F433532

General Info

Members Datasets Scaffolds Average Seq Length
396 214 792 118

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10158846|Ga0207652_101588462
Length 144
Sequence LKLNGSPAELPPPDLHFQPTIGYEIRSMNPAPIKPIVPFSTLDALDIRVGTITAVEEVPQSAKLMRLIVSFGDHTRTILAGIKKERANPFELQGRQALFVVNLEPRRMAGELSEGMLFDIGYADNITPVLATPESPVPDGTRAG

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 0
Rhizosphere 96.21
Stem 0
Stem Tuber 0
Unclassified 30.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10158846 3300025921 Unclassified 2026
2 SwRhRL2b_contig_927608 2162886007 Bacteria 1841
3 Ga0065704_10008682 3300005289 Bacteria 3020
4 Ga0065715_10091513 3300005293 Bacteria 5728
5 Ga0065715_10928209 3300005293 Unclassified 566
6 Ga0065707_10001703 3300005295 Bacteria 6572
7 Ga0070676_10013604 3300005328 Bacteria 4462
8 Ga0070676_10055445 3300005328 Bacteria 2339
9 Ga0070676_10118978 3300005328 Bacteria 1655
10 Ga0070690_100455366 3300005330 Bacteria 949
11 Ga0070670_100291921 3300005331 Unclassified 1425
12 Ga0068869_100249218 3300005334 Bacteria 1418
13 Ga0068869_102026644 3300005334 Unclassified 517
14 Ga0070666_10191027 3300005335 Bacteria 1439
15 Ga0070680_100108888 3300005336 Bacteria 2305
16 Ga0070682_100015191 3300005337 Unclassified 4457
17 Ga0070682_100425981 3300005337 Bacteria 1010
18 Ga0068868_100521378 3300005338 Unclassified 1043
19 Ga0068868_101320791 3300005338 Bacteria 670
20 Ga0070689_100467626 3300005340 Bacteria 1075
21 Ga0070689_100772947 3300005340 Unclassified 843
22 Ga0070691_10032663 3300005341 Bacteria 2446
23 Ga0070691_10130152 3300005341 Bacteria 1275
24 Ga0070687_100107744 3300005343 Bacteria 1571
25 Ga0070687_100234518 3300005343 Bacteria 1131
26 Ga0070692_10076242 3300005345 Bacteria 1797
27 Ga0070692_10555416 3300005345 Unclassified 753
28 Ga0070668_100038938 3300005347 Bacteria 3636
29 Ga0070668_100388719 3300005347 Bacteria 1189
30 Ga0070669_100673459 3300005353 Unclassified 872
31 Ga0070675_100012869 3300005354 Bacteria 6566
32 Ga0070675_100019884 3300005354 Bacteria 5356
33 Ga0070675_100246641 3300005354 Unclassified 1562
34 Ga0070674_100004000 3300005356 Bacteria 8356
35 Ga0070674_100866346 3300005356 Bacteria 784
36 Ga0070674_101744597 3300005356 Unclassified 564
37 Ga0070673_100405235 3300005364 Unclassified 1220
38 Ga0070688_100006295 3300005365 Bacteria 6335
39 Ga0070688_100184330 3300005365 Bacteria 1450
40 Ga0070667_100180921 3300005367 Bacteria 1864
41 Ga0070703_10103881 3300005406 Bacteria 1006
42 Ga0070713_101673698 3300005436 Unclassified 618
43 Ga0070701_10006535 3300005438 Bacteria 4913
44 Ga0070701_10056737 3300005438 Bacteria 2050
45 Ga0070701_11260361 3300005438 Bacteria 527
46 Ga0070711_100647861 3300005439 Bacteria 885
47 Ga0070705_100033270 3300005440 Bacteria 2873
48 Ga0070705_101882865 3300005440 Unclassified 509
49 Ga0070700_100014169 3300005441 Bacteria 4499
50 Ga0070700_100033394 3300005441 Bacteria 3099
51 Ga0070700_100132199 3300005441 Bacteria 1685
52 Ga0070700_100589074 3300005441 Bacteria 869
53 Ga0070694_100027655 3300005444 Unclassified 3686
54 Ga0070694_100120126 3300005444 Bacteria 1884
55 Ga0070694_100367143 3300005444 Bacteria 1119
56 Ga0070694_101306685 3300005444 Bacteria 610
57 Ga0070708_100000562 3300005445 Bacteria 27795
58 Ga0070708_100046510 3300005445 Bacteria 3829
59 Ga0070708_100062365 3300005445 Unclassified 3334
60 Ga0070678_100260247 3300005456 Bacteria 1459
61 Ga0070678_100639375 3300005456 Bacteria 953
62 Ga0070662_101022283 3300005457 Bacteria 708
63 Ga0070681_10163518 3300005458 Unclassified 2149
64 Ga0068867_100038200 3300005459 Bacteria 3495
65 Ga0068867_100072608 3300005459 Bacteria 2576
66 Ga0068867_100633803 3300005459 Unclassified 936
67 Ga0070706_100014073 3300005467 Bacteria 7391
68 Ga0070706_101086883 3300005467 Bacteria 736
69 Ga0070706_101145180 3300005467 Bacteria 715
70 Ga0070707_100028087 3300005468 Bacteria 5353
71 Ga0070707_100064610 3300005468 Bacteria 3514
72 Ga0070707_100080760 3300005468 Unclassified 3139
73 Ga0070707_100494219 3300005468 Unclassified 1185
74 Ga0070698_100039997 3300005471 Bacteria 4821
75 Ga0070698_100977113 3300005471 Bacteria 793
76 Ga0070699_100361073 3300005518 Bacteria 1309
77 Ga0070699_100545825 3300005518 Unclassified 1055
78 Ga0070699_101228755 3300005518 Bacteria 687
79 Ga0070699_101577149 3300005518 Bacteria 602
80 Ga0070679_100308256 3300005530 Unclassified 1533
81 Ga0070697_100160187 3300005536 Bacteria 1901
82 Ga0070697_100225989 3300005536 Bacteria 1596
83 Ga0070697_101501863 3300005536 Bacteria 602
84 Ga0068853_100555882 3300005539 Unclassified 1087
85 Ga0070672_100891109 3300005543 Bacteria 786
86 Ga0070686_100325958 3300005544 Bacteria 1146
87 Ga0070686_100507118 3300005544 Unclassified 937
88 Ga0070695_100118097 3300005545 Unclassified 1811
89 Ga0070695_100336409 3300005545 Bacteria 1127
90 Ga0070695_100905338 3300005545 Bacteria 713
91 Ga0070696_100002702 3300005546 Bacteria 11766
92 Ga0070696_101245337 3300005546 Unclassified 630
93 Ga0070665_100350364 3300005548 Bacteria 1482
94 Ga0070665_102436956 3300005548 Unclassified 525
95 Ga0070704_100010178 3300005549 Bacteria 5719
96 Ga0070664_101206563 3300005564 Bacteria 714
97 Ga0068857_100049531 3300005577 Bacteria 3726
98 Ga0068857_100192727 3300005577 Bacteria 1856
99 Ga0068854_100025450 3300005578 Bacteria 4061
100 Ga0068854_100319958 3300005578 Bacteria 1260
101 Ga0070702_100031162 3300005615 Bacteria 2915
102 Ga0070702_100301419 3300005615 Bacteria 1109
103 Ga0070702_100363115 3300005615 Unclassified 1024
104 Ga0068864_100100158 3300005618 Unclassified 2568
105 Ga0068864_100193469 3300005618 Bacteria 1865
106 Ga0068866_11174248 3300005718 Unclassified 553
107 Ga0068861_100038514 3300005719 Bacteria 3561
108 Ga0068861_100592634 3300005719 Bacteria 1016
109 Ga0068861_101214858 3300005719 Bacteria 729
110 Ga0068861_101896573 3300005719 Bacteria 593
111 Ga0068870_10684401 3300005840 Unclassified 706
112 Ga0068870_10721213 3300005840 Bacteria 690
113 Ga0068863_100017030 3300005841 Bacteria 6969
114 Ga0068863_100599151 3300005841 Bacteria 1090
115 Ga0068863_101610341 3300005841 Unclassified 658
116 Ga0068858_100005866 3300005842 Bacteria 11996
117 Ga0068858_100273821 3300005842 Unclassified 1607
118 Ga0068860_100093390 3300005843 Bacteria 2867
119 Ga0068860_100119543 3300005843 Bacteria 2522
120 Ga0068862_100056036 3300005844 Bacteria 3376
121 Ga0070717_10435860 3300006028 Bacteria 1180
122 Ga0075365_10144198 3300006038 Bacteria 1654
123 Ga0075365_11058191 3300006038 Bacteria 571
124 Ga0075368_10056068 3300006042 Bacteria 1572
125 Ga0075432_10055793 3300006058 Bacteria 1400
126 Ga0070716_100011469 3300006173 Unclassified 4463
127 Ga0075367_10779663 3300006178 Bacteria 609
128 Ga0075366_10000272 3300006195 Bacteria 22957
129 Ga0097621_100001996 3300006237 Bacteria 13917
130 Ga0097621_100035354 3300006237 Bacteria 3992
131 Ga0097621_101013964 3300006237 Bacteria 777
132 Ga0075370_10202890 3300006353 Bacteria 1170
133 Ga0068871_100012277 3300006358 Bacteria 6310
134 Ga0068871_100287243 3300006358 Unclassified 1440
135 Ga0068871_101552220 3300006358 Bacteria 626
136 Ga0075428_100070476 3300006844 Bacteria 3821
137 Ga0075428_100560190 3300006844 Bacteria 1222
138 Ga0075431_100349371 3300006847 Bacteria 1487
139 Ga0075431_100467245 3300006847 Unclassified 1256
140 Ga0075431_100644022 3300006847 Bacteria 1041
141 Ga0075433_10036439 3300006852 Bacteria 4238
142 Ga0075433_10354818 3300006852 Bacteria 1296
143 Ga0075433_10363748 3300006852 Bacteria 1278
144 Ga0075433_10693096 3300006852 Bacteria 892
145 Ga0075433_10947475 3300006852 Unclassified 750
146 Ga0075433_11029994 3300006852 Bacteria 717
147 Ga0075433_11197570 3300006852 Unclassified 659
148 Ga0075433_11267657 3300006852 Bacteria 639
149 Ga0075434_100158538 3300006871 Bacteria 2283
150 Ga0075434_100306335 3300006871 Bacteria 1609
151 Ga0075434_100757518 3300006871 Unclassified 988
152 Ga0075434_100879541 3300006871 Bacteria 911
153 Ga0075434_100892450 3300006871 Unclassified 904
154 Ga0075429_100047574 3300006880 Bacteria 3731
155 Ga0068865_100725830 3300006881 Unclassified 851
156 Ga0075436_100080666 3300006914 Bacteria 2255
157 Ga0075435_100300133 3300007076 Bacteria 1374
158 Ga0099794_10014864 3300007265 Bacteria 3421
159 Ga0099794_10041660 3300007265 Unclassified 2187
160 Ga0099794_10051332 3300007265 Unclassified 1985
161 Ga0105251_10202945 3300009011 Unclassified 893
162 Ga0111539_10004110 3300009094 Bacteria 19087
163 Ga0111539_10013208 3300009094 Bacteria 10324
164 Ga0111539_10014267 3300009094 Bacteria 9925
165 Ga0111539_10285584 3300009094 Unclassified 1920
166 Ga0111539_13434359 3300009094 Unclassified 509
167 Ga0105245_10812575 3300009098 Bacteria 973
168 Ga0105245_11532634 3300009098 Unclassified 718
169 Ga0105247_11881969 3300009101 Unclassified 500
170 Ga0114129_10059396 3300009147 Bacteria 5346
171 Ga0114129_10115942 3300009147 Unclassified 3691
172 Ga0114129_10195899 3300009147 Unclassified 2740
173 Ga0114129_10372021 3300009147 Bacteria 1888
174 Ga0105243_10003480 3300009148 Bacteria 12713
175 Ga0105243_10015443 3300009148 Bacteria 5771
176 Ga0105243_10016751 3300009148 Bacteria 5541
177 Ga0105242_10177771 3300009176 Bacteria 1875
178 Ga0105248_10012399 3300009177 Bacteria 9403
179 Ga0105248_10636975 3300009177 Unclassified 1203
180 Ga0105248_10699714 3300009177 Bacteria 1143
181 Ga0105248_11878632 3300009177 Bacteria 680
182 Ga0105237_10703648 3300009545 Unclassified 1017
183 Ga0105238_10119378 3300009551 Bacteria 2617
184 Ga0105249_10196433 3300009553 Bacteria 1972
185 Ga0105249_11798216 3300009553 Unclassified 685
186 Ga0105239_11125754 3300010375 Unclassified 904
187 Ga0105246_10082558 3300011119 Bacteria 2294
188 Ga0105246_10545870 3300011119 Unclassified 992
189 Ga0157378_11579386 3300013297 Bacteria 702
190 Ga0157378_11774303 3300013297 Unclassified 665
191 Ga0163162_10228608 3300013306 Unclassified 1990
192 Ga0163162_10294507 3300013306 Bacteria 1754
193 Ga0163162_10350476 3300013306 Bacteria 1609
194 Ga0157375_11972770 3300013308 Unclassified 694
195 Ga0157375_12085677 3300013308 Unclassified 675
196 Ga0157375_12379329 3300013308 Unclassified 632
197 Ga0163163_10227063 3300014325 Bacteria 1916
198 Ga0163163_11786577 3300014325 Bacteria 675
199 Ga0157380_10475116 3300014326 Bacteria 1207
200 Ga0157380_11204298 3300014326 Bacteria 801
201 Ga0157380_11834415 3300014326 Unclassified 666
202 Ga0157377_10122487 3300014745 Bacteria 1578
203 Ga0157377_11379250 3300014745 Unclassified 555
204 Ga0157379_10271191 3300014968 Bacteria 1543
205 Ga0157379_10891786 3300014968 Unclassified 843
206 Ga0163161_10358312 3300017792 Bacteria 1161
207 Ga0224572_1028348 3300024225 Unclassified 1073
208 Ga0207682_10408658 3300025893 Bacteria 642
209 Ga0207642_10082906 3300025899 Bacteria 1562
210 Ga0207710_10723189 3300025900 Bacteria 522
211 Ga0207680_10175584 3300025903 Bacteria 1446
212 Ga0207647_10017875 3300025904 Unclassified 4811
213 Ga0207699_10024822 3300025906 Bacteria 3283
214 Ga0207645_10004223 3300025907 Bacteria 10669
215 Ga0207645_10048406 3300025907 Bacteria 2715
216 Ga0207645_10073198 3300025907 Bacteria 2193
217 Ga0207643_10074572 3300025908 Bacteria 1957
218 Ga0207643_10548858 3300025908 Unclassified 741
219 Ga0207684_10046459 3300025910 Bacteria 3683
220 Ga0207684_10737917 3300025910 Bacteria 835
221 Ga0207654_10510824 3300025911 Unclassified 850
222 Ga0207707_10050776 3300025912 Unclassified 3612
223 Ga0207662_10003508 3300025918 Bacteria 8079
224 Ga0207662_10074654 3300025918 Bacteria 2058
225 Ga0207662_11228480 3300025918 Bacteria 533
226 Ga0207649_10698024 3300025920 Bacteria 787
227 Ga0207646_10017848 3300025922 Bacteria 6627
228 Ga0207646_10124702 3300025922 Bacteria 2315
229 Ga0207646_10135340 3300025922 Bacteria 2218
230 Ga0207681_10054221 3300025923 Bacteria 2725
231 Ga0207681_10079868 3300025923 Bacteria 2306
232 Ga0207681_10292597 3300025923 Bacteria 1286
233 Ga0207694_10033073 3300025924 Unclassified 3961
234 Ga0207650_11476103 3300025925 Unclassified 578
235 Ga0207659_10075619 3300025926 Bacteria 2472
236 Ga0207659_10295077 3300025926 Unclassified 1329
237 Ga0207687_10480416 3300025927 Bacteria 1035
238 Ga0207700_11096065 3300025928 Unclassified 712
239 Ga0207686_10226341 3300025934 Bacteria 1353
240 Ga0207709_10002162 3300025935 Bacteria 12587
241 Ga0207709_10198828 3300025935 Bacteria 1430
242 Ga0207709_10848587 3300025935 Unclassified 740
243 Ga0207670_10701851 3300025936 Unclassified 838
244 Ga0207670_10745326 3300025936 Bacteria 813
245 Ga0207670_11727827 3300025936 Unclassified 532
246 Ga0207669_10010661 3300025937 Bacteria 4435
247 Ga0207669_10824179 3300025937 Unclassified 771
248 Ga0207704_10063755 3300025938 Bacteria 2299
249 Ga0207704_10999053 3300025938 Unclassified 707
250 Ga0207691_10007730 3300025940 Bacteria 10347
251 Ga0207691_10140526 3300025940 Bacteria 2128
252 Ga0207691_10745002 3300025940 Bacteria 825
253 Ga0207691_11010193 3300025940 Unclassified 694
254 Ga0207711_10035972 3300025941 Bacteria 4200
255 Ga0207711_10458299 3300025941 Unclassified 1187
256 Ga0207711_10744757 3300025941 Unclassified 913
257 Ga0207689_10010802 3300025942 Bacteria 7855
258 Ga0207651_10630544 3300025960 Bacteria 940
259 Ga0207651_10891771 3300025960 Unclassified 792
260 Ga0207651_11126301 3300025960 Unclassified 704
261 Ga0207712_10087026 3300025961 Bacteria 2290
262 Ga0207712_11217293 3300025961 Unclassified 672
263 Ga0207668_10282744 3300025972 Unclassified 1361
264 Ga0207668_11477737 3300025972 Bacteria 613
265 Ga0207658_10312899 3300025986 Bacteria 1357
266 Ga0207703_10012423 3300026035 Bacteria 6638
267 Ga0207703_10021478 3300026035 Bacteria 5054
268 Ga0207639_10304281 3300026041 Bacteria 1410
269 Ga0207678_10011892 3300026067 Bacteria 7642
270 Ga0207708_10014449 3300026075 Bacteria 5909
271 Ga0207708_10022591 3300026075 Bacteria 4750
272 Ga0207708_10052655 3300026075 Bacteria 3100
273 Ga0207641_10067176 3300026088 Unclassified 3071
274 Ga0207641_10159958 3300026088 Bacteria 2047
275 Ga0207641_10217061 3300026088 Bacteria 1772
276 Ga0207648_10001294 3300026089 Bacteria 27922
277 Ga0207648_10115889 3300026089 Bacteria 2355
278 Ga0207648_10192848 3300026089 Bacteria 1806
279 Ga0207676_10081603 3300026095 Bacteria 2627
280 Ga0207676_10571180 3300026095 Bacteria 1083
281 Ga0207676_12510873 3300026095 Unclassified 512
282 Ga0207674_10045263 3300026116 Bacteria 4528
283 Ga0207674_10162384 3300026116 Unclassified 2188
284 Ga0207674_11765924 3300026116 Bacteria 586
285 Ga0207675_100008055 3300026118 Bacteria 9929
286 Ga0207675_100226167 3300026118 Bacteria 1804
287 Ga0207675_100243003 3300026118 Bacteria 1740
288 Ga0207675_100400870 3300026118 Bacteria 1352
289 Ga0209588_1033498 3300027671 Unclassified 1647
290 Ga0209588_1114204 3300027671 Bacteria 866
291 Ga0207428_10000252 3300027907 Bacteria 73167
292 Ga0207428_10037594 3300027907 Bacteria 3938
293 Ga0207428_10044967 3300027907 Bacteria 3560
294 Ga0268266_11199239 3300028379 Bacteria 734
295 Ga0268266_11453489 3300028379 Unclassified 661
296 Ga0268266_12037208 3300028379 Unclassified 547
297 Ga0268265_10231461 3300028380 Unclassified 1624
298 Ga0268265_10721929 3300028380 Bacteria 965
299 Ga0268265_10993985 3300028380 Bacteria 828
300 Ga0268264_11237751 3300028381 Unclassified 756
301 Ga0268264_11593503 3300028381 Unclassified 664
302 Ga0268264_12200619 3300028381 Unclassified 559
303 Ga0265318_10092012 3300028577 Bacteria 1117
304 Ga0265760_10091956 3300031090 Unclassified 951
305 Ga0265340_10167109 3300031247 Unclassified 997
306 Ga0265339_10378286 3300031249 Unclassified 664
307 Ga0316579_10002059 3300031691 Bacteria 7535
308 Ga0316585_10016118 3300032137 Bacteria 2248
309 Ga0373926_0006408 3300035083 Unclassified 3909
310 Ga0373926_0073730 3300035083 Unclassified 1256
311 Ga0373923_0243291 3300035111 Bacteria 841
312 Ga0373954_0000089 3300035118 Bacteria 31233
313 Ga0373956_0023886 3300035119 Bacteria 2628
314 Ga0373957_0005374 3300035120 Bacteria 3967
315 Ga0373943_0960701 3300035170 Unclassified 512
316 Ga0373946_0007435 3300035171 Bacteria 4006
317 Ga0373955_0004753 3300035172 Bacteria 6042
318 Ga0316574_0216065 3300035398 Bacteria 1229
319 Ga0373931_0217876 3300035691 Bacteria 1148
320 Ga0373927_0011244 3300035695 Bacteria 5959
321 Ga0373927_0076157 3300035695 Bacteria 2173
322 Ga0373933_0000224 3300035724 Bacteria 37593
323 Ga0373947_0030062 3300035725 Bacteria 3190
324 Ga0373937_0019690 3300036401 Bacteria 6043
325 Ga0316582_0023254 3300036647 Bacteria 3692
326 Ga0316584_0014188 3300036712 Bacteria 5664
327 Ga0316584_0255986 3300036712 Bacteria 1278
328 Ga0373925_0000529 3300037068 Bacteria 37826
329 Ga0373925_0325853 3300037068 Unclassified 1244
330 Ga0373925_0346436 3300037068 Unclassified 1206
331 Ga0316581_0015961 3300037588 Bacteria 2153
332 Ga0436365_1257296 3300039437 Bacteria 701
333 Ga0436362_0144679 3300039453 Unclassified 501
334 Ga0439439_0058905 3300041406 Unclassified 1017
335 Ga0495592_0039265 3300046454 Bacteria 3557
336 Ga0495592_0607076 3300046454 Unclassified 667
337 Ga0495651_0017836 3300046462 Bacteria 5495
338 Ga0495651_0126043 3300046462 Unclassified 1875
339 Ga0495580_0035638 3300046472 Bacteria 3577
340 Ga0495580_0233871 3300046472 Bacteria 1261
341 Ga0495582_0031794 3300046473 Bacteria 2902
342 Ga0495582_0575351 3300046473 Unclassified 652
343 Ga0495639_0203357 3300046475 Bacteria 970
344 Ga0495664_0023474 3300046477 Bacteria 3581
345 Ga0495594_0108301 3300046499 Unclassified 1566
346 Ga0495594_0156653 3300046499 Bacteria 1294
347 Ga0495608_0075909 3300046511 Unclassified 2190
348 Ga0495630_0011698 3300046517 Bacteria 6360
349 Ga0495663_0305453 3300046525 Bacteria 573
350 Ga0495666_0274434 3300046526 Bacteria 765
351 Ga0495642_0289711 3300046528 Unclassified 717
352 Ga0495665_0035188 3300046531 Bacteria 2676
353 Ga0495587_0001053 3300046536 Bacteria 18165
354 Ga0495587_0002144 3300046536 Bacteria 13197
355 Ga0495645_0187205 3300046543 Unclassified 1414
356 Ga0495623_0013404 3300046679 Bacteria 5314
357 Ga0495646_0207726 3300046680 Bacteria 1064
358 Ga0495669_0031244 3300046684 Bacteria 2339
359 Ga0495669_0367510 3300046684 Unclassified 696
360 Ga0495604_0000647 3300047317 Bacteria 29822
361 Ga0495674_0073900 3300047319 Unclassified 2937
362 Ga0495674_0573708 3300047319 Unclassified 896
363 Ga0495675_0064546 3300047444 Unclassified 2316
364 Ga0495684_0004734 3300047471 Bacteria 10627
365 Ga0495684_0034915 3300047471 Bacteria 3858
366 Ga0495602_0000957 3300048088 Bacteria 27907
367 Ga0495602_0606906 3300048088 Unclassified 752
368 Ga0495602_0972211 3300048088 Unclassified 561
369 Ga0501043_0812132 3300049579 Bacteria 676
370 nmdc:mga03683_36477_c1 3300050489 Bacteria 2000
371 nmdc:mga03n38_10277_c1 3300050490 Bacteria 1361
372 nmdc:mga00v17_26488_c1 3300050491 Bacteria 3380
373 nmdc:mga00v17_437894_c1 3300050491 Bacteria 849
374 nmdc:mga0yw44_197489_c1 3300050492 Bacteria 1328
375 nmdc:mga0k408_394_c1 3300050493 Bacteria 23871
376 nmdc:mga06z11_55364_c1 3300050494 Bacteria 2048
377 nmdc:mga07m45_16352_c1 3300050496 Bacteria 3972
378 nmdc:mga05p37_1370195_c1 3300050507 Unclassified 715
379 nmdc:mga05p37_502334_c1 3300050507 Unclassified 1391
380 nmdc:mga05p37_86993_c1 3300050507 Unclassified 3852
381 nmdc:mga09592_117188_c1 3300050508 Bacteria 2286
382 nmdc:mga0qj67_202554_c1 3300050509 Bacteria 1612
383 nmdc:mga06r32_1834962_c1 3300050510 Bacteria 541
384 nmdc:mga06r32_339730_c1 3300050510 Bacteria 1486
385 nmdc:mga06r32_7091_c1 3300050510 Bacteria 10090
386 nmdc:mga06r32_785827_c1 3300050510 Bacteria 913
387 nmdc:mga08y16_30444_c1 3300050511 Bacteria 5681
388 nmdc:mga08y16_3858_c1 3300050511 Bacteria 15586
389 nmdc:mga08y16_74_c1 3300050511 Bacteria 83677
390 nmdc:mga0n895_116390_c1 3300050512 Bacteria 2692
391 nmdc:mga0n895_125132_c1 3300050512 Bacteria 2594
392 nmdc:mga0n895_278557_c1 3300050512 Bacteria 1696
393 nmdc:mga0n895_828785_c1 3300050512 Unclassified 914
394 nmdc:mga08x19_15374_c2 3300050514 Bacteria 3728
395 nmdc:mga0a205_160266_c1 3300050515 Bacteria 2147
396 nmdc:mga0a205_428732_c1 3300050515 Unclassified 1184
397 Ga0207652_10158846
398 SwRhRL2b_contig_927608
399 Ga0065704_10008682
400 Ga0065715_10091513
401 Ga0065715_10928209
402 Ga0065707_10001703
403 Ga0070676_10013604
404 Ga0070676_10055445
405 Ga0070676_10118978
406 Ga0070690_100455366
407 Ga0070670_100291921
408 Ga0068869_100249218
409 Ga0068869_102026644
410 Ga0070666_10191027
411 Ga0070680_100108888
412 Ga0070682_100015191
413 Ga0070682_100425981
414 Ga0068868_100521378
415 Ga0068868_101320791
416 Ga0070689_100467626
417 Ga0070689_100772947
418 Ga0070691_10032663
419 Ga0070691_10130152
420 Ga0070687_100107744
421 Ga0070687_100234518
422 Ga0070692_10076242
423 Ga0070692_10555416
424 Ga0070668_100038938
425 Ga0070668_100388719
426 Ga0070669_100673459
427 Ga0070675_100012869
428 Ga0070675_100019884
429 Ga0070675_100246641
430 Ga0070674_100004000
431 Ga0070674_100866346
432 Ga0070674_101744597
433 Ga0070673_100405235
434 Ga0070688_100006295
435 Ga0070688_100184330
436 Ga0070667_100180921
437 Ga0070703_10103881
438 Ga0070713_101673698
439 Ga0070701_10006535
440 Ga0070701_10056737
441 Ga0070701_11260361
442 Ga0070711_100647861
443 Ga0070705_100033270
444 Ga0070705_101882865
445 Ga0070700_100014169
446 Ga0070700_100033394
447 Ga0070700_100132199
448 Ga0070700_100589074
449 Ga0070694_100027655
450 Ga0070694_100120126
451 Ga0070694_100367143
452 Ga0070694_101306685
453 Ga0070708_100000562
454 Ga0070708_100046510
455 Ga0070708_100062365
456 Ga0070678_100260247
457 Ga0070678_100639375
458 Ga0070662_101022283
459 Ga0070681_10163518
460 Ga0068867_100038200
461 Ga0068867_100072608
462 Ga0068867_100633803
463 Ga0070706_100014073
464 Ga0070706_101086883
465 Ga0070706_101145180
466 Ga0070707_100028087
467 Ga0070707_100064610
468 Ga0070707_100080760
469 Ga0070707_100494219
470 Ga0070698_100039997
471 Ga0070698_100977113
472 Ga0070699_100361073
473 Ga0070699_100545825
474 Ga0070699_101228755
475 Ga0070699_101577149
476 Ga0070679_100308256
477 Ga0070697_100160187
478 Ga0070697_100225989
479 Ga0070697_101501863
480 Ga0068853_100555882
481 Ga0070672_100891109
482 Ga0070686_100325958
483 Ga0070686_100507118
484 Ga0070695_100118097
485 Ga0070695_100336409
486 Ga0070695_100905338
487 Ga0070696_100002702
488 Ga0070696_101245337
489 Ga0070665_100350364
490 Ga0070665_102436956
491 Ga0070704_100010178
492 Ga0070664_101206563
493 Ga0068857_100049531
494 Ga0068857_100192727
495 Ga0068854_100025450
496 Ga0068854_100319958
497 Ga0070702_100031162
498 Ga0070702_100301419
499 Ga0070702_100363115
500 Ga0068864_100100158
501 Ga0068864_100193469
502 Ga0068866_11174248
503 Ga0068861_100038514
504 Ga0068861_100592634
505 Ga0068861_101214858
506 Ga0068861_101896573
507 Ga0068870_10684401
508 Ga0068870_10721213
509 Ga0068863_100017030
510 Ga0068863_100599151
511 Ga0068863_101610341
512 Ga0068858_100005866
513 Ga0068858_100273821
514 Ga0068860_100093390
515 Ga0068860_100119543
516 Ga0068862_100056036
517 Ga0070717_10435860
518 Ga0075365_10144198
519 Ga0075365_11058191
520 Ga0075368_10056068
521 Ga0075432_10055793
522 Ga0070716_100011469
523 Ga0075367_10779663
524 Ga0075366_10000272
525 Ga0097621_100001996
526 Ga0097621_100035354
527 Ga0097621_101013964
528 Ga0075370_10202890
529 Ga0068871_100012277
530 Ga0068871_100287243
531 Ga0068871_101552220
532 Ga0075428_100070476
533 Ga0075428_100560190
534 Ga0075431_100349371
535 Ga0075431_100467245
536 Ga0075431_100644022
537 Ga0075433_10036439
538 Ga0075433_10354818
539 Ga0075433_10363748
540 Ga0075433_10693096
541 Ga0075433_10947475
542 Ga0075433_11029994
543 Ga0075433_11197570
544 Ga0075433_11267657
545 Ga0075434_100158538
546 Ga0075434_100306335
547 Ga0075434_100757518
548 Ga0075434_100879541
549 Ga0075434_100892450
550 Ga0075429_100047574
551 Ga0068865_100725830
552 Ga0075436_100080666
553 Ga0075435_100300133
554 Ga0099794_10014864
555 Ga0099794_10041660
556 Ga0099794_10051332
557 Ga0105251_10202945
558 Ga0111539_10004110
559 Ga0111539_10013208
560 Ga0111539_10014267
561 Ga0111539_10285584
562 Ga0111539_13434359
563 Ga0105245_10812575
564 Ga0105245_11532634
565 Ga0105247_11881969
566 Ga0114129_10059396
567 Ga0114129_10115942
568 Ga0114129_10195899
569 Ga0114129_10372021
570 Ga0105243_10003480
571 Ga0105243_10015443
572 Ga0105243_10016751
573 Ga0105242_10177771
574 Ga0105248_10012399
575 Ga0105248_10636975
576 Ga0105248_10699714
577 Ga0105248_11878632
578 Ga0105237_10703648
579 Ga0105238_10119378
580 Ga0105249_10196433
581 Ga0105249_11798216
582 Ga0105239_11125754
583 Ga0105246_10082558
584 Ga0105246_10545870
585 Ga0157378_11579386
586 Ga0157378_11774303
587 Ga0163162_10228608
588 Ga0163162_10294507
589 Ga0163162_10350476
590 Ga0157375_11972770
591 Ga0157375_12085677
592 Ga0157375_12379329
593 Ga0163163_10227063
594 Ga0163163_11786577
595 Ga0157380_10475116
596 Ga0157380_11204298
597 Ga0157380_11834415
598 Ga0157377_10122487
599 Ga0157377_11379250
600 Ga0157379_10271191
601 Ga0157379_10891786
602 Ga0163161_10358312
603 Ga0224572_1028348
604 Ga0207682_10408658
605 Ga0207642_10082906
606 Ga0207710_10723189
607 Ga0207680_10175584
608 Ga0207647_10017875
609 Ga0207699_10024822
610 Ga0207645_10004223
611 Ga0207645_10048406
612 Ga0207645_10073198
613 Ga0207643_10074572
614 Ga0207643_10548858
615 Ga0207684_10046459
616 Ga0207684_10737917
617 Ga0207654_10510824
618 Ga0207707_10050776
619 Ga0207662_10003508
620 Ga0207662_10074654
621 Ga0207662_11228480
622 Ga0207649_10698024
623 Ga0207646_10017848
624 Ga0207646_10124702
625 Ga0207646_10135340
626 Ga0207681_10054221
627 Ga0207681_10079868
628 Ga0207681_10292597
629 Ga0207694_10033073
630 Ga0207650_11476103
631 Ga0207659_10075619
632 Ga0207659_10295077
633 Ga0207687_10480416
634 Ga0207700_11096065
635 Ga0207686_10226341
636 Ga0207709_10002162
637 Ga0207709_10198828
638 Ga0207709_10848587
639 Ga0207670_10701851
640 Ga0207670_10745326
641 Ga0207670_11727827
642 Ga0207669_10010661
643 Ga0207669_10824179
644 Ga0207704_10063755
645 Ga0207704_10999053
646 Ga0207691_10007730
647 Ga0207691_10140526
648 Ga0207691_10745002
649 Ga0207691_11010193
650 Ga0207711_10035972
651 Ga0207711_10458299
652 Ga0207711_10744757
653 Ga0207689_10010802
654 Ga0207651_10630544
655 Ga0207651_10891771
656 Ga0207651_11126301
657 Ga0207712_10087026
658 Ga0207712_11217293
659 Ga0207668_10282744
660 Ga0207668_11477737
661 Ga0207658_10312899
662 Ga0207703_10012423
663 Ga0207703_10021478
664 Ga0207639_10304281
665 Ga0207678_10011892
666 Ga0207708_10014449
667 Ga0207708_10022591
668 Ga0207708_10052655
669 Ga0207641_10067176
670 Ga0207641_10159958
671 Ga0207641_10217061
672 Ga0207648_10001294
673 Ga0207648_10115889
674 Ga0207648_10192848
675 Ga0207676_10081603
676 Ga0207676_10571180
677 Ga0207676_12510873
678 Ga0207674_10045263
679 Ga0207674_10162384
680 Ga0207674_11765924
681 Ga0207675_100008055
682 Ga0207675_100226167
683 Ga0207675_100243003
684 Ga0207675_100400870
685 Ga0209588_1033498
686 Ga0209588_1114204
687 Ga0207428_10000252
688 Ga0207428_10037594
689 Ga0207428_10044967
690 Ga0268266_11199239
691 Ga0268266_11453489
692 Ga0268266_12037208
693 Ga0268265_10231461
694 Ga0268265_10721929
695 Ga0268265_10993985
696 Ga0268264_11237751
697 Ga0268264_11593503
698 Ga0268264_12200619
699 Ga0265318_10092012
700 Ga0265760_10091956
701 Ga0265340_10167109
702 Ga0265339_10378286
703 Ga0316579_10002059
704 Ga0316585_10016118
705 Ga0373926_0006408
706 Ga0373926_0073730
707 Ga0373923_0243291
708 Ga0373954_0000089
709 Ga0373956_0023886
710 Ga0373957_0005374
711 Ga0373943_0960701
712 Ga0373946_0007435
713 Ga0373955_0004753
714 Ga0316574_0216065
715 Ga0373931_0217876
716 Ga0373927_0011244
717 Ga0373927_0076157
718 Ga0373933_0000224
719 Ga0373947_0030062
720 Ga0373937_0019690
721 Ga0316582_0023254
722 Ga0316584_0014188
723 Ga0316584_0255986
724 Ga0373925_0000529
725 Ga0373925_0325853
726 Ga0373925_0346436
727 Ga0316581_0015961
728 Ga0436365_1257296
729 Ga0436362_0144679
730 Ga0439439_0058905
731 Ga0495592_0039265
732 Ga0495592_0607076
733 Ga0495651_0017836
734 Ga0495651_0126043
735 Ga0495580_0035638
736 Ga0495580_0233871
737 Ga0495582_0031794
738 Ga0495582_0575351
739 Ga0495639_0203357
740 Ga0495664_0023474
741 Ga0495594_0108301
742 Ga0495594_0156653
743 Ga0495608_0075909
744 Ga0495630_0011698
745 Ga0495663_0305453
746 Ga0495666_0274434
747 Ga0495642_0289711
748 Ga0495665_0035188
749 Ga0495587_0001053
750 Ga0495587_0002144
751 Ga0495645_0187205
752 Ga0495623_0013404
753 Ga0495646_0207726
754 Ga0495669_0031244
755 Ga0495669_0367510
756 Ga0495604_0000647
757 Ga0495674_0073900
758 Ga0495674_0573708
759 Ga0495675_0064546
760 Ga0495684_0004734
761 Ga0495684_0034915
762 Ga0495602_0000957
763 Ga0495602_0606906
764 Ga0495602_0972211
765 Ga0501043_0812132
766 nmdc:mga03683_36477_c1
767 nmdc:mga03n38_10277_c1
768 nmdc:mga00v17_26488_c1
769 nmdc:mga00v17_437894_c1
770 nmdc:mga0yw44_197489_c1
771 nmdc:mga0k408_394_c1
772 nmdc:mga06z11_55364_c1
773 nmdc:mga07m45_16352_c1
774 nmdc:mga05p37_1370195_c1
775 nmdc:mga05p37_502334_c1
776 nmdc:mga05p37_86993_c1
777 nmdc:mga09592_117188_c1
778 nmdc:mga0qj67_202554_c1
779 nmdc:mga06r32_1834962_c1
780 nmdc:mga06r32_339730_c1
781 nmdc:mga06r32_7091_c1
782 nmdc:mga06r32_785827_c1
783 nmdc:mga08y16_30444_c1
784 nmdc:mga08y16_3858_c1
785 nmdc:mga08y16_74_c1
786 nmdc:mga0n895_116390_c1
787 nmdc:mga0n895_125132_c1
788 nmdc:mga0n895_278557_c1
789 nmdc:mga0n895_828785_c1
790 nmdc:mga08x19_15374_c2
791 nmdc:mga0a205_160266_c1
792 nmdc:mga0a205_428732_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

47

142

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkh-assembly1.cif.gz_A-2 c-terminal domain of methionyl-trna synthetase from pyrococcus abyssi 0.9683 8 117
5h34-assembly1.cif.gz_A crystal structure of the c-terminal domain of methionyl-trna synthetase (metrs-c) in nanoarchaeum equitans 0.9671 4 117
1mkh-assembly1.cif.gz_A-2 c-terminal domain of methionyl-trna synthetase from pyrococcus abyssi 0.9595 8 117
5h34-assembly1.cif.gz_A crystal structure of the c-terminal domain of methionyl-trna synthetase (metrs-c) in nanoarchaeum equitans 0.9587 4 117
7d8r-assembly2.cif.gz_C mitf hlhlz structure 0.9493 12 117
ID Description Score Start End Superfamily
5h34A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9671 4 117 2.40.50.140
5h34A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9587 4 117 2.40.50.140
af_Q2G1R9_548_656_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9433 5 116 2.40.50.140
af_Q2G1R9_548_656_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.935 5 116 2.40.50.140
af_P00959_568_677_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9267 7 117 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0C5WNZ1-F1-model_v4 tRNA-binding domain-containing protein 0.9921 1 117 GO:0000049
AF-A0A0F9ZRP8-F1-model_v4 EMAP domain protein 0.9912 23 117 GO:0000049
AF-A0A537E4N9-F1-model_v4 tRNA-binding domain-containing protein 0.9905 5 117 GO:0000049
AF-A0A848X424-F1-model_v4 tRNA-binding protein 0.9887 2 117 GO:0000049
AF-A0A2N6CQ93-F1-model_v4 tRNA-binding protein 0.9856 34 117 GO:0000049

Map