | Ga0070670_100417635 | 3300005331 | Bacteria | 1186 |
| 19 | Ga0070666_10131270 | 3300005335 | Bacteria | 1741 |
| 20 | Ga0070689_100073803 | 3300005340 | Bacteria | 2669 |
| 21 | Ga0070689_100726613 | 3300005340 | Bacteria | 869 |
| 22 | Ga0070689_100901627 | 3300005340 | Unclassified | 782 |
| 23 | Ga0070687_100178839 | 3300005343 | Bacteria | 1269 |
| 24 | Ga0070687_100388576 | 3300005343 | Unclassified | 911 |
| 25 | Ga0070668_100683215 | 3300005347 | Unclassified | 904 |
| 26 | Ga0070669_100465239 | 3300005353 | Bacteria | 1044 |
| 27 | Ga0070669_100641464 | 3300005353 | Bacteria | 893 |
| 28 | Ga0070675_100435610 | 3300005354 | Bacteria | 1174 |
| 29 | Ga0070674_100085475 | 3300005356 | Bacteria | 2264 |
| 30 | Ga0070674_100771171 | 3300005356 | Bacteria | 828 |
| 31 | Ga0070673_100579890 | 3300005364 | Unclassified | 1021 |
| 32 | Ga0070667_100291114 | 3300005367 | Bacteria | 1468 |
| 33 | Ga0070667_100707051 | 3300005367 | Bacteria | 933 |
| 34 | Ga0070703_10331818 | 3300005406 | Bacteria | 643 |
| 35 | Ga0070709_10013545 | 3300005434 | Unclassified | 4589 |
| 36 | Ga0070714_100034209 | 3300005435 | Unclassified | 4254 |
| 37 | Ga0070713_100016390 | 3300005436 | Bacteria | 5571 |
| 38 | Ga0070713_100979776 | 3300005436 | Bacteria | 815 |
| 39 | Ga0070710_10072397 | 3300005437 | Unclassified | 1990 |
| 40 | Ga0070701_10048753 | 3300005438 | Bacteria | 2187 |
| 41 | Ga0070701_10188807 | 3300005438 | Unclassified | 1211 |
| 42 | Ga0070711_100059933 | 3300005439 | Unclassified | 2644 |
| 43 | Ga0070711_100235256 | 3300005439 | Bacteria | 1430 |
| 44 | Ga0070705_100109133 | 3300005440 | Bacteria | 1764 |
| 45 | Ga0070705_101213671 | 3300005440 | Bacteria | 622 |
| 46 | Ga0070700_100029553 | 3300005441 | Bacteria | 3269 |
| 47 | Ga0070694_100073264 | 3300005444 | Bacteria | 2365 |
| 48 | Ga0070694_100297183 | 3300005444 | Bacteria | 1236 |
| 49 | Ga0070708_100000237 | 3300005445 | Bacteria | 40825 |
| 50 | Ga0070708_100224138 | 3300005445 | Unclassified | 1764 |
| 51 | Ga0070708_100823485 | 3300005445 | Bacteria | 872 |
| 52 | Ga0070678_101102542 | 3300005456 | Bacteria | 733 |
| 53 | Ga0068867_100836239 | 3300005459 | Bacteria | 824 |
| 54 | Ga0070706_100001593 | 3300005467 | Bacteria | 23652 |
| 55 | Ga0070707_100051028 | 3300005468 | Bacteria | 3965 |
| 56 | Ga0070698_100001354 | 3300005471 | Bacteria | 27238 |
| 57 | Ga0070698_100047475 | 3300005471 | Bacteria | 4389 |
| 58 | Ga0070698_100220755 | 3300005471 | Bacteria | 1829 |
| 59 | Ga0070699_100101623 | 3300005518 | Bacteria | 2521 |
| 60 | Ga0070699_100171861 | 3300005518 | Unclassified | 1920 |
| 61 | Ga0070699_101002069 | 3300005518 | Unclassified | 766 |
| 62 | Ga0070679_100294754 | 3300005530 | Bacteria | 1573 |
| 63 | Ga0070679_100747712 | 3300005530 | Bacteria | 921 |
| 64 | Ga0070684_100100996 | 3300005535 | Bacteria | 2577 |
| 65 | Ga0070684_100177314 | 3300005535 | Bacteria | 1937 |
| 66 | Ga0070697_100000140 | 3300005536 | Bacteria | 58765 |
| 67 | Ga0070697_100137905 | 3300005536 | Bacteria | 2049 |
| 68 | Ga0070697_100886825 | 3300005536 | Bacteria | 791 |
| 69 | Ga0070672_100077430 | 3300005543 | Unclassified | 2660 |
| 70 | Ga0070672_100294219 | 3300005543 | Bacteria | 1375 |
| 71 | Ga0070672_100335661 | 3300005543 | Unclassified | 1286 |
| 72 | Ga0070686_100312496 | 3300005544 | Bacteria | 1169 |
| 73 | Ga0070696_100325462 | 3300005546 | Bacteria | 1184 |
| 74 | Ga0070696_100588739 | 3300005546 | Bacteria | 896 |
| 75 | Ga0070693_100389172 | 3300005547 | Bacteria | 964 |
| 76 | Ga0070665_100065612 | 3300005548 | Bacteria | 3641 |
| 77 | Ga0070704_100017412 | 3300005549 | Unclassified | 4570 |
| 78 | Ga0070704_101111319 | 3300005549 | Bacteria | 718 |
| 79 | Ga0070704_101354321 | 3300005549 | Unclassified | 652 |
| 80 | Ga0070704_101514600 | 3300005549 | Unclassified | 617 |
| 81 | Ga0068855_100248334 | 3300005563 | Bacteria | 1985 |
| 82 | Ga0068857_100312327 | 3300005577 | Unclassified | 1450 |
| 83 | Ga0068857_100717005 | 3300005577 | Bacteria | 951 |
| 84 | Ga0068857_101142520 | 3300005577 | Unclassified | 753 |
| 85 | Ga0070702_100007398 | 3300005615 | Bacteria | 5257 |
| 86 | Ga0068852_100343737 | 3300005616 | Bacteria | 1455 |
| 87 | Ga0068852_101067372 | 3300005616 | Unclassified | 827 |
| 88 | Ga0068859_100011283 | 3300005617 | Bacteria | 8991 |
| 89 | Ga0068859_100014042 | 3300005617 | Bacteria | 8031 |
| 90 | Ga0068859_100288921 | 3300005617 | Bacteria | 1732 |
| 91 | Ga0068859_100645746 | 3300005617 | Bacteria | 1150 |
| 92 | Ga0068859_100823594 | 3300005617 | Unclassified | 1015 |
| 93 | Ga0068864_100001094 | 3300005618 | Bacteria | 22718 |
| 94 | Ga0068864_100228454 | 3300005618 | Unclassified | 1720 |
| 95 | Ga0068864_100483361 | 3300005618 | Bacteria | 1189 |
| 96 | Ga0068864_101058919 | 3300005618 | Bacteria | 806 |
| 97 | Ga0068866_10073404 | 3300005718 | Unclassified | 1815 |
| 98 | Ga0068861_100208124 | 3300005719 | Bacteria | 1646 |
| 99 | Ga0068870_10001396 | 3300005840 | Bacteria | 9746 |
| 100 | Ga0068863_100628449 | 3300005841 | Bacteria | 1064 |
| 101 | Ga0068858_100028754 | 3300005842 | Bacteria | 5162 |
| 102 | Ga0068858_100215509 | 3300005842 | Bacteria | 1817 |
| 103 | Ga0068858_100667810 | 3300005842 | Bacteria | 1010 |
| 104 | Ga0068862_100017498 | 3300005844 | Bacteria | 5970 |
| 105 | Ga0068862_100052003 | 3300005844 | Bacteria | 3504 |
| 106 | Ga0068862_100052522 | 3300005844 | Unclassified | 3487 |
| 107 | Ga0068862_101154603 | 3300005844 | Unclassified | 771 |
| 108 | Ga0081455_10585280 | 3300005937 | Bacteria | 731 |
| 109 | Ga0070717_10011421 | 3300006028 | Bacteria | 6744 |
| 110 | Ga0075363_100143876 | 3300006048 | Bacteria | 1344 |
| 111 | Ga0075364_10002574 | 3300006051 | Bacteria | 10168 |
| 112 | Ga0070715_10206381 | 3300006163 | Unclassified | 1001 |
| 113 | Ga0070712_100006993 | 3300006175 | Bacteria | 7033 |
| 114 | Ga0070712_100085384 | 3300006175 | Bacteria | 2298 |
| 115 | Ga0070712_100411240 | 3300006175 | Bacteria | 1119 |
| 116 | Ga0075362_10034526 | 3300006177 | Bacteria | 2205 |
| 117 | Ga0075367_10005535 | 3300006178 | Bacteria | 6288 |
| 118 | Ga0075366_10024811 | 3300006195 | Bacteria | 3497 |
| 119 | Ga0075366_10041900 | 3300006195 | Bacteria | 2711 |
| 120 | Ga0075370_10006811 | 3300006353 | Bacteria | 5777 |
| 121 | Ga0068871_100538251 | 3300006358 | Bacteria | 1056 |
| 122 | Ga0068871_100653644 | 3300006358 | Bacteria | 960 |
| 123 | Ga0075428_101086883 | 3300006844 | Bacteria | 845 |
| 124 | Ga0075428_101247231 | 3300006844 | Bacteria | 783 |
| 125 | Ga0075430_100155918 | 3300006846 | Bacteria | 1901 |
| 126 | Ga0075431_100007947 | 3300006847 | Bacteria | 10574 |
| 127 | Ga0075431_100943583 | 3300006847 | Bacteria | 831 |
| 128 | Ga0075433_10840810 | 3300006852 | Bacteria | 801 |
| 129 | Ga0075434_100022420 | 3300006871 | Bacteria | 6151 |
| 130 | Ga0075434_100216644 | 3300006871 | Bacteria | 1935 |
| 131 | Ga0075436_100051161 | 3300006914 | Viruses | 2851 |
| 132 | Ga0075436_100238498 | 3300006914 | Bacteria | 1293 |
| 133 | Ga0097620_100011281 | 3300006931 | Bacteria | 8991 |
| 134 | Ga0097620_100014042 | 3300006931 | Bacteria | 8031 |
| 135 | Ga0097620_100288920 | 3300006931 | Bacteria | 1732 |
| 136 | Ga0097620_100645793 | 3300006931 | Bacteria | 1150 |
| 137 | Ga0097620_100823597 | 3300006931 | Unclassified | 1015 |
| 138 | Ga0105240_10011296 | 3300009093 | Bacteria | 12444 |
| 139 | Ga0111539_10385697 | 3300009094 | Bacteria | 1631 |
| 140 | Ga0105247_10270729 | 3300009101 | Bacteria | 1168 |
| 141 | Ga0105247_10534634 | 3300009101 | Bacteria | 859 |
| 142 | Ga0105247_10629515 | 3300009101 | Bacteria | 799 |
| 143 | Ga0114129_10143042 | 3300009147 | Bacteria | 3277 |
| 144 | Ga0114129_10398585 | 3300009147 | Bacteria | 1814 |
| 145 | Ga0114129_10560851 | 3300009147 | Bacteria | 1484 |
| 146 | Ga0105243_10000996 | 3300009148 | Bacteria | 26244 |
| 147 | Ga0105241_10084903 | 3300009174 | Unclassified | 2487 |
| 148 | Ga0105241_10437883 | 3300009174 | Bacteria | 1154 |
| 149 | Ga0105241_10582581 | 3300009174 | Unclassified | 1008 |
| 150 | Ga0105242_10159973 | 3300009176 | Bacteria | 1970 |
| 151 | Ga0105242_10598744 | 3300009176 | Bacteria | 1064 |
| 152 | Ga0105242_10969697 | 3300009176 | Bacteria | 856 |
| 153 | Ga0105248_10068677 | 3300009177 | Bacteria | 3979 |
| 154 | Ga0105248_10138786 | 3300009177 | Bacteria | 2742 |
| 155 | Ga0105248_10264924 | 3300009177 | Unclassified | 1934 |
| 156 | Ga0105237_10001683 | 3300009545 | Bacteria | 28617 |
| 157 | Ga0105237_10533964 | 3300009545 | Bacteria | 1180 |
| 158 | Ga0105238_10015271 | 3300009551 | Bacteria | 7777 |
| 159 | Ga0105238_10182361 | 3300009551 | Bacteria | 2076 |
| 160 | Ga0105238_10265110 | 3300009551 | Unclassified | 1698 |
| 161 | Ga0105249_10623536 | 3300009553 | Bacteria | 1134 |
| 162 | Ga0105249_10806776 | 3300009553 | Bacteria | 1003 |
| 163 | Ga0105249_11086978 | 3300009553 | Bacteria | 870 |
| 164 | Ga0105239_10002819 | 3300010375 | Bacteria | 21741 |
| 165 | Ga0105239_10771897 | 3300010375 | Bacteria | 1101 |
| 166 | Ga0157370_10608548 | 3300013104 | Bacteria | 1000 |
| 167 | Ga0157369_11084006 | 3300013105 | Bacteria | 819 |
| 168 | Ga0157378_10000015 | 3300013297 | Bacteria | 143601 |
| 169 | Ga0157378_10218687 | 3300013297 | Bacteria | 1810 |
| 170 | Ga0163162_10726149 | 3300013306 | Bacteria | 1114 |
| 171 | Ga0157372_10032933 | 3300013307 | Bacteria | 5688 |
| 172 | Ga0157372_10034586 | 3300013307 | Bacteria | 5556 |
| 173 | Ga0157375_10006043 | 3300013308 | Bacteria | 10558 |
| 174 | Ga0157375_10061307 | 3300013308 | Unclassified | 3734 |
| 175 | Ga0157375_10399048 | 3300013308 | Bacteria | 1542 |
| 176 | Ga0157375_12503321 | 3300013308 | Bacteria | 616 |
| 177 | Ga0163163_10115414 | 3300014325 | Bacteria | 2717 |
| 178 | Ga0163163_10123336 | 3300014325 | Bacteria | 2626 |
| 179 | Ga0163163_11004943 | 3300014325 | Bacteria | 897 |
| 180 | Ga0157380_10091353 | 3300014326 | Bacteria | 2513 |
| 181 | Ga0157380_10224968 | 3300014326 | Bacteria | 1681 |
| 182 | Ga0157380_10288848 | 3300014326 | Unclassified | 1505 |
| 183 | Ga0157380_11911779 | 3300014326 | Unclassified | 654 |
| 184 | Ga0157377_10232439 | 3300014745 | Bacteria | 1186 |
| 185 | Ga0157379_10271898 | 3300014968 | Bacteria | 1541 |
| 186 | Ga0157379_10361718 | 3300014968 | Bacteria | 1330 |
| 187 | Ga0157376_10043523 | 3300014969 | Bacteria | 3685 |
| 188 | Ga0157376_10073169 | 3300014969 | Bacteria | 2918 |
| 189 | Ga0157376_10076551 | 3300014969 | Bacteria | 2859 |
| 190 | Ga0157376_12068755 | 3300014969 | Bacteria | 607 |
| 191 | Ga0182007_10094635 | 3300015262 | Bacteria | 985 |
| 192 | Ga0163161_10175644 | 3300017792 | Bacteria | 1640 |
| 193 | Ga0163161_10587002 | 3300017792 | Bacteria | 917 |
| 194 | Ga0163161_10628759 | 3300017792 | Bacteria | 888 |
| 195 | Ga0207697_10249697 | 3300025315 | Bacteria | 785 |
| 196 | Ga0207653_10183191 | 3300025885 | Bacteria | 784 |
| 197 | Ga0207692_10010443 | 3300025898 | Bacteria | 3912 |
| 198 | Ga0207692_10075734 | 3300025898 | Unclassified | 1786 |
| 199 | Ga0207710_10057290 | 3300025900 | Bacteria | 1760 |
| 200 | Ga0207688_10174778 | 3300025901 | Bacteria | 1278 |
| 201 | Ga0207680_10320618 | 3300025903 | Bacteria | 1083 |
| 202 | Ga0207685_10085093 | 3300025905 | Bacteria | 1318 |
| 203 | Ga0207643_10015698 | 3300025908 | Bacteria | 4124 |
| 204 | Ga0207684_10001536 | 3300025910 | Bacteria | 24717 |
| 205 | Ga0207684_10030053 | 3300025910 | Bacteria | 4626 |
| 206 | Ga0207684_10962999 | 3300025910 | Bacteria | 715 |
| 207 | Ga0207684_11189982 | 3300025910 | Bacteria | 631 |
| 208 | Ga0207707_10557188 | 3300025912 | Bacteria | 973 |
| 209 | Ga0207695_10028305 | 3300025913 | Bacteria | 6219 |
| 210 | Ga0207671_10006284 | 3300025914 | Bacteria | 10609 |
| 211 | Ga0207693_10010700 | 3300025915 | Bacteria | 7447 |
| 212 | Ga0207693_10171851 | 3300025915 | Bacteria | 1706 |
| 213 | Ga0207693_10330506 | 3300025915 | Bacteria | 1193 |
| 214 | Ga0207663_10041856 | 3300025916 | Unclassified | 2795 |
| 215 | Ga0207662_10029724 | 3300025918 | Bacteria | 3168 |
| 216 | Ga0207662_10238788 | 3300025918 | Bacteria | 1189 |
| 217 | Ga0207652_10286648 | 3300025921 | Bacteria | 1486 |
| 218 | Ga0207681_10132693 | 3300025923 | Bacteria | 1844 |
| 219 | Ga0207681_10151146 | 3300025923 | Unclassified | 1740 |
| 220 | Ga0207694_10083657 | 3300025924 | Bacteria | 2509 |
| 221 | Ga0207650_10021490 | 3300025925 | Bacteria | 4560 |
| 222 | Ga0207650_10035327 | 3300025925 | Bacteria | 3628 |
| 223 | Ga0207659_10099258 | 3300025926 | Bacteria | 2192 |
| 224 | Ga0207659_10113553 | 3300025926 | Bacteria | 2063 |
| 225 | Ga0207659_10290068 | 3300025926 | Bacteria | 1340 |
| 226 | Ga0207687_10196379 | 3300025927 | Bacteria | 1574 |
| 227 | Ga0207700_10228090 | 3300025928 | Unclassified | 1582 |
| 228 | Ga0207664_10197518 | 3300025929 | Unclassified | 1735 |
| 229 | Ga0207644_10425222 | 3300025931 | Unclassified | 1089 |
| 230 | Ga0207706_10309720 | 3300025933 | Bacteria | 1375 |
| 231 | Ga0207686_10125131 | 3300025934 | Bacteria | 1756 |
| 232 | Ga0207709_10001187 | 3300025935 | Bacteria | 18824 |
| 233 | Ga0207670_10159106 | 3300025936 | Bacteria | 1684 |
| 234 | Ga0207691_10200110 | 3300025940 | Unclassified | 1739 |
| 235 | Ga0207691_10381443 | 3300025940 | Unclassified | 1203 |
| 236 | Ga0207691_10876272 | 3300025940 | Bacteria | 752 |
| 237 | Ga0207711_10189654 | 3300025941 | Unclassified | 1873 |
| 238 | Ga0207661_10126725 | 3300025944 | Bacteria | 2181 |
| 239 | Ga0207651_10261681 | 3300025960 | Bacteria | 1421 |
| 240 | Ga0207712_10473186 | 3300025961 | Unclassified | 1066 |
| 241 | Ga0207658_10254854 | 3300025986 | Bacteria | 1493 |
| 242 | Ga0207658_10370903 | 3300025986 | Bacteria | 1251 |
| 243 | Ga0207678_10141699 | 3300026067 | Bacteria | 2052 |
| 244 | Ga0207641_10249276 | 3300026088 | Bacteria | 1658 |
| 245 | Ga0207648_10148300 | 3300026089 | Bacteria | 2070 |
| 246 | Ga0207676_10234782 | 3300026095 | Bacteria | 1642 |
| 247 | Ga0207676_10632053 | 3300026095 | Unclassified | 1031 |
| 248 | Ga0207676_11233628 | 3300026095 | Bacteria | 742 |
| 249 | Ga0207676_11333223 | 3300026095 | Unclassified | 713 |
| 250 | Ga0207674_10116463 | 3300026116 | Unclassified | 2643 |
| 251 | Ga0207674_10399289 | 3300026116 | Unclassified | 1329 |
| 252 | Ga0207674_10846677 | 3300026116 | Bacteria | 882 |
| 253 | Ga0207675_100568624 | 3300026118 | Bacteria | 1134 |
| 254 | Ga0207675_100612747 | 3300026118 | Bacteria | 1092 |
| 255 | Ga0207675_100930549 | 3300026118 | Bacteria | 886 |
| 256 | Ga0207683_10977535 | 3300026121 | Bacteria | 786 |
| 257 | Ga0207698_10701373 | 3300026142 | Bacteria | 1007 |
| 258 | Ga0268265_10027580 | 3300028380 | Unclassified | 4055 |
| 259 | Ga0268265_10028037 | 3300028380 | Bacteria | 4028 |
| 260 | Ga0268265_10558318 | 3300028380 | Bacteria | 1088 |
| 261 | Ga0268264_10052810 | 3300028381 | Unclassified | 3389 |
| 262 | Ga0268264_10093358 | 3300028381 | Bacteria | 2599 |
| 263 | Ga0268264_11544901 | 3300028381 | Bacteria | 674 |
| 264 | Ga0316177_1045804 | 3300030731 | Bacteria | 987 |
| 265 | Ga0307408_100362913 | 3300031548 | Bacteria | 1233 |
| 266 | Ga0316576_10052011 | 3300031727 | Bacteria | 2982 |
| 267 | Ga0307409_100592056 | 3300031995 | Bacteria | 1095 |
| 268 | Ga0307416_100035412 | 3300032002 | Bacteria | 3812 |
| 269 | Ga0307416_100124568 | 3300032002 | Bacteria | 2306 |
| 270 | Ga0316583_10000989 | 3300032133 | Bacteria | 9138 |
| 271 | Ga0373936_0019359 | 3300035113 | Bacteria | 2637 |
| 272 | Ga0373939_0044604 | 3300035114 | Bacteria | 1350 |
| 273 | Ga0373955_0115108 | 3300035172 | Bacteria | 1558 |
| 274 | Ga0373955_0379631 | 3300035172 | Bacteria | 858 |
| 275 | Ga0373935_0089201 | 3300035692 | Bacteria | 2016 |
| 276 | Ga0373927_0449944 | 3300035695 | Bacteria | 851 |
| 277 | Ga0373947_0126186 | 3300035725 | Bacteria | 1630 |
| 278 | Ga0373947_0168781 | 3300035725 | Bacteria | 1419 |
| 279 | Ga0373937_0001923 | 3300036401 | Bacteria | 17365 |
| 280 | Ga0373937_0536538 | 3300036401 | Bacteria | 1111 |
| 281 | Ga0316582_0172665 | 3300036647 | Bacteria | 1468 |
| 282 | Ga0316584_0048353 | 3300036712 | Bacteria | 3178 |
| 283 | Ga0373925_0634836 | 3300037068 | Bacteria | 880 |
| 284 | Ga0395899_0023366 | 3300037312 | Bacteria | 4683 |
| 285 | Ga0395900_0009078 | 3300037418 | Bacteria | 10191 |
| 286 | Ga0395898_0025330 | 3300037466 | Bacteria | 5979 |
| 287 | Ga0395901_0000661 | 3300038443 | Bacteria | 39682 |
| 288 | Ga0395901_0948409 | 3300038443 | Bacteria | 839 |
| 289 | Ga0400490_31829 | 3300038726 | Bacteria | 2212 |
| 290 | Ga0400489_09922 | 3300039093 | Bacteria | 25644 |
| 291 | Ga0439436_0039872 | 3300041404 | Bacteria | 1347 |
| 292 | Ga0439447_078913 | 3300041407 | Bacteria | 761 |
| 293 | Ga0439461_0005128 | 3300041410 | Bacteria | 2219 |
| 294 | Ga0439466_0060080 | 3300041411 | Bacteria | 1226 |
| 295 | Ga0439431_0115635 | 3300041997 | Bacteria | 745 |
| 296 | Ga0439433_0000609 | 3300041999 | Bacteria | 6829 |
| 297 | Ga0439442_008667 | 3300042002 | Bacteria | 2054 |
| 298 | Ga0439432_000968 | 3300042006 | Bacteria | 10835 |
| 299 | Ga0439449_0004082 | 3300042007 | Bacteria | 5652 |
| 300 | Ga0439463_034029 | 3300042016 | Bacteria | 1289 |
| 301 | Ga0450911_000004 | 3300042115 | Bacteria | 234537 |
| 302 | Ga0450904_000210 | 3300042139 | Bacteria | 12706 |
| 303 | Ga0439434_0010457 | 3300042435 | Bacteria | 2734 |
| 304 | Ga0439435_0001633 | 3300042436 | Bacteria | 4216 |
| 305 | Ga0439459_0031603 | 3300042438 | Bacteria | 1080 |
| 306 | Ga0450893_0003084 | 3300042532 | Bacteria | 2619 |
| 307 | Ga0439440_0021057 | 3300042993 | Bacteria | 1467 |
| 308 | Ga0451576_0140474 | 3300045051 | Bacteria | 2519 |
| 309 | Ga0466967_0107205 | 3300045976 | Bacteria | 2562 |
| 310 | Ga0495592_0233315 | 3300046454 | Bacteria | 1224 |
| 311 | Ga0495590_0001294 | 3300046457 | Bacteria | 10880 |
| 312 | Ga0495629_0340681 | 3300046459 | Bacteria | 1024 |
| 313 | Ga0495653_0089198 | 3300046463 | Bacteria | 2260 |
| 314 | Ga0495580_0001795 | 3300046472 | Bacteria | 18858 |
| 315 | Ga0495580_0484877 | 3300046472 | Bacteria | 826 |
| 316 | Ga0495582_0267200 | 3300046473 | Bacteria | 981 |
| 317 | Ga0495584_0177116 | 3300046491 | Bacteria | 1084 |
| 318 | Ga0495608_0072219 | 3300046511 | Bacteria | 2251 |
| 319 | Ga0495645_0006118 | 3300046543 | Bacteria | 8328 |
| 320 | Ga0495667_0000715 | 3300046559 | Bacteria | 21273 |
| 321 | Ga0495668_0515014 | 3300046616 | Bacteria | 660 |
| 322 | Ga0495635_0002992 | 3300046663 | Bacteria | 11597 |
| 323 | Ga0495657_0036301 | 3300046675 | Bacteria | 3407 |
| 324 | Ga0495599_0053748 | 3300046678 | Bacteria | 2523 |
| 325 | Ga0495599_0201671 | 3300046678 | Bacteria | 1222 |
| 326 | Ga0495623_0094033 | 3300046679 | Bacteria | 1834 |
| 327 | Ga0495646_0038283 | 3300046680 | Unclassified | 2962 |
| 328 | Ga0495646_0319285 | 3300046680 | Bacteria | 818 |
| 329 | Ga0495647_0099479 | 3300046681 | Bacteria | 1203 |
| 330 | Ga0495613_0238244 | 3300046689 | Bacteria | 1273 |
| 331 | Ga0495600_0053077 | 3300046809 | Bacteria | 2647 |
| 332 | Ga0495600_0140403 | 3300046809 | Bacteria | 1567 |
| 333 | Ga0495581_0396727 | 3300047315 | Bacteria | 805 |
| 334 | Ga0495604_0051724 | 3300047317 | Bacteria | 3183 |
| 335 | Ga0495604_0535643 | 3300047317 | Bacteria | 756 |
| 336 | Ga0495680_0003225 | 3300047322 | Bacteria | 16201 |
| 337 | Ga0495684_0053748 | 3300047471 | Bacteria | 3073 |
| 338 | Ga0495684_0155582 | 3300047471 | Bacteria | 1707 |
| 339 | Ga0495686_0002413 | 3300047472 | Bacteria | 17723 |
| 340 | Ga0495602_0119016 | 3300048088 | Bacteria | 2129 |
| 341 | Ga0496100_0113237 | 3300048903 | Bacteria | 1888 |
| 342 | Ga0496107_0695857 | 3300048910 | Unclassified | 748 |
| 343 | Ga0496108_0073481 | 3300048911 | Bacteria | 2887 |
| 344 | Ga0496108_0348473 | 3300048911 | Bacteria | 1292 |
| 345 | Ga0496112_0000122 | 3300048915 | Bacteria | 48608 |
| 346 | Ga0496125_0072230 | 3300048928 | Bacteria | 2690 |
| 347 | Ga0501031_0349345 | 3300049568 | Bacteria | 957 |
| 348 | Ga0501032_0765723 | 3300049569 | Bacteria | 610 |
| 349 | Ga0501036_0118628 | 3300049572 | Bacteria | 2234 |
| 350 | Ga0501036_0914518 | 3300049572 | Bacteria | 720 |
| 351 | Ga0501038_0169419 | 3300049574 | Bacteria | 1769 |
| 352 | Ga0501039_0038010 | 3300049575 | Bacteria | 3718 |
| 353 | Ga0501039_0093397 | 3300049575 | Bacteria | 2345 |
| 354 | Ga0501040_0051755 | 3300049576 | Bacteria | 2809 |
| 355 | Ga0501041_0004269 | 3300049577 | Bacteria | 8273 |
| 356 | Ga0501042_0058561 | 3300049578 | Bacteria | 2750 |
| 357 | Ga0501043_0148029 | 3300049579 | Bacteria | 1838 |
| 358 | Ga0501048_0037352 | 3300049582 | Bacteria | 3488 |
| 359 | Ga0501071_0353749 | 3300049587 | Bacteria | 1118 |
| 360 | Ga0501072_0172202 | 3300049588 | Bacteria | 1727 |
| 361 | Ga0501076_0022427 | 3300049592 | Bacteria | 4853 |
| 362 | Ga0501235_043386 | 3300049669 | Bacteria | 1032 |
| 363 | Ga0501079_0042715 | 3300049741 | Bacteria | 3500 |
| 364 | Ga0501081_0418153 | 3300049743 | Bacteria | 994 |
| 365 | Ga0501035_0144613 | 3300049822 | Bacteria | 2066 |
| 366 | Ga0501045_0008831 | 3300049824 | Bacteria | 7039 |
| 367 | Ga0501226_000003 | 3300049853 | Bacteria | 358977 |
| 368 | nmdc:mga03683_4157_c1 | 3300050489 | Bacteria | 4763 |
| 369 | nmdc:mga00v17_34193_c1 | 3300050491 | Bacteria | 3017 |
| 370 | nmdc:mga0k408_26759_c1 | 3300050493 | Bacteria | 3272 |
| 371 | nmdc:mga06z11_181208_c1 | 3300050494 | Bacteria | 1215 |
| 372 | nmdc:mga05p37_1237564_c1 | 3300050507 | Unclassified | 767 |
| 373 | nmdc:mga05p37_302649_c1 | 3300050507 | Bacteria | 1899 |
| 374 | nmdc:mga0qj67_110089_c1 | 3300050509 | Bacteria | 2223 |
| 375 | nmdc:mga06r32_10603_c1 | 3300050510 | Bacteria | 8310 |
| 376 | nmdc:mga0n895_19806_c1 | 3300050512 | Bacteria | 6260 |
| 377 | nmdc:mga0n895_90213_c1 | 3300050512 | Bacteria | 3066 |
| 378 | nmdc:mga0rr50_94190_c1 | 3300050513 | Bacteria | 2338 |
| 379 | nmdc:mga08x19_10974_c1 | 3300050514 | Bacteria | 5450 |
| 380 | nmdc:mga08x19_314442_c1 | 3300050514 | Bacteria | 1089 |
| 381 | nmdc:mga0a205_147027_c1 | 3300050515 | Bacteria | 2257 |
| 382 | nmdc:mga0a205_267865_c1 | 3300050515 | Bacteria | 1585 |
| 383 | nmdc:mga0a205_728638_c1 | 3300050515 | Bacteria | 841 |
| 384 | nmdc:mga0a205_889333_c1 | 3300050515 | Bacteria | 737 |
| 385 | Ga0500616_0000928 | 3300053153 | Bacteria | 32046 |
| 386 | Ga0500616_0002505 | 3300053153 | Bacteria | 15205 |
| 387 | Ga0501084_1096223 | 3300054114 | Bacteria | 668 |
| 388 | Ga0530510_0006279 | 3300061734 | Bacteria | 8270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0765723 | Ga0501032_0765723_27_488 | 129 |
| 2 | 3300046678 | Ga0495599_0201671 | Ga0495599_0201671_730_1200 | 132 |
| 3 | iso_pu_bacteria | 2734482264 | 2735836967 | 140 |
| 4 | iso_pu_bacteria | 2738543009 | 2739226412 | 140 |
| 5 | iso_pu_bacteria | 2739367700 | 2739731123 | 140 |
| 6 | iso_pu_bacteria | 2895395659 | 2895398981 | 140 |
| 7 | iso_pu_bacteria | 2928963466 | 2928967170 | 140 |
| 8 | iso_pu_bacteria | 2885192300 | 2885193918 | 141 |
| 9 | iso_pu_bacteria | 8057568493 | 8057574818 | 141 |
| 10 | 3300031995 | Ga0307409_100592056 | Ga0307409_1005920562 | 142 |
| 11 | 3300032002 | Ga0307416_100035412 | Ga0307416_1000354124 | 142 |
| 12 | 3300053153 | Ga0500616_0002505 | Ga0500616_0002505_7283_7795 | 142 |
| 13 | iso_pu_bacteria | 2808606373 | 2808903846 | 142 |
| 14 | 3300003322 | rootL2_10257985 | rootL2_102579852 | 143 |
| 15 | 3300005295 | Ga0065707_10293949 | Ga0065707_102939492 | 143 |
| 16 | 3300005330 | Ga0070690_100045624 | Ga0070690_1000456243 | 143 |
| 17 | 3300005335 | Ga0070666_10131270 | Ga0070666_101312701 | 143 |
| 18 | 3300005340 | Ga0070689_100726613 | Ga0070689_1007266131 | 143 |
| 19 | 3300005353 | Ga0070669_100641464 | Ga0070669_1006414642 | 143 |
| 20 | 3300005356 | Ga0070674_100771171 | Ga0070674_1007711712 | 143 |
| 21 | 3300005367 | Ga0070667_100291114 | Ga0070667_1002911143 | 143 |
| 22 | 3300005367 | Ga0070667_100707051 | Ga0070667_1007070512 | 143 |
| 23 | 3300005543 | Ga0070672_100077430 | Ga0070672_1000774304 | 143 |
| 24 | 3300005544 | Ga0070686_100312496 | Ga0070686_1003124962 | 143 |
| 25 | 3300005577 | Ga0068857_101142520 | Ga0068857_1011425201 | 143 |
| 26 | 3300005616 | Ga0068852_101067372 | Ga0068852_1010673722 | 143 |
| 27 | 3300005618 | Ga0068864_101058919 | Ga0068864_1010589192 | 143 |
| 28 | 3300005841 | Ga0068863_100628449 | Ga0068863_1006284492 | 143 |
| 29 | 3300005844 | Ga0068862_100017498 | Ga0068862_1000174987 | 143 |
| 30 | 3300009101 | Ga0105247_10270729 | Ga0105247_102707292 | 143 |
| 31 | 3300009176 | Ga0105242_10159973 | Ga0105242_101599732 | 143 |
| 32 | 3300009176 | Ga0105242_10969697 | Ga0105242_109696972 | 143 |
| 33 | 3300009551 | Ga0105238_10265110 | Ga0105238_102651102 | 143 |
| 34 | 3300013306 | Ga0163162_10726149 | Ga0163162_107261491 | 143 |
| 35 | 3300013308 | Ga0157375_10061307 | Ga0157375_100613074 | 143 |
| 36 | 3300014326 | Ga0157380_10288848 | Ga0157380_102888482 | 143 |
| 37 | 3300030731 | Ga0316177_1045804 | Ga0316177_10458042 | 143 |
| 38 | 3300035113 | Ga0373936_0019359 | Ga0373936_0019359_1348_1860 | 143 |
| 39 | 3300035172 | Ga0373955_0115108 | Ga0373955_0115108_750_1262 | 143 |
| 40 | 3300035692 | Ga0373935_0089201 | Ga0373935_0089201_1073_1585 | 143 |
| 41 | 3300035725 | Ga0373947_0126186 | Ga0373947_0126186_948_1460 | 143 |
| 42 | 3300036401 | Ga0373937_0001923 | Ga0373937_0001923_6575_7087 | 143 |
| 43 | 3300042016 | Ga0439463_034029 | Ga0439463_034029_499_1014 | 143 |
| 44 | 3300042993 | Ga0439440_0021057 | Ga0439440_0021057_134_649 | 143 |
| 45 | 3300046454 | Ga0495592_0233315 | Ga0495592_0233315_337_849 | 143 |
| 46 | 3300046463 | Ga0495653_0089198 | Ga0495653_0089198_823_1335 | 143 |
| 47 | 3300046473 | Ga0495582_0267200 | Ga0495582_0267200_410_925 | 143 |
| 48 | 3300046511 | Ga0495608_0072219 | Ga0495608_0072219_168_680 | 143 |
| 49 | 3300046559 | Ga0495667_0000715 | Ga0495667_0000715_13281_13793 | 143 |
| 50 | 3300046663 | Ga0495635_0002992 | Ga0495635_0002992_4480_4992 | 143 |
| 51 | 3300046675 | Ga0495657_0036301 | Ga0495657_0036301_2481_2993 | 143 |
| 52 | 3300046680 | Ga0495646_0319285 | Ga0495646_0319285_15_527 | 143 |
| 53 | 3300046809 | Ga0495600_0053077 | Ga0495600_0053077_814_1326 | 143 |
| 54 | 3300047317 | Ga0495604_0535643 | Ga0495604_0535643_112_624 | 143 |
| 55 | 3300047322 | Ga0495680_0003225 | Ga0495680_0003225_12842_13354 | 143 |
| 56 | 3300047471 | Ga0495684_0053748 | Ga0495684_0053748_2499_3011 | 143 |
| 57 | 3300048903 | Ga0496100_0113237 | Ga0496100_0113237_126_641 | 143 |
| 58 | 3300050515 | nmdc:mga0a205_267865_c1 | nmdc:mga0a205_267865_c1_750_1268 | 143 |
| 59 | 3300002737 | JGI25162J39368_1000707 | JGI25162J39368_100070712 | 144 |
| 60 | 3300003320 | rootH2_10030489 | rootH2_100304894 | 144 |
| 61 | 3300003320 | rootH2_10271950 | rootH2_102719502 | 144 |
| 62 | 3300003322 | rootL2_10054932 | rootL2_100549327 | 144 |
| 63 | 3300003323 | rootH1_10284792 | rootH1_102847926 | 144 |
| 64 | 3300003323 | rootH1_10358618 | rootH1_103586183 | 144 |
| 65 | 3300003762 | Ga0055542_1000223 | Ga0055542_100022321 | 144 |
| 66 | 3300005262 | Ga0065165_1015936 | Ga0065165_10159364 | 144 |
| 67 | 3300005293 | Ga0065715_10549411 | Ga0065715_105494111 | 144 |
| 68 | 3300005295 | Ga0065707_10089702 | Ga0065707_100897022 | 144 |
| 69 | 3300005327 | Ga0070658_10188211 | Ga0070658_101882112 | 144 |
| 70 | 3300005329 | Ga0070683_100048561 | Ga0070683_1000485614 | 144 |
| 71 | 3300005331 | Ga0070670_100018852 | Ga0070670_1000188526 | 144 |
| 72 | 3300005331 | Ga0070670_100029904 | Ga0070670_1000299044 | 144 |
| 73 | 3300005331 | Ga0070670_100417635 | Ga0070670_1004176352 | 144 |
| 74 | 3300005340 | Ga0070689_100073803 | Ga0070689_1000738031 | 144 |
| 75 | 3300005340 | Ga0070689_100901627 | Ga0070689_1009016272 | 144 |
| 76 | 3300005343 | Ga0070687_100178839 | Ga0070687_1001788392 | 144 |
| 77 | 3300005343 | Ga0070687_100388576 | Ga0070687_1003885762 | 144 |
| 78 | 3300005347 | Ga0070668_100683215 | Ga0070668_1006832151 | 144 |
| 79 | 3300005353 | Ga0070669_100465239 | Ga0070669_1004652392 | 144 |
| 80 | 3300005354 | Ga0070675_100435610 | Ga0070675_1004356102 | 144 |
| 81 | 3300005356 | Ga0070674_100085475 | Ga0070674_1000854753 | 144 |
| 82 | 3300005364 | Ga0070673_100579890 | Ga0070673_1005798902 | 144 |
| 83 | 3300005406 | Ga0070703_10331818 | Ga0070703_103318181 | 144 |
| 84 | 3300005434 | Ga0070709_10013545 | Ga0070709_100135452 | 144 |
| 85 | 3300005435 | Ga0070714_100034209 | Ga0070714_1000342092 | 144 |
| 86 | 3300005436 | Ga0070713_100016390 | Ga0070713_1000163903 | 144 |
| 87 | 3300005436 | Ga0070713_100979776 | Ga0070713_1009797762 | 144 |
| 88 | 3300005437 | Ga0070710_10072397 | Ga0070710_100723973 | 144 |
| 89 | 3300005438 | Ga0070701_10048753 | Ga0070701_100487533 | 144 |
| 90 | 3300005438 | Ga0070701_10188807 | Ga0070701_101888071 | 144 |
| 91 | 3300005439 | Ga0070711_100059933 | Ga0070711_1000599334 | 144 |
| 92 | 3300005439 | Ga0070711_100235256 | Ga0070711_1002352562 | 144 |
| 93 | 3300005440 | Ga0070705_100109133 | Ga0070705_1001091332 | 144 |
| 94 | 3300005440 | Ga0070705_101213671 | Ga0070705_1012136711 | 144 |
| 95 | 3300005441 | Ga0070700_100029553 | Ga0070700_1000295534 | 144 |
| 96 | 3300005444 | Ga0070694_100073264 | Ga0070694_1000732643 | 144 |
| 97 | 3300005444 | Ga0070694_100297183 | Ga0070694_1002971831 | 144 |
| 98 | 3300005445 | Ga0070708_100000237 | Ga0070708_10000023716 | 144 |
| 99 | 3300005445 | Ga0070708_100224138 | Ga0070708_1002241381 | 144 |
| 100 | 3300005445 | Ga0070708_100823485 | Ga0070708_1008234851 | 144 |
| 101 | 3300005456 | Ga0070678_101102542 | Ga0070678_1011025421 | 144 |
| 102 | 3300005459 | Ga0068867_100836239 | Ga0068867_1008362392 | 144 |
| 103 | 3300005467 | Ga0070706_100001593 | Ga0070706_10000159313 | 144 |
| 104 | 3300005468 | Ga0070707_100051028 | Ga0070707_1000510284 | 144 |
| 105 | 3300005471 | Ga0070698_100001354 | Ga0070698_10000135412 | 144 |
| 106 | 3300005471 | Ga0070698_100047475 | Ga0070698_1000474751 | 144 |
| 107 | 3300005471 | Ga0070698_100220755 | Ga0070698_1002207552 | 144 |
| 108 | 3300005518 | Ga0070699_100101623 | Ga0070699_1001016232 | 144 |
| 109 | 3300005518 | Ga0070699_100171861 | Ga0070699_1001718612 | 144 |
| 110 | 3300005518 | Ga0070699_101002069 | Ga0070699_1010020692 | 144 |
| 111 | 3300005530 | Ga0070679_100294754 | Ga0070679_1002947542 | 144 |
| 112 | 3300005530 | Ga0070679_100747712 | Ga0070679_1007477122 | 144 |
| 113 | 3300005535 | Ga0070684_100100996 | Ga0070684_1001009964 | 144 |
| 114 | 3300005535 | Ga0070684_100177314 | Ga0070684_1001773143 | 144 |
| 115 | 3300005536 | Ga0070697_100000140 | Ga0070697_10000014024 | 144 |
| 116 | 3300005536 | Ga0070697_100137905 | Ga0070697_1001379052 | 144 |
| 117 | 3300005536 | Ga0070697_100886825 | Ga0070697_1008868251 | 144 |
| 118 | 3300005543 | Ga0070672_100294219 | Ga0070672_1002942192 | 144 |
| 119 | 3300005543 | Ga0070672_100335661 | Ga0070672_1003356612 | 144 |
| 120 | 3300005546 | Ga0070696_100325462 | Ga0070696_1003254622 | 144 |
| 121 | 3300005546 | Ga0070696_100588739 | Ga0070696_1005887392 | 144 |
| 122 | 3300005547 | Ga0070693_100389172 | Ga0070693_1003891721 | 144 |
| 123 | 3300005548 | Ga0070665_100065612 | Ga0070665_1000656121 | 144 |
| 124 | 3300005549 | Ga0070704_100017412 | Ga0070704_1000174123 | 144 |
| 125 | 3300005549 | Ga0070704_101111319 | Ga0070704_1011113191 | 144 |
| 126 | 3300005549 | Ga0070704_101354321 | Ga0070704_1013543211 | 144 |
| 127 | 3300005549 | Ga0070704_101514600 | Ga0070704_1015146001 | 144 |
| 128 | 3300005563 | Ga0068855_100248334 | Ga0068855_1002483342 | 144 |
| 129 | 3300005577 | Ga0068857_100312327 | Ga0068857_1003123274 | 144 |
| 130 | 3300005577 | Ga0068857_100717005 | Ga0068857_1007170052 | 144 |
| 131 | 3300005615 | Ga0070702_100007398 | Ga0070702_1000073984 | 144 |
| 132 | 3300005616 | Ga0068852_100343737 | Ga0068852_1003437373 | 144 |
| 133 | 3300005617 | Ga0068859_100011283 | Ga0068859_1000112837 | 144 |
| 134 | 3300005617 | Ga0068859_100014042 | Ga0068859_1000140426 | 144 |
| 135 | 3300005617 | Ga0068859_100288921 | Ga0068859_1002889213 | 144 |
| 136 | 3300005617 | Ga0068859_100645746 | Ga0068859_1006457462 | 144 |
| 137 | 3300005617 | Ga0068859_100823594 | Ga0068859_1008235942 | 144 |
| 138 | 3300005618 | Ga0068864_100001094 | Ga0068864_10000109410 | 144 |
| 139 | 3300005618 | Ga0068864_100228454 | Ga0068864_1002284542 | 144 |
| 140 | 3300005618 | Ga0068864_100483361 | Ga0068864_1004833612 | 144 |
| 141 | 3300005718 | Ga0068866_10073404 | Ga0068866_100734042 | 144 |
| 142 | 3300005719 | Ga0068861_100208124 | Ga0068861_1002081242 | 144 |
| 143 | 3300005840 | Ga0068870_10001396 | Ga0068870_100013963 | 144 |
| 144 | 3300005842 | Ga0068858_100028754 | Ga0068858_1000287543 | 144 |
| 145 | 3300005842 | Ga0068858_100215509 | Ga0068858_1002155092 | 144 |
| 146 | 3300005842 | Ga0068858_100667810 | Ga0068858_1006678102 | 144 |
| 147 | 3300005844 | Ga0068862_100052003 | Ga0068862_1000520034 | 144 |
| 148 | 3300005844 | Ga0068862_100052522 | Ga0068862_1000525224 | 144 |
| 149 | 3300005844 | Ga0068862_101154603 | Ga0068862_1011546031 | 144 |
| 150 | 3300005937 | Ga0081455_10585280 | Ga0081455_105852802 | 144 |
| 151 | 3300006028 | Ga0070717_10011421 | Ga0070717_100114215 | 144 |
| 152 | 3300006048 | Ga0075363_100143876 | Ga0075363_1001438761 | 144 |
| 153 | 3300006051 | Ga0075364_10002574 | Ga0075364_100025747 | 144 |
| 154 | 3300006163 | Ga0070715_10206381 | Ga0070715_102063812 | 144 |
| 155 | 3300006175 | Ga0070712_100006993 | Ga0070712_1000069935 | 144 |
| 156 | 3300006175 | Ga0070712_100085384 | Ga0070712_1000853842 | 144 |
| 157 | 3300006175 | Ga0070712_100411240 | Ga0070712_1004112402 | 144 |
| 158 | 3300006177 | Ga0075362_10034526 | Ga0075362_100345261 | 144 |
| 159 | 3300006178 | Ga0075367_10005535 | Ga0075367_100055355 | 144 |
| 160 | 3300006195 | Ga0075366_10024811 | Ga0075366_100248112 | 144 |
| 161 | 3300006195 | Ga0075366_10041900 | Ga0075366_100419002 | 144 |
| 162 | 3300006353 | Ga0075370_10006811 | Ga0075370_100068115 | 144 |
| 163 | 3300006358 | Ga0068871_100538251 | Ga0068871_1005382512 | 144 |
| 164 | 3300006358 | Ga0068871_100653644 | Ga0068871_1006536442 | 144 |
| 165 | 3300006844 | Ga0075428_101086883 | Ga0075428_1010868832 | 144 |
| 166 | 3300006844 | Ga0075428_101247231 | Ga0075428_1012472311 | 144 |
| 167 | 3300006846 | Ga0075430_100155918 | Ga0075430_1001559184 | 144 |
| 168 | 3300006847 | Ga0075431_100007947 | Ga0075431_1000079477 | 144 |
| 169 | 3300006847 | Ga0075431_100943583 | Ga0075431_1009435831 | 144 |
| 170 | 3300006852 | Ga0075433_10840810 | Ga0075433_108408101 | 144 |
| 171 | 3300006871 | Ga0075434_100022420 | Ga0075434_1000224206 | 144 |
| 172 | 3300006871 | Ga0075434_100216644 | Ga0075434_1002166444 | 144 |
| 173 | 3300006914 | Ga0075436_100051161 | Ga0075436_1000511615 | 144 |
| 174 | 3300006914 | Ga0075436_100238498 | Ga0075436_1002384982 | 144 |
| 175 | 3300006931 | Ga0097620_100011281 | Ga0097620_1000112815 | 144 |
| 176 | 3300006931 | Ga0097620_100014042 | Ga0097620_1000140426 | 144 |
| 177 | 3300006931 | Ga0097620_100288920 | Ga0097620_1002889202 | 144 |
| 178 | 3300006931 | Ga0097620_100645793 | Ga0097620_1006457932 | 144 |
| 179 | 3300006931 | Ga0097620_100823597 | Ga0097620_1008235972 | 144 |
| 180 | 3300009093 | Ga0105240_10011296 | Ga0105240_100112966 | 144 |
| 181 | 3300009094 | Ga0111539_10385697 | Ga0111539_103856972 | 144 |
| 182 | 3300009101 | Ga0105247_10534634 | Ga0105247_105346342 | 144 |
| 183 | 3300009101 | Ga0105247_10629515 | Ga0105247_106295152 | 144 |
| 184 | 3300009147 | Ga0114129_10143042 | Ga0114129_101430424 | 144 |
| 185 | 3300009147 | Ga0114129_10398585 | Ga0114129_103985852 | 144 |
| 186 | 3300009147 | Ga0114129_10560851 | Ga0114129_105608513 | 144 |
| 187 | 3300009148 | Ga0105243_10000996 | Ga0105243_1000099622 | 144 |
| 188 | 3300009174 | Ga0105241_10084903 | Ga0105241_100849032 | 144 |
| 189 | 3300009174 | Ga0105241_10437883 | Ga0105241_104378832 | 144 |
| 190 | 3300009174 | Ga0105241_10582581 | Ga0105241_105825812 | 144 |
| 191 | 3300009176 | Ga0105242_10598744 | Ga0105242_105987442 | 144 |
| 192 | 3300009177 | Ga0105248_10068677 | Ga0105248_100686772 | 144 |
| 193 | 3300009177 | Ga0105248_10138786 | Ga0105248_101387863 | 144 |
| 194 | 3300009177 | Ga0105248_10264924 | Ga0105248_102649242 | 144 |
| 195 | 3300009545 | Ga0105237_10001683 | Ga0105237_1000168323 | 144 |
| 196 | 3300009545 | Ga0105237_10533964 | Ga0105237_105339642 | 144 |
| 197 | 3300009551 | Ga0105238_10015271 | Ga0105238_100152716 | 144 |
| 198 | 3300009551 | Ga0105238_10182361 | Ga0105238_101823612 | 144 |
| 199 | 3300009553 | Ga0105249_10623536 | Ga0105249_106235363 | 144 |
| 200 | 3300009553 | Ga0105249_10806776 | Ga0105249_108067762 | 144 |
| 201 | 3300009553 | Ga0105249_11086978 | Ga0105249_110869782 | 144 |
| 202 | 3300010375 | Ga0105239_10002819 | Ga0105239_100028196 | 144 |
| 203 | 3300010375 | Ga0105239_10771897 | Ga0105239_107718972 | 144 |
| 204 | 3300013104 | Ga0157370_10608548 | Ga0157370_106085481 | 144 |
| 205 | 3300013105 | Ga0157369_11084006 | Ga0157369_110840061 | 144 |
| 206 | 3300013297 | Ga0157378_10000015 | Ga0157378_1000001598 | 144 |
| 207 | 3300013297 | Ga0157378_10218687 | Ga0157378_102186872 | 144 |
| 208 | 3300013307 | Ga0157372_10032933 | Ga0157372_100329335 | 144 |
| 209 | 3300013307 | Ga0157372_10034586 | Ga0157372_100345864 | 144 |
| 210 | 3300013308 | Ga0157375_10006043 | Ga0157375_100060431 | 144 |
| 211 | 3300013308 | Ga0157375_10399048 | Ga0157375_103990481 | 144 |
| 212 | 3300013308 | Ga0157375_12503321 | Ga0157375_125033211 | 144 |
| 213 | 3300014325 | Ga0163163_10115414 | Ga0163163_101154144 | 144 |
| 214 | 3300014325 | Ga0163163_10123336 | Ga0163163_101233362 | 144 |
| 215 | 3300014325 | Ga0163163_11004943 | Ga0163163_110049433 | 144 |
| 216 | 3300014326 | Ga0157380_10091353 | Ga0157380_100913531 | 144 |
| 217 | 3300014326 | Ga0157380_10224968 | Ga0157380_102249682 | 144 |
| 218 | 3300014326 | Ga0157380_11911779 | Ga0157380_119117792 | 144 |
| 219 | 3300014745 | Ga0157377_10232439 | Ga0157377_102324391 | 144 |
| 220 | 3300014968 | Ga0157379_10271898 | Ga0157379_102718982 | 144 |
| 221 | 3300014968 | Ga0157379_10361718 | Ga0157379_103617182 | 144 |
| 222 | 3300014969 | Ga0157376_10043523 | Ga0157376_100435232 | 144 |
| 223 | 3300014969 | Ga0157376_10073169 | Ga0157376_100731692 | 144 |
| 224 | 3300014969 | Ga0157376_10076551 | Ga0157376_100765515 | 144 |
| 225 | 3300014969 | Ga0157376_12068755 | Ga0157376_120687551 | 144 |
| 226 | 3300015262 | Ga0182007_10094635 | Ga0182007_100946351 | 144 |
| 227 | 3300017792 | Ga0163161_10175644 | Ga0163161_101756444 | 144 |
| 228 | 3300017792 | Ga0163161_10587002 | Ga0163161_105870021 | 144 |
| 229 | 3300017792 | Ga0163161_10628759 | Ga0163161_106287591 | 144 |
| 230 | 3300025315 | Ga0207697_10249697 | Ga0207697_102496971 | 144 |
| 231 | 3300025885 | Ga0207653_10183191 | Ga0207653_101831912 | 144 |
| 232 | 3300025898 | Ga0207692_10010443 | Ga0207692_100104435 | 144 |
| 233 | 3300025898 | Ga0207692_10075734 | Ga0207692_100757342 | 144 |
| 234 | 3300025900 | Ga0207710_10057290 | Ga0207710_100572904 | 144 |
| 235 | 3300025901 | Ga0207688_10174778 | Ga0207688_101747781 | 144 |
| 236 | 3300025903 | Ga0207680_10320618 | Ga0207680_103206181 | 144 |
| 237 | 3300025905 | Ga0207685_10085093 | Ga0207685_100850932 | 144 |
| 238 | 3300025908 | Ga0207643_10015698 | Ga0207643_100156985 | 144 |
| 239 | 3300025910 | Ga0207684_10001536 | Ga0207684_1000153616 | 144 |
| 240 | 3300025910 | Ga0207684_10030053 | Ga0207684_100300535 | 144 |
| 241 | 3300025910 | Ga0207684_10962999 | Ga0207684_109629991 | 144 |
| 242 | 3300025910 | Ga0207684_11189982 | Ga0207684_111899821 | 144 |
| 243 | 3300025912 | Ga0207707_10557188 | Ga0207707_105571881 | 144 |
| 244 | 3300025913 | Ga0207695_10028305 | Ga0207695_100283052 | 144 |
| 245 | 3300025914 | Ga0207671_10006284 | Ga0207671_100062844 | 144 |
| 246 | 3300025915 | Ga0207693_10010700 | Ga0207693_100107005 | 144 |
| 247 | 3300025915 | Ga0207693_10171851 | Ga0207693_101718514 | 144 |
| 248 | 3300025915 | Ga0207693_10330506 | Ga0207693_103305061 | 144 |
| 249 | 3300025916 | Ga0207663_10041856 | Ga0207663_100418563 | 144 |
| 250 | 3300025918 | Ga0207662_10029724 | Ga0207662_100297242 | 144 |
| 251 | 3300025918 | Ga0207662_10238788 | Ga0207662_102387882 | 144 |
| 252 | 3300025921 | Ga0207652_10286648 | Ga0207652_102866483 | 144 |
| 253 | 3300025923 | Ga0207681_10132693 | Ga0207681_101326933 | 144 |
| 254 | 3300025923 | Ga0207681_10151146 | Ga0207681_101511462 | 144 |
| 255 | 3300025924 | Ga0207694_10083657 | Ga0207694_100836573 | 144 |
| 256 | 3300025925 | Ga0207650_10021490 | Ga0207650_100214904 | 144 |
| 257 | 3300025925 | Ga0207650_10035327 | Ga0207650_100353274 | 144 |
| 258 | 3300025926 | Ga0207659_10099258 | Ga0207659_100992583 | 144 |
| 259 | 3300025926 | Ga0207659_10113553 | Ga0207659_101135533 | 144 |
| 260 | 3300025926 | Ga0207659_10290068 | Ga0207659_102900682 | 144 |
| 261 | 3300025927 | Ga0207687_10196379 | Ga0207687_101963792 | 144 |
| 262 | 3300025928 | Ga0207700_10228090 | Ga0207700_102280903 | 144 |
| 263 | 3300025929 | Ga0207664_10197518 | Ga0207664_101975184 | 144 |
| 264 | 3300025931 | Ga0207644_10425222 | Ga0207644_104252222 | 144 |
| 265 | 3300025933 | Ga0207706_10309720 | Ga0207706_103097202 | 144 |
| 266 | 3300025934 | Ga0207686_10125131 | Ga0207686_101251313 | 144 |
| 267 | 3300025935 | Ga0207709_10001187 | Ga0207709_100011874 | 144 |
| 268 | 3300025936 | Ga0207670_10159106 | Ga0207670_101591062 | 144 |
| 269 | 3300025940 | Ga0207691_10200110 | Ga0207691_102001103 | 144 |
| 270 | 3300025940 | Ga0207691_10381443 | Ga0207691_103814432 | 144 |
| 271 | 3300025940 | Ga0207691_10876272 | Ga0207691_108762721 | 144 |
| 272 | 3300025941 | Ga0207711_10189654 | Ga0207711_101896542 | 144 |
| 273 | 3300025944 | Ga0207661_10126725 | Ga0207661_101267254 | 144 |
| 274 | 3300025960 | Ga0207651_10261681 | Ga0207651_102616812 | 144 |
| 275 | 3300025961 | Ga0207712_10473186 | Ga0207712_104731861 | 144 |
| 276 | 3300025986 | Ga0207658_10254854 | Ga0207658_102548542 | 144 |
| 277 | 3300025986 | Ga0207658_10370903 | Ga0207658_103709031 | 144 |
| 278 | 3300026067 | Ga0207678_10141699 | Ga0207678_101416992 | 144 |
| 279 | 3300026088 | Ga0207641_10249276 | Ga0207641_102492762 | 144 |
| 280 | 3300026089 | Ga0207648_10148300 | Ga0207648_101483002 | 144 |
| 281 | 3300026095 | Ga0207676_10234782 | Ga0207676_102347822 | 144 |
| 282 | 3300026095 | Ga0207676_10632053 | Ga0207676_106320531 | 144 |
| 283 | 3300026095 | Ga0207676_11233628 | Ga0207676_112336282 | 144 |
| 284 | 3300026095 | Ga0207676_11333223 | Ga0207676_113332231 | 144 |
| 285 | 3300026116 | Ga0207674_10116463 | Ga0207674_101164631 | 144 |
| 286 | 3300026116 | Ga0207674_10399289 | Ga0207674_103992891 | 144 |
| 287 | 3300026116 | Ga0207674_10846677 | Ga0207674_108466771 | 144 |
| 288 | 3300026118 | Ga0207675_100568624 | Ga0207675_1005686242 | 144 |
| 289 | 3300026118 | Ga0207675_100612747 | Ga0207675_1006127472 | 144 |
| 290 | 3300026118 | Ga0207675_100930549 | Ga0207675_1009305491 | 144 |
| 291 | 3300026121 | Ga0207683_10977535 | Ga0207683_109775352 | 144 |
| 292 | 3300026142 | Ga0207698_10701373 | Ga0207698_107013732 | 144 |
| 293 | 3300028380 | Ga0268265_10027580 | Ga0268265_100275804 | 144 |
| 294 | 3300028380 | Ga0268265_10028037 | Ga0268265_100280372 | 144 |
| 295 | 3300028380 | Ga0268265_10558318 | Ga0268265_105583182 | 144 |
| 296 | 3300028381 | Ga0268264_10052810 | Ga0268264_100528104 | 144 |
| 297 | 3300028381 | Ga0268264_10093358 | Ga0268264_100933584 | 144 |
| 298 | 3300028381 | Ga0268264_11544901 | Ga0268264_115449011 | 144 |
| 299 | 3300031548 | Ga0307408_100362913 | Ga0307408_1003629133 | 144 |
| 300 | 3300031727 | Ga0316576_10052011 | Ga0316576_100520114 | 144 |
| 301 | 3300032002 | Ga0307416_100124568 | Ga0307416_1001245683 | 144 |
| 302 | 3300032133 | Ga0316583_10000989 | Ga0316583_100009892 | 144 |
| 303 | 3300035114 | Ga0373939_0044604 | Ga0373939_0044604_40_555 | 144 |
| 304 | 3300035172 | Ga0373955_0379631 | Ga0373955_0379631_193_720 | 144 |
| 305 | 3300035695 | Ga0373927_0449944 | Ga0373927_0449944_262_789 | 144 |
| 306 | 3300035725 | Ga0373947_0168781 | Ga0373947_0168781_881_1408 | 144 |
| 307 | 3300036401 | Ga0373937_0536538 | Ga0373937_0536538_357_863 | 144 |
| 308 | 3300036647 | Ga0316582_0172665 | Ga0316582_0172665_366_881 | 144 |
| 309 | 3300036712 | Ga0316584_0048353 | Ga0316584_0048353_1953_2468 | 144 |
| 310 | 3300037068 | Ga0373925_0634836 | Ga0373925_0634836_323_850 | 144 |
| 311 | 3300037312 | Ga0395899_0023366 | Ga0395899_0023366_3439_3948 | 144 |
| 312 | 3300037418 | Ga0395900_0009078 | Ga0395900_0009078_2123_2632 | 144 |
| 313 | 3300037466 | Ga0395898_0025330 | Ga0395898_0025330_1033_1542 | 144 |
| 314 | 3300038443 | Ga0395901_0000661 | Ga0395901_0000661_3963_4472 | 144 |
| 315 | 3300038443 | Ga0395901_0948409 | Ga0395901_0948409_80_595 | 144 |
| 316 | 3300038726 | Ga0400490_31829 | Ga0400490_31829_353_868 | 144 |
| 317 | 3300039093 | Ga0400489_09922 | Ga0400489_09922_12288_12803 | 144 |
| 318 | 3300041404 | Ga0439436_0039872 | Ga0439436_0039872_408_923 | 144 |
| 319 | 3300041407 | Ga0439447_078913 | Ga0439447_078913_175_684 | 144 |
| 320 | 3300041410 | Ga0439461_0005128 | Ga0439461_0005128_429_938 | 144 |
| 321 | 3300041411 | Ga0439466_0060080 | Ga0439466_0060080_648_1157 | 144 |
| 322 | 3300041997 | Ga0439431_0115635 | Ga0439431_0115635_36_548 | 144 |
| 323 | 3300041999 | Ga0439433_0000609 | Ga0439433_0000609_5484_5993 | 144 |
| 324 | 3300042002 | Ga0439442_008667 | Ga0439442_008667_1186_1695 | 144 |
| 325 | 3300042006 | Ga0439432_000968 | Ga0439432_000968_1903_2412 | 144 |
| 326 | 3300042007 | Ga0439449_0004082 | Ga0439449_0004082_1318_1827 | 144 |
| 327 | 3300042115 | Ga0450911_000004 | Ga0450911_000004_78048_78560 | 144 |
| 328 | 3300042139 | Ga0450904_000210 | Ga0450904_000210_10722_11234 | 144 |
| 329 | 3300042435 | Ga0439434_0010457 | Ga0439434_0010457_1024_1533 | 144 |
| 330 | 3300042436 | Ga0439435_0001633 | Ga0439435_0001633_876_1388 | 144 |
| 331 | 3300042438 | Ga0439459_0031603 | Ga0439459_0031603_299_811 | 144 |
| 332 | 3300042532 | Ga0450893_0003084 | Ga0450893_0003084_1393_1905 | 144 |
| 333 | 3300045051 | Ga0451576_0140474 | Ga0451576_0140474_519_1031 | 144 |
| 334 | 3300045976 | Ga0466967_0107205 | Ga0466967_0107205_1369_1887 | 144 |
| 335 | 3300046457 | Ga0495590_0001294 | Ga0495590_0001294_2692_3210 | 144 |
| 336 | 3300046459 | Ga0495629_0340681 | Ga0495629_0340681_327_839 | 144 |
| 337 | 3300046472 | Ga0495580_0001795 | Ga0495580_0001795_879_1385 | 144 |
| 338 | 3300046472 | Ga0495580_0484877 | Ga0495580_0484877_219_743 | 144 |
| 339 | 3300046491 | Ga0495584_0177116 | Ga0495584_0177116_459_971 | 144 |
| 340 | 3300046543 | Ga0495645_0006118 | Ga0495645_0006118_3560_4066 | 144 |
| 341 | 3300046616 | Ga0495668_0515014 | Ga0495668_0515014_39_557 | 144 |
| 342 | 3300046678 | Ga0495599_0053748 | Ga0495599_0053748_704_1210 | 144 |
| 343 | 3300046679 | Ga0495623_0094033 | Ga0495623_0094033_822_1328 | 144 |
| 344 | 3300046680 | Ga0495646_0038283 | Ga0495646_0038283_692_1198 | 144 |
| 345 | 3300046681 | Ga0495647_0099479 | Ga0495647_0099479_519_1031 | 144 |
| 346 | 3300046689 | Ga0495613_0238244 | Ga0495613_0238244_444_950 | 144 |
| 347 | 3300046809 | Ga0495600_0140403 | Ga0495600_0140403_699_1205 | 144 |
| 348 | 3300047315 | Ga0495581_0396727 | Ga0495581_0396727_259_777 | 144 |
| 349 | 3300047317 | Ga0495604_0051724 | Ga0495604_0051724_989_1495 | 144 |
| 350 | 3300047471 | Ga0495684_0155582 | Ga0495684_0155582_594_1100 | 144 |
| 351 | 3300047472 | Ga0495686_0002413 | Ga0495686_0002413_16535_17044 | 144 |
| 352 | 3300048088 | Ga0495602_0119016 | Ga0495602_0119016_725_1231 | 144 |
| 353 | 3300048910 | Ga0496107_0695857 | Ga0496107_0695857_176_718 | 144 |
| 354 | 3300048911 | Ga0496108_0073481 | Ga0496108_0073481_1540_2052 | 144 |
| 355 | 3300048911 | Ga0496108_0348473 | Ga0496108_0348473_303_818 | 144 |
| 356 | 3300048915 | Ga0496112_0000122 | Ga0496112_0000122_11529_12038 | 144 |
| 357 | 3300048928 | Ga0496125_0072230 | Ga0496125_0072230_1372_1881 | 144 |
| 358 | 3300049568 | Ga0501031_0349345 | Ga0501031_0349345_391_906 | 144 |
| 359 | 3300049572 | Ga0501036_0118628 | Ga0501036_0118628_701_1216 | 144 |
| 360 | 3300049572 | Ga0501036_0914518 | Ga0501036_0914518_135_650 | 144 |
| 361 | 3300049574 | Ga0501038_0169419 | Ga0501038_0169419_444_959 | 144 |
| 362 | 3300049575 | Ga0501039_0038010 | Ga0501039_0038010_2055_2570 | 144 |
| 363 | 3300049575 | Ga0501039_0093397 | Ga0501039_0093397_1055_1570 | 144 |
| 364 | 3300049576 | Ga0501040_0051755 | Ga0501040_0051755_1077_1592 | 144 |
| 365 | 3300049577 | Ga0501041_0004269 | Ga0501041_0004269_5132_5647 | 144 |
| 366 | 3300049578 | Ga0501042_0058561 | Ga0501042_0058561_1106_1621 | 144 |
| 367 | 3300049579 | Ga0501043_0148029 | Ga0501043_0148029_942_1457 | 144 |
| 368 | 3300049582 | Ga0501048_0037352 | Ga0501048_0037352_559_1074 | 144 |
| 369 | 3300049587 | Ga0501071_0353749 | Ga0501071_0353749_106_621 | 144 |
| 370 | 3300049588 | Ga0501072_0172202 | Ga0501072_0172202_53_568 | 144 |
| 371 | 3300049592 | Ga0501076_0022427 | Ga0501076_0022427_1103_1618 | 144 |
| 372 | 3300049669 | Ga0501235_043386 | Ga0501235_043386_495_1016 | 144 |
| 373 | 3300049741 | Ga0501079_0042715 | Ga0501079_0042715_1833_2348 | 144 |
| 374 | 3300049743 | Ga0501081_0418153 | Ga0501081_0418153_269_784 | 144 |
| 375 | 3300049822 | Ga0501035_0144613 | Ga0501035_0144613_1326_1832 | 144 |
| 376 | 3300049824 | Ga0501045_0008831 | Ga0501045_0008831_5404_5919 | 144 |
| 377 | 3300049853 | Ga0501226_000003 | Ga0501226_000003_107164_107676 | 144 |
| 378 | 3300050489 | nmdc:mga03683_4157_c1 | nmdc:mga03683_4157_c1_2009_2515 | 144 |
| 379 | 3300050491 | nmdc:mga00v17_34193_c1 | nmdc:mga00v17_34193_c1_616_1122 | 144 |
| 380 | 3300050493 | nmdc:mga0k408_26759_c1 | nmdc:mga0k408_26759_c1_999_1505 | 144 |
| 381 | 3300050494 | nmdc:mga06z11_181208_c1 | nmdc:mga06z11_181208_c1_136_642 | 144 |
| 382 | 3300050507 | nmdc:mga05p37_1237564_c1 | nmdc:mga05p37_1237564_c1_188_703 | 144 |
| 383 | 3300050507 | nmdc:mga05p37_302649_c1 | nmdc:mga05p37_302649_c1_673_1188 | 144 |
| 384 | 3300050509 | nmdc:mga0qj67_110089_c1 | nmdc:mga0qj67_110089_c1_1586_2101 | 144 |
| 385 | 3300050510 | nmdc:mga06r32_10603_c1 | nmdc:mga06r32_10603_c1_659_1174 | 144 |
| 386 | 3300050512 | nmdc:mga0n895_19806_c1 | nmdc:mga0n895_19806_c1_1545_2060 | 144 |
| 387 | 3300050512 | nmdc:mga0n895_90213_c1 | nmdc:mga0n895_90213_c1_2397_2912 | 144 |
| 388 | 3300050513 | nmdc:mga0rr50_94190_c1 | nmdc:mga0rr50_94190_c1_1458_1973 | 144 |
| 389 | 3300050514 | nmdc:mga08x19_10974_c1 | nmdc:mga08x19_10974_c1_2260_2775 | 144 |
| 390 | 3300050514 | nmdc:mga08x19_314442_c1 | nmdc:mga08x19_314442_c1_377_892 | 144 |
| 391 | 3300050515 | nmdc:mga0a205_147027_c1 | nmdc:mga0a205_147027_c1_1000_1515 | 144 |
| 392 | 3300050515 | nmdc:mga0a205_728638_c1 | nmdc:mga0a205_728638_c1_142_657 | 144 |
| 393 | 3300050515 | nmdc:mga0a205_889333_c1 | nmdc:mga0a205_889333_c1_170_685 | 144 |
| 394 | 3300053153 | Ga0500616_0000928 | Ga0500616_0000928_18175_18702 | 144 |
| 395 | 3300054114 | Ga0501084_1096223 | Ga0501084_1096223_123_638 | 144 |
| 396 | 3300061734 | Ga0530510_0006279 | Ga0530510_0006279_1135_1650 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ql5-assembly1.cif.gz_A | crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4 | 0.7456 | 6 | 81 |
| 3jam-assembly1.cif.gz_i | cryoem structure of 40s-eif1a-eif1 complex from yeast | 0.7251 | 1 | 81 |
| 1hr0-assembly1.cif.gz_W | crystal structure of initiation factor if1 bound to the 30s ribosomal subunit | 0.7229 | 6 | 77 |
| 2n3s-assembly1.cif.gz_A | nmr assignments and structure of translation initiation factor if-1 from burkholderia thailandensis e264. | 0.718 | 6 | 81 |
| 6zu9-assembly1.cif.gz_A | structure of a yeast abce1-bound 48s initiation complex | 0.7176 | 4 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fvqA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.7837 | 6 | 66 | 2.40.50.470 |
| af_Q8II01_677_864_2.40.50.90 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.7707 | 5 | 36 | 2.40.50.90 |
| 3i4oA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7192 | 7 | 81 | 2.40.50.140 |
| af_P46618_9_92_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7099 | 5 | 90 | 2.40.50.140 |
| af_Q8IQ13_17_92_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.6875 | 7 | 81 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A321LET6-F1-model_v4 | Baseplate assembly protein | 0.8881 | 1 | 144 |
|
| AF-A0A1H9C3A2-F1-model_v4 | Gp5/Type VI secretion system Vgr protein OB-fold domain-containing protein | 0.8842 | 2 | 144 |
|
| AF-A0A321LET6-F1-model_v4 | Baseplate assembly protein | 0.8824 | 1 | 144 |
|
| AF-A0A4S3KCW2-F1-model_v4 | Baseplate assembly protein | 0.8759 | 1 | 144 |
|
| AF-A0A7Y8KWG7-F1-model_v4 | Baseplate assembly protein | 0.8746 | 12 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar