F433457

General Info

Members Datasets Scaffolds Average Seq Length
396 254 792 188

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100000197|Ga0068856_10000019735
Length 201
Sequence MARATATNMMKRTSIVAAVIAGFGLGVLVGAFGYFAWPLLGRDDVVTAPSHPVWAEVEWPFPIDEWGKGKAFRCAAADCGVEVNFYVRAKIGFCNCTTGVSDDNELDRLSDFSLMGESHSVLGPGHPIRVAWMNGRSRPYAIADSYRRRKSALTVAFNDHCDAVVATVVVAHDRPAAIEPRVIEFLNSQTVIHWAEVTLGL

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 5.05
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100000197 3300005614 Bacteria 63857
2 JGI24742J22300_10019920 3300002244 Bacteria 1141
3 JGI24742J22300_10055090 3300002244 Bacteria 725
4 Ga0070676_10492680 3300005328 Unclassified 869
5 Ga0070683_100011759 3300005329 Bacteria 7579
6 Ga0070683_100251703 3300005329 Bacteria 1680
7 Ga0070680_100381158 3300005336 Bacteria 1201
8 Ga0068868_100794685 3300005338 Bacteria 853
9 Ga0070660_100157149 3300005339 Bacteria 1831
10 Ga0070668_100133336 3300005347 Bacteria 1995
11 Ga0070669_100066773 3300005353 Bacteria 2652
12 Ga0070675_100410001 3300005354 Bacteria 1210
13 Ga0070671_100460055 3300005355 Bacteria 1092
14 Ga0070674_100000199 3300005356 Bacteria 28875
15 Ga0070674_100084424 3300005356 Bacteria 2277
16 Ga0070673_100160421 3300005364 Bacteria 1912
17 Ga0070673_100821109 3300005364 Bacteria 859
18 Ga0070688_100069258 3300005365 Bacteria 2252
19 Ga0070659_100047631 3300005366 Bacteria 3363
20 Ga0070667_100007428 3300005367 Bacteria 9104
21 Ga0070667_100048039 3300005367 Bacteria 3592
22 Ga0070667_100278994 3300005367 Bacteria 1500
23 Ga0070709_10004732 3300005434 Bacteria 7347
24 Ga0070709_10340042 3300005434 Bacteria 1106
25 Ga0070714_100024234 3300005435 Bacteria 4992
26 Ga0070714_100033396 3300005435 Bacteria 4301
27 Ga0070713_100004274 3300005436 Bacteria 9560
28 Ga0070713_100461281 3300005436 Bacteria 1195
29 Ga0070713_100887710 3300005436 Bacteria 857
30 Ga0070710_10027111 3300005437 Bacteria 3052
31 Ga0070710_10057172 3300005437 Bacteria 2210
32 Ga0070701_10069068 3300005438 Bacteria 1884
33 Ga0070711_100033464 3300005439 Bacteria 3423
34 Ga0070711_100047127 3300005439 Bacteria 2941
35 Ga0070711_100273114 3300005439 Bacteria 1335
36 Ga0070705_100265844 3300005440 Bacteria 1212
37 Ga0070700_100502011 3300005441 Unclassified 933
38 Ga0070663_100043007 3300005455 Bacteria 3177
39 Ga0070663_100052628 3300005455 Bacteria 2904
40 Ga0070663_100630896 3300005455 Unclassified 904
41 Ga0070678_100209415 3300005456 Bacteria 1614
42 Ga0070678_100210448 3300005456 Bacteria 1611
43 Ga0070662_100132846 3300005457 Bacteria 1921
44 Ga0070681_10535558 3300005458 Bacteria 1085
45 Ga0068867_100027229 3300005459 Bacteria 4107
46 Ga0068867_100155646 3300005459 Bacteria 1799
47 Ga0070699_100300023 3300005518 Bacteria 1441
48 Ga0070679_100690129 3300005530 Bacteria 964
49 Ga0070679_100860509 3300005530 Bacteria 850
50 Ga0070684_100092333 3300005535 Bacteria 2693
51 Ga0068853_100163968 3300005539 Bacteria 2007
52 Ga0070686_100040236 3300005544 Bacteria 2916
53 Ga0070695_100239713 3300005545 Bacteria 1315
54 Ga0070695_100277219 3300005545 Bacteria 1231
55 Ga0070695_100287617 3300005545 Bacteria 1210
56 Ga0070665_100222931 3300005548 Bacteria 1886
57 Ga0070704_100025025 3300005549 Bacteria 3925
58 Ga0070704_100174461 3300005549 Bacteria 1713
59 Ga0068855_101344116 3300005563 Bacteria 738
60 Ga0070664_100823107 3300005564 Unclassified 869
61 Ga0068854_100172772 3300005578 Bacteria 1683
62 Ga0068854_100257398 3300005578 Bacteria 1396
63 Ga0068856_100370822 3300005614 Bacteria 1450
64 Ga0068856_101165897 3300005614 Bacteria 787
65 Ga0070702_100093593 3300005615 Bacteria 1828
66 Ga0068852_100392810 3300005616 Bacteria 1363
67 Ga0068852_101663428 3300005616 Unclassified 661
68 Ga0068861_100773624 3300005719 Unclassified 899
69 Ga0068863_100501145 3300005841 Bacteria 1196
70 Ga0068863_100694690 3300005841 Bacteria 1011
71 Ga0068858_100190191 3300005842 Bacteria 1940
72 Ga0068860_100017244 3300005843 Bacteria 7039
73 Ga0068862_100162830 3300005844 Bacteria 1992
74 Ga0081540_1000011 3300005983 Bacteria 191880
75 Ga0075368_10113899 3300006042 Bacteria 1116
76 Ga0075363_100085319 3300006048 Bacteria 1732
77 Ga0075363_100089021 3300006048 Bacteria 1697
78 Ga0075364_10254959 3300006051 Unclassified 1192
79 Ga0070716_100026259 3300006173 Bacteria 3117
80 Ga0070712_100072389 3300006175 Bacteria 2469
81 Ga0070712_100172326 3300006175 Unclassified 1680
82 Ga0070712_100522588 3300006175 Bacteria 997
83 Ga0075366_10128236 3300006195 Bacteria 1530
84 Ga0097621_100005662 3300006237 Bacteria 8816
85 Ga0075370_10074582 3300006353 Bacteria 1944
86 Ga0068871_100223515 3300006358 Bacteria 1632
87 Ga0075428_100021002 3300006844 Bacteria 7232
88 Ga0075428_100304673 3300006844 Bacteria 1713
89 Ga0075428_101494016 3300006844 Bacteria 708
90 Ga0075430_100000160 3300006846 Bacteria 44139
91 Ga0075430_100544329 3300006846 Bacteria 957
92 Ga0075434_100753214 3300006871 Unclassified 991
93 Ga0068865_100033940 3300006881 Bacteria 3419
94 Ga0068865_100052340 3300006881 Bacteria 2829
95 Ga0075435_100069557 3300007076 Bacteria 2871
96 Ga0111539_10024778 3300009094 Bacteria 7358
97 Ga0111539_10371050 3300009094 Bacteria 1666
98 Ga0105245_10005231 3300009098 Bacteria 11400
99 Ga0105245_10101509 3300009098 Bacteria 2663
100 Ga0105247_10389092 3300009101 Bacteria 990
101 Ga0114129_10691876 3300009147 Bacteria 1311
102 Ga0114129_12104211 3300009147 Bacteria 681
103 Ga0105243_10133182 3300009148 Bacteria 2112
104 Ga0105243_10595444 3300009148 Unclassified 1064
105 Ga0105241_10031051 3300009174 Bacteria 3997
106 Ga0105242_10022232 3300009176 Bacteria 4985
107 Ga0105242_10353121 3300009176 Bacteria 1358
108 Ga0105248_10080111 3300009177 Bacteria 3670
109 Ga0105248_10204948 3300009177 Bacteria 2222
110 Ga0105237_10084502 3300009545 Bacteria 3165
111 Ga0105237_10122704 3300009545 Bacteria 2592
112 Ga0105238_10006757 3300009551 Bacteria 11461
113 Ga0105249_10127099 3300009553 Bacteria 2429
114 Ga0105249_10383753 3300009553 Bacteria 1431
115 Ga0105239_10007181 3300010375 Bacteria 12811
116 Ga0105239_10103274 3300010375 Bacteria 3154
117 Ga0105246_10301163 3300011119 Bacteria 1294
118 Ga0157374_10083131 3300013296 Bacteria 3041
119 Ga0157378_10011284 3300013297 Bacteria 7819
120 Ga0157378_10067768 3300013297 Bacteria 3199
121 Ga0157378_10345407 3300013297 Bacteria 1452
122 Ga0163162_10019796 3300013306 Bacteria 6608
123 Ga0163162_10059280 3300013306 Bacteria 3859
124 Ga0163162_10484706 3300013306 Unclassified 1368
125 Ga0157372_10675915 3300013307 Bacteria 1202
126 Ga0157375_10004649 3300013308 Bacteria 11933
127 Ga0157375_10316981 3300013308 Bacteria 1724
128 Ga0163163_10243830 3300014325 Unclassified 1847
129 Ga0157380_10133063 3300014326 Bacteria 2125
130 Ga0157380_10238367 3300014326 Bacteria 1638
131 Ga0157380_10575203 3300014326 Bacteria 1110
132 Ga0157377_10836566 3300014745 Unclassified 682
133 Ga0157379_10035258 3300014968 Bacteria 4461
134 Ga0157379_10303397 3300014968 Bacteria 1455
135 Ga0157376_10000819 3300014969 Bacteria 20406
136 Ga0157376_10089263 3300014969 Bacteria 2665
137 Ga0163161_10124781 3300017792 Bacteria 1937
138 Ga0213876_10026105 3300021384 Bacteria 3081
139 Ga0213875_10000009 3300021388 Bacteria 451129
140 Ga0207682_10000171 3300025893 Bacteria 29817
141 Ga0207692_10292229 3300025898 Bacteria 989
142 Ga0207642_10002922 3300025899 Bacteria 5345
143 Ga0207688_10012225 3300025901 Bacteria 4668
144 Ga0207688_10021380 3300025901 Bacteria 3535
145 Ga0207680_10099136 3300025903 Bacteria 1869
146 Ga0207680_10327093 3300025903 Bacteria 1073
147 Ga0207699_10233402 3300025906 Bacteria 1261
148 Ga0207645_10009463 3300025907 Bacteria 6737
149 Ga0207645_10096166 3300025907 Bacteria 1908
150 Ga0207705_10781246 3300025909 Bacteria 741
151 Ga0207707_10446752 3300025912 Bacteria 1107
152 Ga0207671_10061495 3300025914 Bacteria 2786
153 Ga0207671_10291045 3300025914 Bacteria 1289
154 Ga0207693_10024163 3300025915 Bacteria 4826
155 Ga0207693_10111111 3300025915 Unclassified 2149
156 Ga0207663_10004708 3300025916 Bacteria 6814
157 Ga0207663_10017435 3300025916 Bacteria 4002
158 Ga0207663_10113801 3300025916 Bacteria 1840
159 Ga0207663_10210386 3300025916 Bacteria 1409
160 Ga0207663_10589841 3300025916 Unclassified 872
161 Ga0207662_10169540 3300025918 Bacteria 1399
162 Ga0207652_10150974 3300025921 Bacteria 2080
163 Ga0207652_10859942 3300025921 Bacteria 803
164 Ga0207681_10025578 3300025923 Bacteria 3798
165 Ga0207681_10319519 3300025923 Bacteria 1234
166 Ga0207681_10436549 3300025923 Bacteria 1063
167 Ga0207694_10394246 3300025924 Bacteria 1150
168 Ga0207659_10149614 3300025926 Bacteria 1822
169 Ga0207659_10445382 3300025926 Bacteria 1090
170 Ga0207687_10007580 3300025927 Bacteria 7135
171 Ga0207687_10173528 3300025927 Bacteria 1665
172 Ga0207700_10117984 3300025928 Bacteria 2147
173 Ga0207700_10374650 3300025928 Bacteria 1244
174 Ga0207700_10678317 3300025928 Bacteria 919
175 Ga0207664_10020531 3300025929 Bacteria 4898
176 Ga0207664_10127068 3300025929 Bacteria 2142
177 Ga0207644_10432684 3300025931 Bacteria 1079
178 Ga0207706_10014084 3300025933 Bacteria 7250
179 Ga0207706_10152849 3300025933 Bacteria 2030
180 Ga0207686_10003320 3300025934 Bacteria 8653
181 Ga0207709_10015546 3300025935 Bacteria 4220
182 Ga0207670_10063343 3300025936 Bacteria 2530
183 Ga0207669_10001961 3300025937 Bacteria 8730
184 Ga0207704_10016161 3300025938 Bacteria 3827
185 Ga0207704_10414319 3300025938 Bacteria 1066
186 Ga0207665_10011185 3300025939 Bacteria 5890
187 Ga0207691_10004900 3300025940 Bacteria 12937
188 Ga0207691_10016417 3300025940 Bacteria 7029
189 Ga0207661_10182296 3300025944 Bacteria 1835
190 Ga0207679_10818095 3300025945 Unclassified 850
191 Ga0207667_10403006 3300025949 Bacteria 1393
192 Ga0207651_10044673 3300025960 Bacteria 2967
193 Ga0207651_10197922 3300025960 Bacteria 1608
194 Ga0207651_10742318 3300025960 Bacteria 867
195 Ga0207712_10226406 3300025961 Bacteria 1498
196 Ga0207712_10391913 3300025961 Bacteria 1165
197 Ga0207668_10034877 3300025972 Bacteria 3345
198 Ga0207668_10055830 3300025972 Bacteria 2748
199 Ga0207668_10077249 3300025972 Bacteria 2400
200 Ga0207640_10223282 3300025981 Bacteria 1444
201 Ga0207640_10380411 3300025981 Bacteria 1143
202 Ga0207658_10013532 3300025986 Bacteria 5577
203 Ga0207658_10575987 3300025986 Bacteria 1009
204 Ga0207658_10733618 3300025986 Bacteria 894
205 Ga0207677_10162810 3300026023 Bacteria 1735
206 Ga0207677_10232909 3300026023 Bacteria 1485
207 Ga0207703_10150055 3300026035 Bacteria 2032
208 Ga0207639_10088923 3300026041 Bacteria 2467
209 Ga0207678_10015368 3300026067 Bacteria 6734
210 Ga0207678_10881061 3300026067 Unclassified 791
211 Ga0207702_10000044 3300026078 Bacteria 149419
212 Ga0207702_11346649 3300026078 Bacteria 708
213 Ga0207641_10482244 3300026088 Bacteria 1202
214 Ga0207641_10644309 3300026088 Bacteria 1040
215 Ga0207648_10015564 3300026089 Bacteria 6990
216 Ga0207675_100054289 3300026118 Bacteria 3737
217 Ga0207683_10000902 3300026121 Bacteria 27333
218 Ga0207683_10057164 3300026121 Bacteria 3424
219 Ga0207683_10250543 3300026121 Bacteria 1616
220 Ga0207698_11149624 3300026142 Unclassified 790
221 Ga0207428_10093394 3300027907 Bacteria 2334
222 Ga0268266_10115185 3300028379 Bacteria 2386
223 Ga0268265_10024223 3300028380 Bacteria 4291
224 Ga0268264_10054764 3300028381 Bacteria 3331
225 Ga0265337_1001627 3300028556 Bacteria 10929
226 Ga0265318_10009425 3300028577 Bacteria 4293
227 Ga0265330_10270340 3300031235 Bacteria 716
228 Ga0265332_10111343 3300031238 Bacteria 1153
229 Ga0265332_10117871 3300031238 Bacteria 1116
230 Ga0265328_10040525 3300031239 Bacteria 1716
231 Ga0265320_10025841 3300031240 Bacteria 3081
232 Ga0265325_10037423 3300031241 Bacteria 2565
233 Ga0265340_10015508 3300031247 Bacteria 3958
234 Ga0265331_10051765 3300031250 Bacteria 1965
235 Ga0265313_10023371 3300031595 Bacteria 3330
236 Ga0265314_10014725 3300031711 Bacteria 6239
237 Ga0265314_10357655 3300031711 Unclassified 801
238 Ga0265342_10092477 3300031712 Bacteria 1732
239 Ga0265342_10337729 3300031712 Bacteria 787
240 Ga0316053_106356 3300032120 Bacteria 768
241 Ga0373934_0084990 3300035086 Bacteria 1273
242 Ga0373945_0260127 3300035116 Bacteria 735
243 Ga0373953_0062686 3300035117 Bacteria 1522
244 Ga0373953_0176790 3300035117 Bacteria 920
245 Ga0373954_0019817 3300035118 Bacteria 3036
246 Ga0373954_0082496 3300035118 Bacteria 1537
247 Ga0373956_0198592 3300035119 Bacteria 950
248 Ga0373943_0089227 3300035170 Bacteria 1594
249 Ga0373955_0275592 3300035172 Bacteria 1011
250 Ga0373962_0163535 3300035242 Bacteria 736
251 Ga0373931_0033890 3300035691 Bacteria 2648
252 Ga0373931_0071009 3300035691 Bacteria 1901
253 Ga0373935_0337595 3300035692 Bacteria 1072
254 Ga0373935_0555107 3300035692 Bacteria 837
255 Ga0373927_0536376 3300035695 Unclassified 773
256 Ga0373927_0543218 3300035695 Bacteria 768
257 Ga0373933_0075248 3300035724 Bacteria 2061
258 Ga0373947_0022285 3300035725 Bacteria 3672
259 Ga0373947_0099220 3300035725 Bacteria 1828
260 Ga0373937_0120108 3300036401 Bacteria 2449
261 Ga0373937_0666080 3300036401 Bacteria 986
262 Ga0373925_0008206 3300037068 Bacteria 7603
263 Ga0373925_0292668 3300037068 Bacteria 1313
264 Ga0373925_0554906 3300037068 Bacteria 945
265 Ga0436364_0174146 3300037853 Bacteria 60383
266 Ga0436364_0898963 3300037853 Bacteria 670
267 Ga0436365_0057260 3300039437 Bacteria 4747
268 Ga0436365_0084831 3300039437 Unclassified 1383
269 Ga0436362_0151641 3300039453 Bacteria 746
270 Ga0466963_0045287 3300044694 Bacteria 2898
271 Ga0466963_0146918 3300044694 Unclassified 1636
272 Ga0466971_0047161 3300044719 Bacteria 1937
273 Ga0466958_0113519 3300045836 Bacteria 1692
274 Ga0495592_0072352 3300046454 Bacteria 2508
275 Ga0495651_0013190 3300046462 Bacteria 6388
276 Ga0495651_0171655 3300046462 Bacteria 1544
277 Ga0495653_0022919 3300046463 Bacteria 5050
278 Ga0495653_0025236 3300046463 Bacteria 4781
279 Ga0495580_0712609 3300046472 Bacteria 656
280 Ga0495662_0152132 3300046476 Unclassified 1139
281 Ga0495662_0184382 3300046476 Bacteria 1029
282 Ga0495662_0347397 3300046476 Bacteria 729
283 Ga0495664_0056765 3300046477 Bacteria 2329
284 Ga0495664_0090329 3300046477 Bacteria 1841
285 Ga0495584_0057733 3300046491 Bacteria 1953
286 Ga0495585_0163013 3300046492 Bacteria 1156
287 Ga0495608_0015553 3300046511 Bacteria 5274
288 Ga0495608_0018606 3300046511 Bacteria 4789
289 Ga0495618_0054846 3300046514 Bacteria 2523
290 Ga0495618_0083135 3300046514 Bacteria 2045
291 Ga0495618_0172859 3300046514 Bacteria 1374
292 Ga0495628_0032364 3300046516 Bacteria 4221
293 Ga0495628_0047620 3300046516 Bacteria 3400
294 Ga0495631_0015309 3300046518 Bacteria 3677
295 Ga0495644_0063854 3300046523 Bacteria 1384
296 Ga0495652_0023822 3300046529 Bacteria 5423
297 Ga0495652_0052146 3300046529 Bacteria 3490
298 Ga0495665_0043690 3300046531 Bacteria 2383
299 Ga0495640_0058301 3300046533 Bacteria 2633
300 Ga0495640_0100039 3300046533 Bacteria 1904
301 Ga0495586_0092468 3300046535 Bacteria 1672
302 Ga0495587_0005391 3300046536 Bacteria 8358
303 Ga0495598_0019577 3300046537 Bacteria 1777
304 Ga0495598_0132618 3300046537 Bacteria 856
305 Ga0495645_0001785 3300046543 Bacteria 14612
306 Ga0495645_0106049 3300046543 Bacteria 1993
307 Ga0495645_0131073 3300046543 Bacteria 1757
308 Ga0495633_0449904 3300046558 Unclassified 582
309 Ga0495667_0025788 3300046559 Bacteria 3960
310 Ga0495656_0404825 3300046615 Bacteria 714
311 Ga0495634_0111076 3300046642 Bacteria 1762
312 Ga0495634_0157987 3300046642 Bacteria 1431
313 Ga0495635_0042706 3300046663 Bacteria 3130
314 Ga0495635_0207172 3300046663 Bacteria 1329
315 Ga0495657_0036431 3300046675 Bacteria 3400
316 Ga0495599_0056518 3300046678 Bacteria 2456
317 Ga0495623_0022807 3300046679 Bacteria 4042
318 Ga0495623_0049061 3300046679 Bacteria 2675
319 Ga0495646_0022209 3300046680 Bacteria 4003
320 Ga0495646_0032298 3300046680 Bacteria 3258
321 Ga0495658_0318199 3300046683 Bacteria 986
322 Ga0495669_0001036 3300046684 Bacteria 11586
323 Ga0495613_0252290 3300046689 Bacteria 1231
324 Ga0495613_0480862 3300046689 Unclassified 838
325 Ga0495589_0130117 3300046794 Bacteria 1209
326 Ga0495600_0352695 3300046809 Bacteria 921
327 Ga0495581_0435663 3300047315 Unclassified 764
328 Ga0495604_0010951 3300047317 Bacteria 7199
329 Ga0495636_0095177 3300047318 Bacteria 1297
330 Ga0495674_0022118 3300047319 Bacteria 5868
331 Ga0495674_0040751 3300047319 Bacteria 4152
332 Ga0495674_0176633 3300047319 Bacteria 1779
333 Ga0495672_0126170 3300047320 Bacteria 1353
334 Ga0495680_0088704 3300047322 Bacteria 2323
335 Ga0495680_0326411 3300047322 Bacteria 1073
336 Ga0495675_0018834 3300047444 Bacteria 4386
337 Ga0495685_082929 3300047447 Bacteria 1067
338 Ga0495684_0046134 3300047471 Bacteria 3334
339 Ga0495684_0093713 3300047471 Bacteria 2274
340 Ga0495686_0024222 3300047472 Bacteria 3992
341 Ga0495602_0030104 3300048088 Bacteria 5156
342 Ga0495602_0082515 3300048088 Bacteria 2697
343 Ga0496100_0002179 3300048903 Bacteria 9879
344 Ga0496101_0000426 3300048904 Bacteria 26985
345 Ga0496101_0016385 3300048904 Bacteria 5007
346 Ga0496102_0001022 3300048905 Bacteria 26076
347 Ga0496102_0070816 3300048905 Bacteria 3202
348 Ga0496103_0338891 3300048906 Bacteria 967
349 Ga0496104_0000729 3300048907 Bacteria 28333
350 Ga0496104_0108261 3300048907 Bacteria 2663
351 Ga0496104_0529152 3300048907 Unclassified 1090
352 Ga0496105_0003749 3300048908 Bacteria 11325
353 Ga0496106_0002193 3300048909 Bacteria 14595
354 Ga0496106_1530914 3300048909 Unclassified 512
355 Ga0496107_0002951 3300048910 Bacteria 11259
356 Ga0496107_0934547 3300048910 Unclassified 631
357 Ga0496109_0052647 3300048912 Bacteria 3711
358 Ga0496110_0186266 3300048913 Bacteria 1885
359 Ga0496114_0004980 3300048917 Bacteria 10362
360 Ga0496115_0000917 3300048918 Bacteria 21406
361 Ga0496115_0012651 3300048918 Bacteria 6359
362 Ga0496115_0178796 3300048918 Bacteria 1754
363 Ga0496119_0401407 3300048922 Bacteria 654
364 Ga0496120_0073980 3300048923 Bacteria 1863
365 Ga0501038_0577425 3300049574 Bacteria 853
366 Ga0501048_0172885 3300049582 Unclassified 1531
367 Ga0501074_0530528 3300049590 Bacteria 834
368 Ga0501077_0133556 3300049593 Bacteria 1574
369 Ga0501081_0623538 3300049743 Unclassified 808
370 nmdc:mga03683_59181_c1 3300050489 Bacteria 1616
371 nmdc:mga00v17_104419_c1 3300050491 Bacteria 1792
372 nmdc:mga0yw44_431634_c1 3300050492 Unclassified 892
373 nmdc:mga0yw44_78340_c1 3300050492 Bacteria 2067
374 nmdc:mga0k408_117297_c1 3300050493 Bacteria 1575
375 nmdc:mga0k408_143861_c1 3300050493 Bacteria 1419
376 nmdc:mga0k408_54995_c1 3300050493 Bacteria 2307
377 nmdc:mga05p37_125032_c1 3300050507 Bacteria 3158
378 nmdc:mga0qj67_64_c1 3300050509 Bacteria 77795
379 nmdc:mga08y16_351174_c1 3300050511 Bacteria 1515
380 nmdc:mga0rr50_277899_c1 3300050513 Bacteria 1397
381 Ga0495601_0030413 3300053077 Unclassified 3353
382 Ga0495601_0087187 3300053077 Bacteria 2006
383 Ga0495601_0118989 3300053077 Bacteria 1714
384 Ga0495601_0207956 3300053077 Bacteria 1278
385 Ga0495612_0010174 3300053078 Bacteria 3804
386 Ga0495612_0021260 3300053078 Bacteria 2603
387 Ga0495595_0025650 3300053084 Bacteria 2614
388 Ga0495595_0085457 3300053084 Bacteria 1508
389 Ga0495619_0007375 3300053085 Bacteria 6966
390 Ga0495619_0270904 3300053085 Bacteria 1177
391 Ga0495619_0313589 3300053085 Bacteria 1086
392 Ga0500595_003436 3300053119 Bacteria 7393
393 Ga0500597_143689 3300053120 Bacteria 1027
394 Ga0500616_0006571 3300053153 Bacteria 7583
395 Ga0501084_1210379 3300054114 Bacteria 634
396 Ga0530510_0289466 3300061734 Bacteria 1224
397 Ga0068856_100000197
398 JGI24742J22300_10019920
399 JGI24742J22300_10055090
400 Ga0070676_10492680
401 Ga0070683_100011759
402 Ga0070683_100251703
403 Ga0070680_100381158
404 Ga0068868_100794685
405 Ga0070660_100157149
406 Ga0070668_100133336
407 Ga0070669_100066773
408 Ga0070675_100410001
409 Ga0070671_100460055
410 Ga0070674_100000199
411 Ga0070674_100084424
412 Ga0070673_100160421
413 Ga0070673_100821109
414 Ga0070688_100069258
415 Ga0070659_100047631
416 Ga0070667_100007428
417 Ga0070667_100048039
418 Ga0070667_100278994
419 Ga0070709_10004732
420 Ga0070709_10340042
421 Ga0070714_100024234
422 Ga0070714_100033396
423 Ga0070713_100004274
424 Ga0070713_100461281
425 Ga0070713_100887710
426 Ga0070710_10027111
427 Ga0070710_10057172
428 Ga0070701_10069068
429 Ga0070711_100033464
430 Ga0070711_100047127
431 Ga0070711_100273114
432 Ga0070705_100265844
433 Ga0070700_100502011
434 Ga0070663_100043007
435 Ga0070663_100052628
436 Ga0070663_100630896
437 Ga0070678_100209415
438 Ga0070678_100210448
439 Ga0070662_100132846
440 Ga0070681_10535558
441 Ga0068867_100027229
442 Ga0068867_100155646
443 Ga0070699_100300023
444 Ga0070679_100690129
445 Ga0070679_100860509
446 Ga0070684_100092333
447 Ga0068853_100163968
448 Ga0070686_100040236
449 Ga0070695_100239713
450 Ga0070695_100277219
451 Ga0070695_100287617
452 Ga0070665_100222931
453 Ga0070704_100025025
454 Ga0070704_100174461
455 Ga0068855_101344116
456 Ga0070664_100823107
457 Ga0068854_100172772
458 Ga0068854_100257398
459 Ga0068856_100370822
460 Ga0068856_101165897
461 Ga0070702_100093593
462 Ga0068852_100392810
463 Ga0068852_101663428
464 Ga0068861_100773624
465 Ga0068863_100501145
466 Ga0068863_100694690
467 Ga0068858_100190191
468 Ga0068860_100017244
469 Ga0068862_100162830
470 Ga0081540_1000011
471 Ga0075368_10113899
472 Ga0075363_100085319
473 Ga0075363_100089021
474 Ga0075364_10254959
475 Ga0070716_100026259
476 Ga0070712_100072389
477 Ga0070712_100172326
478 Ga0070712_100522588
479 Ga0075366_10128236
480 Ga0097621_100005662
481 Ga0075370_10074582
482 Ga0068871_100223515
483 Ga0075428_100021002
484 Ga0075428_100304673
485 Ga0075428_101494016
486 Ga0075430_100000160
487 Ga0075430_100544329
488 Ga0075434_100753214
489 Ga0068865_100033940
490 Ga0068865_100052340
491 Ga0075435_100069557
492 Ga0111539_10024778
493 Ga0111539_10371050
494 Ga0105245_10005231
495 Ga0105245_10101509
496 Ga0105247_10389092
497 Ga0114129_10691876
498 Ga0114129_12104211
499 Ga0105243_10133182
500 Ga0105243_10595444
501 Ga0105241_10031051
502 Ga0105242_10022232
503 Ga0105242_10353121
504 Ga0105248_10080111
505 Ga0105248_10204948
506 Ga0105237_10084502
507 Ga0105237_10122704
508 Ga0105238_10006757
509 Ga0105249_10127099
510 Ga0105249_10383753
511 Ga0105239_10007181
512 Ga0105239_10103274
513 Ga0105246_10301163
514 Ga0157374_10083131
515 Ga0157378_10011284
516 Ga0157378_10067768
517 Ga0157378_10345407
518 Ga0163162_10019796
519 Ga0163162_10059280
520 Ga0163162_10484706
521 Ga0157372_10675915
522 Ga0157375_10004649
523 Ga0157375_10316981
524 Ga0163163_10243830
525 Ga0157380_10133063
526 Ga0157380_10238367
527 Ga0157380_10575203
528 Ga0157377_10836566
529 Ga0157379_10035258
530 Ga0157379_10303397
531 Ga0157376_10000819
532 Ga0157376_10089263
533 Ga0163161_10124781
534 Ga0213876_10026105
535 Ga0213875_10000009
536 Ga0207682_10000171
537 Ga0207692_10292229
538 Ga0207642_10002922
539 Ga0207688_10012225
540 Ga0207688_10021380
541 Ga0207680_10099136
542 Ga0207680_10327093
543 Ga0207699_10233402
544 Ga0207645_10009463
545 Ga0207645_10096166
546 Ga0207705_10781246
547 Ga0207707_10446752
548 Ga0207671_10061495
549 Ga0207671_10291045
550 Ga0207693_10024163
551 Ga0207693_10111111
552 Ga0207663_10004708
553 Ga0207663_10017435
554 Ga0207663_10113801
555 Ga0207663_10210386
556 Ga0207663_10589841
557 Ga0207662_10169540
558 Ga0207652_10150974
559 Ga0207652_10859942
560 Ga0207681_10025578
561 Ga0207681_10319519
562 Ga0207681_10436549
563 Ga0207694_10394246
564 Ga0207659_10149614
565 Ga0207659_10445382
566 Ga0207687_10007580
567 Ga0207687_10173528
568 Ga0207700_10117984
569 Ga0207700_10374650
570 Ga0207700_10678317
571 Ga0207664_10020531
572 Ga0207664_10127068
573 Ga0207644_10432684
574 Ga0207706_10014084
575 Ga0207706_10152849
576 Ga0207686_10003320
577 Ga0207709_10015546
578 Ga0207670_10063343
579 Ga0207669_10001961
580 Ga0207704_10016161
581 Ga0207704_10414319
582 Ga0207665_10011185
583 Ga0207691_10004900
584 Ga0207691_10016417
585 Ga0207661_10182296
586 Ga0207679_10818095
587 Ga0207667_10403006
588 Ga0207651_10044673
589 Ga0207651_10197922
590 Ga0207651_10742318
591 Ga0207712_10226406
592 Ga0207712_10391913
593 Ga0207668_10034877
594 Ga0207668_10055830
595 Ga0207668_10077249
596 Ga0207640_10223282
597 Ga0207640_10380411
598 Ga0207658_10013532
599 Ga0207658_10575987
600 Ga0207658_10733618
601 Ga0207677_10162810
602 Ga0207677_10232909
603 Ga0207703_10150055
604 Ga0207639_10088923
605 Ga0207678_10015368
606 Ga0207678_10881061
607 Ga0207702_10000044
608 Ga0207702_11346649
609 Ga0207641_10482244
610 Ga0207641_10644309
611 Ga0207648_10015564
612 Ga0207675_100054289
613 Ga0207683_10000902
614 Ga0207683_10057164
615 Ga0207683_10250543
616 Ga0207698_11149624
617 Ga0207428_10093394
618 Ga0268266_10115185
619 Ga0268265_10024223
620 Ga0268264_10054764
621 Ga0265337_1001627
622 Ga0265318_10009425
623 Ga0265330_10270340
624 Ga0265332_10111343
625 Ga0265332_10117871
626 Ga0265328_10040525
627 Ga0265320_10025841
628 Ga0265325_10037423
629 Ga0265340_10015508
630 Ga0265331_10051765
631 Ga0265313_10023371
632 Ga0265314_10014725
633 Ga0265314_10357655
634 Ga0265342_10092477
635 Ga0265342_10337729
636 Ga0316053_106356
637 Ga0373934_0084990
638 Ga0373945_0260127
639 Ga0373953_0062686
640 Ga0373953_0176790
641 Ga0373954_0019817
642 Ga0373954_0082496
643 Ga0373956_0198592
644 Ga0373943_0089227
645 Ga0373955_0275592
646 Ga0373962_0163535
647 Ga0373931_0033890
648 Ga0373931_0071009
649 Ga0373935_0337595
650 Ga0373935_0555107
651 Ga0373927_0536376
652 Ga0373927_0543218
653 Ga0373933_0075248
654 Ga0373947_0022285
655 Ga0373947_0099220
656 Ga0373937_0120108
657 Ga0373937_0666080
658 Ga0373925_0008206
659 Ga0373925_0292668
660 Ga0373925_0554906
661 Ga0436364_0174146
662 Ga0436364_0898963
663 Ga0436365_0057260
664 Ga0436365_0084831
665 Ga0436362_0151641
666 Ga0466963_0045287
667 Ga0466963_0146918
668 Ga0466971_0047161
669 Ga0466958_0113519
670 Ga0495592_0072352
671 Ga0495651_0013190
672 Ga0495651_0171655
673 Ga0495653_0022919
674 Ga0495653_0025236
675 Ga0495580_0712609
676 Ga0495662_0152132
677 Ga0495662_0184382
678 Ga0495662_0347397
679 Ga0495664_0056765
680 Ga0495664_0090329
681 Ga0495584_0057733
682 Ga0495585_0163013
683 Ga0495608_0015553
684 Ga0495608_0018606
685 Ga0495618_0054846
686 Ga0495618_0083135
687 Ga0495618_0172859
688 Ga0495628_0032364
689 Ga0495628_0047620
690 Ga0495631_0015309
691 Ga0495644_0063854
692 Ga0495652_0023822
693 Ga0495652_0052146
694 Ga0495665_0043690
695 Ga0495640_0058301
696 Ga0495640_0100039
697 Ga0495586_0092468
698 Ga0495587_0005391
699 Ga0495598_0019577
700 Ga0495598_0132618
701 Ga0495645_0001785
702 Ga0495645_0106049
703 Ga0495645_0131073
704 Ga0495633_0449904
705 Ga0495667_0025788
706 Ga0495656_0404825
707 Ga0495634_0111076
708 Ga0495634_0157987
709 Ga0495635_0042706
710 Ga0495635_0207172
711 Ga0495657_0036431
712 Ga0495599_0056518
713 Ga0495623_0022807
714 Ga0495623_0049061
715 Ga0495646_0022209
716 Ga0495646_0032298
717 Ga0495658_0318199
718 Ga0495669_0001036
719 Ga0495613_0252290
720 Ga0495613_0480862
721 Ga0495589_0130117
722 Ga0495600_0352695
723 Ga0495581_0435663
724 Ga0495604_0010951
725 Ga0495636_0095177
726 Ga0495674_0022118
727 Ga0495674_0040751
728 Ga0495674_0176633
729 Ga0495672_0126170
730 Ga0495680_0088704
731 Ga0495680_0326411
732 Ga0495675_0018834
733 Ga0495685_082929
734 Ga0495684_0046134
735 Ga0495684_0093713
736 Ga0495686_0024222
737 Ga0495602_0030104
738 Ga0495602_0082515
739 Ga0496100_0002179
740 Ga0496101_0000426
741 Ga0496101_0016385
742 Ga0496102_0001022
743 Ga0496102_0070816
744 Ga0496103_0338891
745 Ga0496104_0000729
746 Ga0496104_0108261
747 Ga0496104_0529152
748 Ga0496105_0003749
749 Ga0496106_0002193
750 Ga0496106_1530914
751 Ga0496107_0002951
752 Ga0496107_0934547
753 Ga0496109_0052647
754 Ga0496110_0186266
755 Ga0496114_0004980
756 Ga0496115_0000917
757 Ga0496115_0012651
758 Ga0496115_0178796
759 Ga0496119_0401407
760 Ga0496120_0073980
761 Ga0501038_0577425
762 Ga0501048_0172885
763 Ga0501074_0530528
764 Ga0501077_0133556
765 Ga0501081_0623538
766 nmdc:mga03683_59181_c1
767 nmdc:mga00v17_104419_c1
768 nmdc:mga0yw44_431634_c1
769 nmdc:mga0yw44_78340_c1
770 nmdc:mga0k408_117297_c1
771 nmdc:mga0k408_143861_c1
772 nmdc:mga0k408_54995_c1
773 nmdc:mga05p37_125032_c1
774 nmdc:mga0qj67_64_c1
775 nmdc:mga08y16_351174_c1
776 nmdc:mga0rr50_277899_c1
777 Ga0495601_0030413
778 Ga0495601_0087187
779 Ga0495601_0118989
780 Ga0495601_0207956
781 Ga0495612_0010174
782 Ga0495612_0021260
783 Ga0495595_0025650
784 Ga0495595_0085457
785 Ga0495619_0007375
786 Ga0495619_0270904
787 Ga0495619_0313589
788 Ga0500595_003436
789 Ga0500597_143689
790 Ga0500616_0006571
791 Ga0501084_1210379
792 Ga0530510_0289466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o9s-assembly1.cif.gz_A crystal structure of staphylococcus aureus mecr1 antibiotic-sensor domain in complex with avibactam 0.7057 121 171
3d2l-assembly1.cif.gz_A crystal structure of sam-dependent methyltransferase (zp_00538691.1) from exiguobacterium sp. 255-15 at 1.90 a resolution 0.6862 113 162
6psg-assembly1.cif.gz_A crystal structure of class d beta-lactamase oxa-48 with faropenem 0.6853 121 176
7ass-assembly2.cif.gz_D oxa-48_l67f_caz. what doesnt kill you makes you stronger: sub-mic selection drives cryptic evolution of oxa-48 0.6847 121 176
4dx9-assembly12.cif.gz_W icap1 in complex with integrin beta 1 cytoplasmic tail 0.6836 116 170
ID Description Score Start End Superfamily
af_Q9GYL7_59_288_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7809 125 155 3.80.10.10
af_Q55E62_106_392_3.70.10.10 Alpha Beta;Box;Proliferating Cell Nuclear Antigen; 0.7446 123 155 3.70.10.10
af_A4I937_6_264_3.70.10.10 Alpha Beta;Box;Proliferating Cell Nuclear Antigen; 0.7375 124 155 3.70.10.10
4c7pA03 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;sec7 domains 0.7123 123 152 3.30.310.140
af_X2JAR4_20_254_3.40.33.10 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.6332 135 157 3.40.33.10
ID Description Score Start End GO Terms
AF-H5YKG6-F1-model_v4 Uncharacterized protein 0.9192 42 186
AF-H5YKG6-F1-model_v4 Uncharacterized protein 0.9132 42 186
AF-B8IQI5-F1-model_v4 Uncharacterized protein 0.9056 41 186
AF-A0A537UU47-F1-model_v4 Uncharacterized protein 0.8822 36 186
AF-A0A502GAD5-F1-model_v4 Uncharacterized protein 0.8675 39 183

Map