F433401
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 396 | 241 | 396 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100201321|Ga0070683_1002013212 |
| Length | 177 |
| Sequence | MDRMSDKAAGPWRLERFVTAQDQRGTYQRAVAELRAGAKASHWMWFIFPQIAGLGLSEISQRYAIGSLGEARAYLAHPVLGPRLRECARIVADTEGKSAERIFGPVDAMKLRSSMTLFAAADEEPGESVFHAVLAKYFNGIADEATVTRLLPARGRLWQWAGAACGPGRTAWRRPGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 103 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 180 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 188 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 230 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 232 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 239 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 240 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 241 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.67 |
| Nodule | 0 |
| Rhizoplane | 6.06 |
| Rhizosphere | 75.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10144995 | 3300001991 | Bacteria | 530 |
| 2 | JGI24735J21928_10063561 | 3300002067 | Bacteria | 1059 |
| 3 | JGI24748J21848_1009573 | 3300002074 | Bacteria | 1141 |
| 4 | JGI24748J21848_1025363 | 3300002074 | Bacteria | 723 |
| 5 | JGI24738J21930_10054779 | 3300002075 | Bacteria | 815 |
| 6 | JGI24749J21850_1029324 | 3300002076 | Bacteria | 788 |
| 7 | JGI24744J21845_10000226 | 3300002077 | Bacteria | 8994 |
| 8 | JGI24034J26672_10002361 | 3300002239 | Bacteria | 2586 |
| 9 | JGI24034J26672_10023353 | 3300002239 | Bacteria | 981 |
| 10 | JGI24034J26672_10065878 | 3300002239 | Bacteria | 642 |
| 11 | JGI24742J22300_10004297 | 3300002244 | Bacteria | 2330 |
| 12 | Ga0070676_10017923 | 3300005328 | Bacteria | 3920 |
| 13 | Ga0070683_100201321 | 3300005329 | Bacteria | 1891 |
| 14 | Ga0070690_100039717 | 3300005330 | Bacteria | 2974 |
| 15 | Ga0070670_100517998 | 3300005331 | Bacteria | 1062 |
| 16 | Ga0070677_10086411 | 3300005333 | Bacteria | 1355 |
| 17 | Ga0068869_100256418 | 3300005334 | Bacteria | 1399 |
| 18 | Ga0070666_10059968 | 3300005335 | Bacteria | 2574 |
| 19 | Ga0070666_10310874 | 3300005335 | Bacteria | 1123 |
| 20 | Ga0070682_100060413 | 3300005337 | Bacteria | 2397 |
| 21 | Ga0070682_100547324 | 3300005337 | Bacteria | 905 |
| 22 | Ga0068868_100000582 | 3300005338 | Bacteria | 24501 |
| 23 | Ga0068868_100356637 | 3300005338 | Bacteria | 1254 |
| 24 | Ga0070660_100168713 | 3300005339 | Bacteria | 1767 |
| 25 | Ga0070660_100998579 | 3300005339 | Bacteria | 707 |
| 26 | Ga0070689_100001541 | 3300005340 | Bacteria | 14693 |
| 27 | Ga0070691_10006121 | 3300005341 | Bacteria | 5492 |
| 28 | Ga0070687_100062164 | 3300005343 | Bacteria | 1976 |
| 29 | Ga0070668_100049519 | 3300005347 | Bacteria | 3232 |
| 30 | Ga0070668_100050031 | 3300005347 | Bacteria | 3217 |
| 31 | Ga0070669_100016429 | 3300005353 | Bacteria | 5280 |
| 32 | Ga0070669_100029005 | 3300005353 | Bacteria | 3988 |
| 33 | Ga0070675_100188298 | 3300005354 | Bacteria | 1787 |
| 34 | Ga0070671_100362940 | 3300005355 | Bacteria | 1237 |
| 35 | Ga0070674_100001347 | 3300005356 | Bacteria | 12944 |
| 36 | Ga0070674_100761029 | 3300005356 | Bacteria | 833 |
| 37 | Ga0070673_100411551 | 3300005364 | Bacteria | 1211 |
| 38 | Ga0070688_100482775 | 3300005365 | Bacteria | 932 |
| 39 | Ga0070659_100101704 | 3300005366 | Bacteria | 2313 |
| 40 | Ga0070659_100382855 | 3300005366 | Bacteria | 1185 |
| 41 | Ga0070667_100004738 | 3300005367 | Bacteria | 11399 |
| 42 | Ga0070667_100029808 | 3300005367 | Bacteria | 4549 |
| 43 | Ga0070667_100425688 | 3300005367 | Bacteria | 1211 |
| 44 | Ga0070709_10294681 | 3300005434 | Bacteria | 1183 |
| 45 | Ga0070709_10745979 | 3300005434 | Bacteria | 765 |
| 46 | Ga0070714_100082102 | 3300005435 | Bacteria | 2807 |
| 47 | Ga0070713_100043738 | 3300005436 | Bacteria | 3663 |
| 48 | Ga0070713_100653085 | 3300005436 | Bacteria | 1002 |
| 49 | Ga0070713_100995320 | 3300005436 | Bacteria | 809 |
| 50 | Ga0070710_10000230 | 3300005437 | Bacteria | 26115 |
| 51 | Ga0070710_10083131 | 3300005437 | Bacteria | 1873 |
| 52 | Ga0070701_10002124 | 3300005438 | Bacteria | 7542 |
| 53 | Ga0070711_100011498 | 3300005439 | Bacteria | 5499 |
| 54 | Ga0070711_100791229 | 3300005439 | Bacteria | 804 |
| 55 | Ga0070705_100014215 | 3300005440 | Bacteria | 4091 |
| 56 | Ga0070700_100027060 | 3300005441 | Bacteria | 3396 |
| 57 | Ga0070694_100020644 | 3300005444 | Bacteria | 4202 |
| 58 | Ga0070678_100002658 | 3300005456 | Bacteria | 9842 |
| 59 | Ga0070662_100005597 | 3300005457 | Bacteria | 8030 |
| 60 | Ga0068867_100054257 | 3300005459 | Bacteria | 2961 |
| 61 | Ga0070697_100920778 | 3300005536 | Bacteria | 776 |
| 62 | Ga0068853_100041206 | 3300005539 | Bacteria | 3943 |
| 63 | Ga0070672_100204368 | 3300005543 | Bacteria | 1652 |
| 64 | Ga0070686_100070360 | 3300005544 | Bacteria | 2288 |
| 65 | Ga0070686_100484123 | 3300005544 | Bacteria | 957 |
| 66 | Ga0070696_100001412 | 3300005546 | Bacteria | 15688 |
| 67 | Ga0070693_100070857 | 3300005547 | Bacteria | 2052 |
| 68 | Ga0070665_100024959 | 3300005548 | Bacteria | 6025 |
| 69 | Ga0070665_100509515 | 3300005548 | Bacteria | 1215 |
| 70 | Ga0070704_100002411 | 3300005549 | Bacteria | 10498 |
| 71 | Ga0068855_100893835 | 3300005563 | Bacteria | 939 |
| 72 | Ga0068854_100014497 | 3300005578 | Bacteria | 5197 |
| 73 | Ga0070702_100007927 | 3300005615 | Bacteria | 5115 |
| 74 | Ga0068859_100002920 | 3300005617 | Bacteria | 17355 |
| 75 | Ga0068859_100099145 | 3300005617 | Bacteria | 2969 |
| 76 | Ga0068859_102485698 | 3300005617 | Bacteria | 570 |
| 77 | Ga0068864_100168623 | 3300005618 | Bacteria | 1995 |
| 78 | Ga0068866_10005077 | 3300005718 | Bacteria | 5422 |
| 79 | Ga0068861_100000980 | 3300005719 | Bacteria | 17434 |
| 80 | Ga0068863_100003502 | 3300005841 | Bacteria | 15485 |
| 81 | Ga0068858_100026595 | 3300005842 | Bacteria | 5375 |
| 82 | Ga0068858_100393291 | 3300005842 | Bacteria | 1331 |
| 83 | Ga0068860_100004106 | 3300005843 | Bacteria | 14910 |
| 84 | Ga0068860_100298935 | 3300005843 | Bacteria | 1576 |
| 85 | Ga0068860_102097797 | 3300005843 | Bacteria | 586 |
| 86 | Ga0068862_100019024 | 3300005844 | Bacteria | 5727 |
| 87 | Ga0068862_101741460 | 3300005844 | Bacteria | 632 |
| 88 | Ga0081455_10009614 | 3300005937 | Bacteria | 9930 |
| 89 | Ga0081455_10234431 | 3300005937 | Unclassified | 1352 |
| 90 | Ga0070717_10199310 | 3300006028 | Bacteria | 1753 |
| 91 | Ga0070717_10604822 | 3300006028 | Bacteria | 994 |
| 92 | Ga0075365_10009545 | 3300006038 | Bacteria | 5588 |
| 93 | Ga0075365_10163930 | 3300006038 | Bacteria | 1550 |
| 94 | Ga0075365_10672038 | 3300006038 | Bacteria | 732 |
| 95 | Ga0075368_10116590 | 3300006042 | Bacteria | 1104 |
| 96 | Ga0075368_10118159 | 3300006042 | Bacteria | 1096 |
| 97 | Ga0075363_100000794 | 3300006048 | Bacteria | 10910 |
| 98 | Ga0075363_100002179 | 3300006048 | Bacteria | 7892 |
| 99 | Ga0075363_100008090 | 3300006048 | Bacteria | 4880 |
| 100 | Ga0075363_100027365 | 3300006048 | Bacteria | 2923 |
| 101 | Ga0075363_100033614 | 3300006048 | Bacteria | 2672 |
| 102 | Ga0075363_100043951 | 3300006048 | Bacteria | 2365 |
| 103 | Ga0075363_100078765 | 3300006048 | Bacteria | 1799 |
| 104 | Ga0075363_100106910 | 3300006048 | Bacteria | 1552 |
| 105 | Ga0075364_10005061 | 3300006051 | Bacteria | 7643 |
| 106 | Ga0075364_10013429 | 3300006051 | Bacteria | 5034 |
| 107 | Ga0075364_10027121 | 3300006051 | Bacteria | 3658 |
| 108 | Ga0075364_10032366 | 3300006051 | Bacteria | 3361 |
| 109 | Ga0075364_10171504 | 3300006051 | Bacteria | 1467 |
| 110 | Ga0075364_10595898 | 3300006051 | Bacteria | 755 |
| 111 | Ga0070716_100120600 | 3300006173 | Bacteria | 1641 |
| 112 | Ga0070716_101228569 | 3300006173 | Bacteria | 603 |
| 113 | Ga0070712_100003668 | 3300006175 | Bacteria | 9469 |
| 114 | Ga0070712_100736646 | 3300006175 | Bacteria | 843 |
| 115 | Ga0075367_10006813 | 3300006178 | Bacteria | 5806 |
| 116 | Ga0075367_10064200 | 3300006178 | Bacteria | 2196 |
| 117 | Ga0075367_10158889 | 3300006178 | Bacteria | 1405 |
| 118 | Ga0075367_10178968 | 3300006178 | Bacteria | 1322 |
| 119 | Ga0075369_10029856 | 3300006186 | Bacteria | 2293 |
| 120 | Ga0075369_10049807 | 3300006186 | Bacteria | 1810 |
| 121 | Ga0075369_10177436 | 3300006186 | Bacteria | 980 |
| 122 | Ga0075369_10203128 | 3300006186 | Bacteria | 915 |
| 123 | Ga0075369_10276053 | 3300006186 | Bacteria | 782 |
| 124 | Ga0075370_10007431 | 3300006353 | Bacteria | 5581 |
| 125 | Ga0075370_10035894 | 3300006353 | Bacteria | 2783 |
| 126 | Ga0075370_10245380 | 3300006353 | Bacteria | 1061 |
| 127 | Ga0075370_10356177 | 3300006353 | Bacteria | 875 |
| 128 | Ga0075428_100009624 | 3300006844 | Bacteria | 10729 |
| 129 | Ga0075430_100012921 | 3300006846 | Bacteria | 7116 |
| 130 | Ga0075430_100148943 | 3300006846 | Bacteria | 1949 |
| 131 | Ga0075431_100056065 | 3300006847 | Bacteria | 4065 |
| 132 | Ga0075429_100219805 | 3300006880 | Bacteria | 1664 |
| 133 | Ga0068865_100001501 | 3300006881 | Bacteria | 13611 |
| 134 | Ga0068865_100212515 | 3300006881 | Bacteria | 1508 |
| 135 | Ga0097620_100002920 | 3300006931 | Bacteria | 17355 |
| 136 | Ga0097620_100099145 | 3300006931 | Bacteria | 2969 |
| 137 | Ga0097620_102486032 | 3300006931 | Bacteria | 570 |
| 138 | Ga0105250_10036680 | 3300009092 | Bacteria | 1967 |
| 139 | Ga0105250_10041366 | 3300009092 | Bacteria | 1848 |
| 140 | Ga0111539_10899935 | 3300009094 | Bacteria | 1029 |
| 141 | Ga0105245_10005292 | 3300009098 | Bacteria | 11339 |
| 142 | Ga0105247_10000366 | 3300009101 | Bacteria | 38409 |
| 143 | Ga0105247_10214880 | 3300009101 | Bacteria | 1299 |
| 144 | Ga0105247_10368079 | 3300009101 | Bacteria | 1015 |
| 145 | Ga0114129_10012555 | 3300009147 | Bacteria | 12063 |
| 146 | Ga0105243_10005823 | 3300009148 | Bacteria | 9558 |
| 147 | Ga0105241_10013380 | 3300009174 | Bacteria | 6014 |
| 148 | Ga0105242_10004963 | 3300009176 | Bacteria | 10293 |
| 149 | Ga0105248_10211357 | 3300009177 | Bacteria | 2186 |
| 150 | Ga0105248_10867619 | 3300009177 | Bacteria | 1019 |
| 151 | Ga0105237_10021356 | 3300009545 | Bacteria | 6656 |
| 152 | Ga0105238_10535399 | 3300009551 | Bacteria | 1175 |
| 153 | Ga0105249_10007211 | 3300009553 | Bacteria | 9699 |
| 154 | Ga0105249_10028732 | 3300009553 | Bacteria | 5019 |
| 155 | Ga0099796_10179071 | 3300010159 | Bacteria | 850 |
| 156 | Ga0105239_10043737 | 3300010375 | Bacteria | 4911 |
| 157 | Ga0157374_12735200 | 3300013296 | Bacteria | 521 |
| 158 | Ga0157378_10265059 | 3300013297 | Bacteria | 1650 |
| 159 | Ga0163162_10007849 | 3300013306 | Bacteria | 10399 |
| 160 | Ga0163162_10018951 | 3300013306 | Bacteria | 6749 |
| 161 | Ga0163162_10201599 | 3300013306 | Bacteria | 2118 |
| 162 | Ga0163162_11032910 | 3300013306 | Bacteria | 930 |
| 163 | Ga0163162_11910347 | 3300013306 | Bacteria | 680 |
| 164 | Ga0157372_10010579 | 3300013307 | Bacteria | 9815 |
| 165 | Ga0157375_10001947 | 3300013308 | Bacteria | 17806 |
| 166 | Ga0157375_10851515 | 3300013308 | Bacteria | 1058 |
| 167 | Ga0163163_10054201 | 3300014325 | Bacteria | 3961 |
| 168 | Ga0163163_10433037 | 3300014325 | Bacteria | 1374 |
| 169 | Ga0157380_10001014 | 3300014326 | Bacteria | 17849 |
| 170 | Ga0157379_10056101 | 3300014968 | Bacteria | 3520 |
| 171 | Ga0157379_11495057 | 3300014968 | Bacteria | 657 |
| 172 | Ga0163161_10010688 | 3300017792 | Bacteria | 6356 |
| 173 | Ga0163161_10085478 | 3300017792 | Bacteria | 2327 |
| 174 | Ga0213874_10101496 | 3300021377 | Bacteria | 957 |
| 175 | Ga0209051_1063181 | 3300025303 | Bacteria | 1154 |
| 176 | Ga0207696_1069372 | 3300025711 | Bacteria | 982 |
| 177 | Ga0207682_10166221 | 3300025893 | Bacteria | 1002 |
| 178 | Ga0207692_10002849 | 3300025898 | Bacteria | 6687 |
| 179 | Ga0207642_10000139 | 3300025899 | Bacteria | 20385 |
| 180 | Ga0207710_10002206 | 3300025900 | Bacteria | 9152 |
| 181 | Ga0207688_10028878 | 3300025901 | Bacteria | 3051 |
| 182 | Ga0207680_10143900 | 3300025903 | Bacteria | 1583 |
| 183 | Ga0207680_10958476 | 3300025903 | Bacteria | 613 |
| 184 | Ga0207685_10000650 | 3300025905 | Bacteria | 6164 |
| 185 | Ga0207699_10007110 | 3300025906 | Bacteria | 5457 |
| 186 | Ga0207645_10020583 | 3300025907 | Bacteria | 4316 |
| 187 | Ga0207654_10014458 | 3300025911 | Bacteria | 4078 |
| 188 | Ga0207671_10758084 | 3300025914 | Bacteria | 771 |
| 189 | Ga0207693_10001766 | 3300025915 | Bacteria | 18968 |
| 190 | Ga0207663_10008198 | 3300025916 | Bacteria | 5450 |
| 191 | Ga0207663_10660048 | 3300025916 | Bacteria | 826 |
| 192 | Ga0207662_10124504 | 3300025918 | Bacteria | 1620 |
| 193 | Ga0207657_10081839 | 3300025919 | Bacteria | 2711 |
| 194 | Ga0207681_10076105 | 3300025923 | Bacteria | 2356 |
| 195 | Ga0207681_10461911 | 3300025923 | Bacteria | 1034 |
| 196 | Ga0207694_10424950 | 3300025924 | Bacteria | 1107 |
| 197 | Ga0207659_10347194 | 3300025926 | Bacteria | 1230 |
| 198 | Ga0207687_10001412 | 3300025927 | Bacteria | 16409 |
| 199 | Ga0207700_10329434 | 3300025928 | Bacteria | 1325 |
| 200 | Ga0207700_10586306 | 3300025928 | Bacteria | 992 |
| 201 | Ga0207664_10979320 | 3300025929 | Bacteria | 758 |
| 202 | Ga0207644_10212765 | 3300025931 | Bacteria | 1529 |
| 203 | Ga0207644_10946841 | 3300025931 | Bacteria | 722 |
| 204 | Ga0207690_10006559 | 3300025932 | Bacteria | 6901 |
| 205 | Ga0207706_10022538 | 3300025933 | Bacteria | 5651 |
| 206 | Ga0207706_10032701 | 3300025933 | Bacteria | 4630 |
| 207 | Ga0207686_10023099 | 3300025934 | Bacteria | 3587 |
| 208 | Ga0207709_10096854 | 3300025935 | Bacteria | 1942 |
| 209 | Ga0207670_10549563 | 3300025936 | Bacteria | 943 |
| 210 | Ga0207669_10000309 | 3300025937 | Bacteria | 22278 |
| 211 | Ga0207704_10001181 | 3300025938 | Bacteria | 11638 |
| 212 | Ga0207665_10142955 | 3300025939 | Bacteria | 1708 |
| 213 | Ga0207665_10211387 | 3300025939 | Bacteria | 1417 |
| 214 | Ga0207691_10478440 | 3300025940 | Bacteria | 1058 |
| 215 | Ga0207711_10181838 | 3300025941 | Bacteria | 1912 |
| 216 | Ga0207711_11049900 | 3300025941 | Bacteria | 755 |
| 217 | Ga0207689_10081017 | 3300025942 | Bacteria | 2669 |
| 218 | Ga0207667_10147602 | 3300025949 | Bacteria | 2420 |
| 219 | Ga0207712_10010987 | 3300025961 | Bacteria | 5763 |
| 220 | Ga0207668_10008510 | 3300025972 | Bacteria | 6120 |
| 221 | Ga0207668_10031122 | 3300025972 | Bacteria | 3512 |
| 222 | Ga0207668_10052936 | 3300025972 | Bacteria | 2811 |
| 223 | Ga0207668_10541898 | 3300025972 | Bacteria | 1007 |
| 224 | Ga0207640_10023763 | 3300025981 | Bacteria | 3689 |
| 225 | Ga0207658_10020251 | 3300025986 | Bacteria | 4606 |
| 226 | Ga0207658_10058793 | 3300025986 | Bacteria | 2862 |
| 227 | Ga0207658_10093042 | 3300025986 | Bacteria | 2343 |
| 228 | Ga0207658_10342726 | 3300025986 | Bacteria | 1299 |
| 229 | Ga0207677_10028983 | 3300026023 | Bacteria | 3511 |
| 230 | Ga0207677_10603790 | 3300026023 | Bacteria | 963 |
| 231 | Ga0207703_10017861 | 3300026035 | Bacteria | 5540 |
| 232 | Ga0207703_10129768 | 3300026035 | Bacteria | 2175 |
| 233 | Ga0207703_10715553 | 3300026035 | Bacteria | 953 |
| 234 | Ga0207639_10044961 | 3300026041 | Bacteria | 3323 |
| 235 | Ga0207678_10074493 | 3300026067 | Bacteria | 2909 |
| 236 | Ga0207678_11235073 | 3300026067 | Bacteria | 661 |
| 237 | Ga0207708_10052739 | 3300026075 | Bacteria | 3098 |
| 238 | Ga0207708_10175929 | 3300026075 | Bacteria | 1697 |
| 239 | Ga0207641_10025990 | 3300026088 | Bacteria | 4830 |
| 240 | Ga0207648_10000349 | 3300026089 | Bacteria | 50786 |
| 241 | Ga0207676_10065324 | 3300026095 | Bacteria | 2897 |
| 242 | Ga0207675_100002951 | 3300026118 | Bacteria | 16725 |
| 243 | Ga0207675_100058062 | 3300026118 | Bacteria | 3611 |
| 244 | Ga0207683_10000040 | 3300026121 | Bacteria | 95127 |
| 245 | Ga0268266_10003565 | 3300028379 | Bacteria | 15420 |
| 246 | Ga0268265_10006992 | 3300028380 | Bacteria | 7631 |
| 247 | Ga0268264_10005904 | 3300028381 | Bacteria | 10363 |
| 248 | Ga0268264_10389875 | 3300028381 | Bacteria | 1336 |
| 249 | Ga0265337_1000358 | 3300028556 | Bacteria | 24450 |
| 250 | Ga0265326_10000471 | 3300028558 | Bacteria | 15531 |
| 251 | Ga0265319_1006823 | 3300028563 | Bacteria | 5222 |
| 252 | Ga0265334_10003105 | 3300028573 | Bacteria | 7576 |
| 253 | Ga0265318_10003849 | 3300028577 | Bacteria | 7420 |
| 254 | Ga0265323_10004561 | 3300028653 | Bacteria | 5964 |
| 255 | Ga0265322_10015354 | 3300028654 | Bacteria | 2213 |
| 256 | Ga0265338_10001357 | 3300028800 | Bacteria | 39875 |
| 257 | Ga0265332_10003275 | 3300031238 | Bacteria | 7868 |
| 258 | Ga0265320_10008713 | 3300031240 | Bacteria | 6179 |
| 259 | Ga0265325_10018483 | 3300031241 | Bacteria | 3866 |
| 260 | Ga0265329_10186956 | 3300031242 | Bacteria | 679 |
| 261 | Ga0265339_10064782 | 3300031249 | Bacteria | 1960 |
| 262 | Ga0265316_10028130 | 3300031344 | Bacteria | 4641 |
| 263 | Ga0265314_10022467 | 3300031711 | Bacteria | 4831 |
| 264 | Ga0265342_10004931 | 3300031712 | Bacteria | 10304 |
| 265 | Ga0307413_10032172 | 3300031824 | Bacteria | 2970 |
| 266 | Ga0307413_10071704 | 3300031824 | Bacteria | 2184 |
| 267 | Ga0307410_10158990 | 3300031852 | Bacteria | 1691 |
| 268 | Ga0307407_11291918 | 3300031903 | Bacteria | 572 |
| 269 | Ga0307412_10755078 | 3300031911 | Bacteria | 840 |
| 270 | Ga0307409_100038658 | 3300031995 | Bacteria | 3532 |
| 271 | Ga0307409_100752258 | 3300031995 | Bacteria | 978 |
| 272 | Ga0307416_100017930 | 3300032002 | Bacteria | 4972 |
| 273 | Ga0307416_101390190 | 3300032002 | Bacteria | 808 |
| 274 | Ga0307415_100057221 | 3300032126 | Bacteria | 2678 |
| 275 | Ga0316215_1012477 | 3300033544 | Bacteria | 844 |
| 276 | Ga0316214_1000298 | 3300033545 | Bacteria | 4758 |
| 277 | Ga0373938_0091403 | 3300034957 | Bacteria | 753 |
| 278 | Ga0373939_0247541 | 3300035114 | Bacteria | 692 |
| 279 | Ga0373942_0091757 | 3300035207 | Bacteria | 916 |
| 280 | Ga0372808_008926 | 3300036459 | Bacteria | 1395 |
| 281 | Ga0436361_0364820 | 3300039447 | Bacteria | 634 |
| 282 | Ga0436363_0179673 | 3300039450 | Bacteria | 1472 |
| 283 | Ga0436363_0480362 | 3300039450 | Bacteria | 2170 |
| 284 | Ga0439461_0010559 | 3300041410 | Bacteria | 1698 |
| 285 | Ga0439461_0019249 | 3300041410 | Bacteria | 1343 |
| 286 | Ga0439466_0007613 | 3300041411 | Bacteria | 4090 |
| 287 | Ga0439466_0033532 | 3300041411 | Bacteria | 1744 |
| 288 | Ga0439465_0006345 | 3300041413 | Bacteria | 3756 |
| 289 | Ga0439465_0011566 | 3300041413 | Bacteria | 2769 |
| 290 | Ga0439465_0058518 | 3300041413 | Bacteria | 1273 |
| 291 | Ga0466969_0027627 | 3300044656 | Bacteria | 2905 |
| 292 | Ga0466969_0060140 | 3300044656 | Bacteria | 1847 |
| 293 | Ga0466972_0009345 | 3300044658 | Bacteria | 4928 |
| 294 | Ga0466972_0038651 | 3300044658 | Bacteria | 2331 |
| 295 | Ga0466972_0048012 | 3300044658 | Bacteria | 2063 |
| 296 | Ga0466965_0021153 | 3300044683 | Bacteria | 3130 |
| 297 | Ga0466965_0915217 | 3300044683 | Bacteria | 512 |
| 298 | Ga0466966_0002346 | 3300044684 | Bacteria | 12364 |
| 299 | Ga0466966_0078641 | 3300044684 | Bacteria | 2056 |
| 300 | Ga0466961_0014479 | 3300044693 | Bacteria | 5065 |
| 301 | Ga0466961_0030336 | 3300044693 | Bacteria | 3475 |
| 302 | Ga0466964_0189461 | 3300044706 | Bacteria | 980 |
| 303 | Ga0466968_0012581 | 3300044735 | Bacteria | 3315 |
| 304 | Ga0466970_0036545 | 3300044765 | Bacteria | 2602 |
| 305 | Ga0466970_0057864 | 3300044765 | Bacteria | 2074 |
| 306 | Ga0466970_0636584 | 3300044765 | Bacteria | 620 |
| 307 | Ga0466957_0005544 | 3300044842 | Bacteria | 7089 |
| 308 | Ga0466957_0205597 | 3300044842 | Bacteria | 1295 |
| 309 | Ga0466960_0065796 | 3300044901 | Bacteria | 1791 |
| 310 | Ga0466960_0131122 | 3300044901 | Bacteria | 1323 |
| 311 | Ga0466959_0063957 | 3300045049 | Bacteria | 2671 |
| 312 | Ga0466958_0001179 | 3300045836 | Bacteria | 12170 |
| 313 | Ga0466958_0048258 | 3300045836 | Bacteria | 2572 |
| 314 | Ga0466958_0352590 | 3300045836 | Bacteria | 947 |
| 315 | Ga0466967_0070698 | 3300045976 | Bacteria | 3123 |
| 316 | Ga0466967_0143667 | 3300045976 | Bacteria | 2224 |
| 317 | Ga0466967_0210648 | 3300045976 | Bacteria | 1843 |
| 318 | Ga0466967_0887204 | 3300045976 | Bacteria | 887 |
| 319 | Ga0466967_1275427 | 3300045976 | Bacteria | 732 |
| 320 | Ga0496100_0002195 | 3300048903 | Bacteria | 9845 |
| 321 | Ga0496100_0972462 | 3300048903 | Bacteria | 668 |
| 322 | Ga0496101_0006100 | 3300048904 | Bacteria | 7739 |
| 323 | Ga0496102_0003228 | 3300048905 | Bacteria | 13830 |
| 324 | Ga0496102_0004887 | 3300048905 | Bacteria | 11347 |
| 325 | Ga0496102_0925377 | 3300048905 | Bacteria | 793 |
| 326 | Ga0496103_0004626 | 3300048906 | Bacteria | 8332 |
| 327 | Ga0496104_0152211 | 3300048907 | Bacteria | 2220 |
| 328 | Ga0496104_0459936 | 3300048907 | Bacteria | 1184 |
| 329 | Ga0496104_1559463 | 3300048907 | Bacteria | 563 |
| 330 | Ga0496106_0004173 | 3300048909 | Bacteria | 10770 |
| 331 | Ga0496106_0111822 | 3300048909 | Bacteria | 2128 |
| 332 | Ga0496107_0000718 | 3300048910 | Bacteria | 18910 |
| 333 | Ga0496108_0191763 | 3300048911 | Bacteria | 1771 |
| 334 | Ga0496109_0167505 | 3300048912 | Bacteria | 2060 |
| 335 | Ga0496109_0180695 | 3300048912 | Bacteria | 1981 |
| 336 | Ga0496109_0645139 | 3300048912 | Bacteria | 996 |
| 337 | Ga0496111_0038739 | 3300048914 | Bacteria | 3416 |
| 338 | Ga0496111_0586123 | 3300048914 | Bacteria | 817 |
| 339 | Ga0496112_0004850 | 3300048915 | Bacteria | 11491 |
| 340 | Ga0496112_1258934 | 3300048915 | Bacteria | 656 |
| 341 | Ga0496113_0009031 | 3300048916 | Bacteria | 6528 |
| 342 | Ga0496114_0064429 | 3300048917 | Bacteria | 3069 |
| 343 | Ga0496115_0000807 | 3300048918 | Bacteria | 22983 |
| 344 | Ga0496126_0076043 | 3300048929 | Bacteria | 2979 |
| 345 | Ga0501031_0616078 | 3300049568 | Bacteria | 698 |
| 346 | Ga0501032_0027162 | 3300049569 | Bacteria | 3934 |
| 347 | Ga0501034_0056626 | 3300049571 | Bacteria | 3944 |
| 348 | Ga0501034_0168074 | 3300049571 | Bacteria | 2161 |
| 349 | Ga0501037_0404846 | 3300049573 | Bacteria | 935 |
| 350 | Ga0501043_0181457 | 3300049579 | Bacteria | 1640 |
| 351 | Ga0501047_0095344 | 3300049581 | Bacteria | 2854 |
| 352 | Ga0501070_0040058 | 3300049586 | Bacteria | 3908 |
| 353 | Ga0501070_0934531 | 3300049586 | Bacteria | 675 |
| 354 | Ga0501080_0400318 | 3300049742 | Bacteria | 1235 |
| 355 | Ga0501080_0746445 | 3300049742 | Bacteria | 861 |
| 356 | Ga0501035_0005928 | 3300049822 | Bacteria | 11503 |
| 357 | Ga0501044_0000498 | 3300049823 | Bacteria | 47714 |
| 358 | nmdc:mga03n38_1356_c1 | 3300050490 | Bacteria | 6936 |
| 359 | nmdc:mga03n38_177593_c1 | 3300050490 | Bacteria | 1089 |
| 360 | nmdc:mga03n38_206784_c1 | 3300050490 | Bacteria | 1018 |
| 361 | nmdc:mga03n38_464473_c1 | 3300050490 | Bacteria | 706 |
| 362 | nmdc:mga03n38_52718_c1 | 3300050490 | Bacteria | 1822 |
| 363 | nmdc:mga00v17_117307_c1 | 3300050491 | Bacteria | 1693 |
| 364 | nmdc:mga00v17_380282_c1 | 3300050491 | Bacteria | 918 |
| 365 | nmdc:mga00v17_610_c2 | 3300050491 | Bacteria | 10564 |
| 366 | nmdc:mga00v17_61951_c1 | 3300050491 | Bacteria | 2300 |
| 367 | nmdc:mga00v17_6505_c1 | 3300050491 | Bacteria | 6202 |
| 368 | nmdc:mga00v17_89937_c1 | 3300050491 | Bacteria | 1927 |
| 369 | nmdc:mga0yw44_1204_c1 | 3300050492 | Bacteria | 10121 |
| 370 | nmdc:mga0yw44_16179_c1 | 3300050492 | Bacteria | 4023 |
| 371 | nmdc:mga0yw44_253409_c1 | 3300050492 | Bacteria | 1172 |
| 372 | nmdc:mga0yw44_25526_c1 | 3300050492 | Bacteria | 3361 |
| 373 | nmdc:mga0yw44_416347_c1 | 3300050492 | Bacteria | 909 |
| 374 | nmdc:mga0yw44_46003_c1 | 3300050492 | Bacteria | 2619 |
| 375 | nmdc:mga06z11_43281_c1 | 3300050494 | Bacteria | 2264 |
| 376 | nmdc:mga06z11_72184_c1 | 3300050494 | Bacteria | 1829 |
| 377 | nmdc:mga06z11_88440_c1 | 3300050494 | Bacteria | 1677 |
| 378 | nmdc:mga07m45_18604_c1 | 3300050496 | Bacteria | 1982 |
| 379 | nmdc:mga07m45_41786_c1 | 3300050496 | Bacteria | 2568 |
| 380 | nmdc:mga07m45_6971_c1 | 3300050496 | Bacteria | 5745 |
| 381 | nmdc:mga05p37_6127_c2 | 3300050507 | Bacteria | 8833 |
| 382 | nmdc:mga0qj67_129954_c1 | 3300050509 | Bacteria | 2040 |
| 383 | nmdc:mga0qj67_131045_c1 | 3300050509 | Bacteria | 2031 |
| 384 | nmdc:mga06r32_29170_c1 | 3300050510 | Bacteria | 5168 |
| 385 | nmdc:mga08y16_696729_c1 | 3300050511 | Bacteria | 1016 |
| 386 | nmdc:mga0sz30_1414_c1 | 3300050516 | Bacteria | 3291 |
| 387 | nmdc:mga0sz30_216789_c1 | 3300050516 | Bacteria | 851 |
| 388 | nmdc:mga0sz30_266285_c1 | 3300050516 | Bacteria | 763 |
| 389 | nmdc:mga0sz30_4195_c2 | 3300050516 | Bacteria | 4651 |
| 390 | nmdc:mga0sz30_43150_c1 | 3300050516 | Bacteria | 1898 |
| 391 | nmdc:mga0sz30_46398_c1 | 3300050516 | Bacteria | 1834 |
| 392 | nmdc:mga0sz30_63330_c1 | 3300050516 | Bacteria | 1583 |
| 393 | Ga0500641_0148768 | 3300053096 | Bacteria | 1011 |
| 394 | Ga0500568_0103264 | 3300053139 | Bacteria | 1068 |
| 395 | Ga0500588_0104844 | 3300053146 | Bacteria | 979 |
| 396 | Ga0466962_0007464 | 3300061719 | Bacteria | 5247 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0636584 | Ga0466970_0636584_28_444 | 135 |
| 2 | 3300045836 | Ga0466958_0352590 | Ga0466958_0352590_214_630 | 135 |
| 3 | 3300045976 | Ga0466967_0210648 | Ga0466967_0210648_870_1286 | 135 |
| 4 | 3300005337 | Ga0070682_100547324 | Ga0070682_1005473242 | 137 |
| 5 | 3300005356 | Ga0070674_100761029 | Ga0070674_1007610292 | 137 |
| 6 | 3300005548 | Ga0070665_100509515 | Ga0070665_1005095151 | 137 |
| 7 | 3300005617 | Ga0068859_102485698 | Ga0068859_1024856982 | 137 |
| 8 | 3300006881 | Ga0068865_100212515 | Ga0068865_1002125151 | 137 |
| 9 | 3300006931 | Ga0097620_102486032 | Ga0097620_1024860322 | 137 |
| 10 | 3300009101 | Ga0105247_10214880 | Ga0105247_102148802 | 137 |
| 11 | 3300013306 | Ga0163162_11032910 | Ga0163162_110329101 | 137 |
| 12 | 3300013308 | Ga0157375_10851515 | Ga0157375_108515152 | 137 |
| 13 | 3300014968 | Ga0157379_11495057 | Ga0157379_114950571 | 137 |
| 14 | 3300026067 | Ga0207678_11235073 | Ga0207678_112350732 | 137 |
| 15 | 3300026075 | Ga0207708_10175929 | Ga0207708_101759293 | 137 |
| 16 | 3300048911 | Ga0496108_0191763 | Ga0496108_0191763_1313_1735 | 137 |
| 17 | 3300048912 | Ga0496109_0167505 | Ga0496109_0167505_327_749 | 137 |
| 18 | 3300006038 | Ga0075365_10163930 | Ga0075365_101639302 | 138 |
| 19 | 3300025303 | Ga0209051_1063181 | Ga0209051_10631812 | 138 |
| 20 | 3300050492 | nmdc:mga0yw44_25526_c1 | nmdc:mga0yw44_25526_c1_1443_1859 | 138 |
| 21 | 3300050516 | nmdc:mga0sz30_43150_c1 | nmdc:mga0sz30_43150_c1_1088_1504 | 138 |
| 22 | 3300053139 | Ga0500568_0103264 | Ga0500568_0103264_610_1029 | 139 |
| 23 | 3300053146 | Ga0500588_0104844 | Ga0500588_0104844_29_448 | 139 |
| 24 | 3300006051 | Ga0075364_10595898 | Ga0075364_105958982 | 140 |
| 25 | 3300050492 | nmdc:mga0yw44_253409_c1 | nmdc:mga0yw44_253409_c1_714_1154 | 140 |
| 26 | 3300053096 | Ga0500641_0148768 | Ga0500641_0148768_50_484 | 140 |
| 27 | 3300005436 | Ga0070713_100653085 | Ga0070713_1006530852 | 142 |
| 28 | 3300006048 | Ga0075363_100008090 | Ga0075363_1000080903 | 142 |
| 29 | 3300006051 | Ga0075364_10005061 | Ga0075364_100050614 | 142 |
| 30 | 3300006186 | Ga0075369_10276053 | Ga0075369_102760532 | 142 |
| 31 | 3300009092 | Ga0105250_10036680 | Ga0105250_100366802 | 142 |
| 32 | 3300025711 | Ga0207696_1069372 | Ga0207696_10693722 | 142 |
| 33 | 3300025928 | Ga0207700_10586306 | Ga0207700_105863062 | 142 |
| 34 | 3300033544 | Ga0316215_1012477 | Ga0316215_10124772 | 142 |
| 35 | 3300033545 | Ga0316214_1000298 | Ga0316214_10002983 | 142 |
| 36 | 3300036459 | Ga0372808_008926 | Ga0372808_008926_266_718 | 142 |
| 37 | 3300050490 | nmdc:mga03n38_464473_c1 | nmdc:mga03n38_464473_c1_110_538 | 142 |
| 38 | 3300050491 | nmdc:mga00v17_6505_c1 | nmdc:mga00v17_6505_c1_1370_1798 | 142 |
| 39 | 3300050516 | nmdc:mga0sz30_216789_c1 | nmdc:mga0sz30_216789_c1_230_658 | 142 |
| 40 | 3300005335 | Ga0070666_10310874 | Ga0070666_103108742 | 143 |
| 41 | 3300005339 | Ga0070660_100998579 | Ga0070660_1009985791 | 143 |
| 42 | 3300005366 | Ga0070659_100382855 | Ga0070659_1003828551 | 143 |
| 43 | 3300005436 | Ga0070713_100043738 | Ga0070713_1000437382 | 143 |
| 44 | 3300005437 | Ga0070710_10083131 | Ga0070710_100831311 | 143 |
| 45 | 3300005544 | Ga0070686_100484123 | Ga0070686_1004841232 | 143 |
| 46 | 3300006028 | Ga0070717_10199310 | Ga0070717_101993102 | 143 |
| 47 | 3300006173 | Ga0070716_100120600 | Ga0070716_1001206002 | 143 |
| 48 | 3300013296 | Ga0157374_12735200 | Ga0157374_127352001 | 143 |
| 49 | 3300013306 | Ga0163162_10201599 | Ga0163162_102015992 | 143 |
| 50 | 3300014325 | Ga0163163_10433037 | Ga0163163_104330372 | 143 |
| 51 | 3300025901 | Ga0207688_10028878 | Ga0207688_100288782 | 143 |
| 52 | 3300025928 | Ga0207700_10329434 | Ga0207700_103294342 | 143 |
| 53 | 3300025929 | Ga0207664_10979320 | Ga0207664_109793202 | 143 |
| 54 | 3300025939 | Ga0207665_10211387 | Ga0207665_102113872 | 143 |
| 55 | 3300039447 | Ga0436361_0364820 | Ga0436361_0364820_22_453 | 143 |
| 56 | 3300039450 | Ga0436363_0179673 | Ga0436363_0179673_461_895 | 143 |
| 57 | 3300044656 | Ga0466969_0027627 | Ga0466969_0027627_52_483 | 143 |
| 58 | 3300044683 | Ga0466965_0915217 | Ga0466965_0915217_48_482 | 143 |
| 59 | 3300044684 | Ga0466966_0002346 | Ga0466966_0002346_3651_4082 | 143 |
| 60 | 3300044693 | Ga0466961_0030336 | Ga0466961_0030336_2078_2509 | 143 |
| 61 | 3300044735 | Ga0466968_0012581 | Ga0466968_0012581_556_987 | 143 |
| 62 | 3300044765 | Ga0466970_0057864 | Ga0466970_0057864_627_1058 | 143 |
| 63 | 3300044842 | Ga0466957_0005544 | Ga0466957_0005544_5951_6382 | 143 |
| 64 | 3300045049 | Ga0466959_0063957 | Ga0466959_0063957_778_1209 | 143 |
| 65 | 3300045836 | Ga0466958_0001179 | Ga0466958_0001179_8388_8819 | 143 |
| 66 | 3300045976 | Ga0466967_0887204 | Ga0466967_0887204_92_523 | 143 |
| 67 | 3300048903 | Ga0496100_0972462 | Ga0496100_0972462_136_597 | 143 |
| 68 | 3300048905 | Ga0496102_0925377 | Ga0496102_0925377_125_577 | 143 |
| 69 | 3300048907 | Ga0496104_0459936 | Ga0496104_0459936_585_1028 | 143 |
| 70 | 3300049568 | Ga0501031_0616078 | Ga0501031_0616078_49_480 | 143 |
| 71 | 3300049569 | Ga0501032_0027162 | Ga0501032_0027162_564_995 | 143 |
| 72 | 3300049571 | Ga0501034_0056626 | Ga0501034_0056626_1858_2298 | 143 |
| 73 | 3300049571 | Ga0501034_0168074 | Ga0501034_0168074_1166_1597 | 143 |
| 74 | 3300049573 | Ga0501037_0404846 | Ga0501037_0404846_317_748 | 143 |
| 75 | 3300049579 | Ga0501043_0181457 | Ga0501043_0181457_285_716 | 143 |
| 76 | 3300049581 | Ga0501047_0095344 | Ga0501047_0095344_2098_2529 | 143 |
| 77 | 3300049742 | Ga0501080_0746445 | Ga0501080_0746445_241_681 | 143 |
| 78 | 3300049822 | Ga0501035_0005928 | Ga0501035_0005928_7350_7781 | 143 |
| 79 | 3300049823 | Ga0501044_0000498 | Ga0501044_0000498_35655_36086 | 143 |
| 80 | 3300002074 | JGI24748J21848_1025363 | JGI24748J21848_10253632 | 144 |
| 81 | 3300006038 | Ga0075365_10672038 | Ga0075365_106720382 | 144 |
| 82 | 3300006042 | Ga0075368_10116590 | Ga0075368_101165902 | 144 |
| 83 | 3300006042 | Ga0075368_10118159 | Ga0075368_101181592 | 144 |
| 84 | 3300006048 | Ga0075363_100000794 | Ga0075363_1000007942 | 144 |
| 85 | 3300006048 | Ga0075363_100002179 | Ga0075363_1000021796 | 144 |
| 86 | 3300006048 | Ga0075363_100027365 | Ga0075363_1000273651 | 144 |
| 87 | 3300006048 | Ga0075363_100033614 | Ga0075363_1000336142 | 144 |
| 88 | 3300006048 | Ga0075363_100043951 | Ga0075363_1000439512 | 144 |
| 89 | 3300006051 | Ga0075364_10027121 | Ga0075364_100271212 | 144 |
| 90 | 3300006051 | Ga0075364_10032366 | Ga0075364_100323663 | 144 |
| 91 | 3300006051 | Ga0075364_10171504 | Ga0075364_101715041 | 144 |
| 92 | 3300006178 | Ga0075367_10006813 | Ga0075367_100068132 | 144 |
| 93 | 3300006178 | Ga0075367_10064200 | Ga0075367_100642002 | 144 |
| 94 | 3300006186 | Ga0075369_10049807 | Ga0075369_100498072 | 144 |
| 95 | 3300006186 | Ga0075369_10203128 | Ga0075369_102031282 | 144 |
| 96 | 3300006353 | Ga0075370_10007431 | Ga0075370_100074313 | 144 |
| 97 | 3300006353 | Ga0075370_10035894 | Ga0075370_100358942 | 144 |
| 98 | 3300006353 | Ga0075370_10356177 | Ga0075370_103561772 | 144 |
| 99 | 3300028556 | Ga0265337_1000358 | Ga0265337_100035820 | 144 |
| 100 | 3300028558 | Ga0265326_10000471 | Ga0265326_100004719 | 144 |
| 101 | 3300028563 | Ga0265319_1006823 | Ga0265319_10068235 | 144 |
| 102 | 3300028573 | Ga0265334_10003105 | Ga0265334_100031055 | 144 |
| 103 | 3300028577 | Ga0265318_10003849 | Ga0265318_100038494 | 144 |
| 104 | 3300028653 | Ga0265323_10004561 | Ga0265323_100045615 | 144 |
| 105 | 3300028654 | Ga0265322_10015354 | Ga0265322_100153543 | 144 |
| 106 | 3300028800 | Ga0265338_10001357 | Ga0265338_1000135716 | 144 |
| 107 | 3300031238 | Ga0265332_10003275 | Ga0265332_100032754 | 144 |
| 108 | 3300031240 | Ga0265320_10008713 | Ga0265320_100087133 | 144 |
| 109 | 3300031241 | Ga0265325_10018483 | Ga0265325_100184831 | 144 |
| 110 | 3300031242 | Ga0265329_10186956 | Ga0265329_101869561 | 144 |
| 111 | 3300031249 | Ga0265339_10064782 | Ga0265339_100647823 | 144 |
| 112 | 3300031344 | Ga0265316_10028130 | Ga0265316_100281302 | 144 |
| 113 | 3300031711 | Ga0265314_10022467 | Ga0265314_100224673 | 144 |
| 114 | 3300031712 | Ga0265342_10004931 | Ga0265342_100049313 | 144 |
| 115 | 3300031824 | Ga0307413_10032172 | Ga0307413_100321722 | 144 |
| 116 | 3300031824 | Ga0307413_10071704 | Ga0307413_100717042 | 144 |
| 117 | 3300031852 | Ga0307410_10158990 | Ga0307410_101589903 | 144 |
| 118 | 3300031911 | Ga0307412_10755078 | Ga0307412_107550782 | 144 |
| 119 | 3300031995 | Ga0307409_100038658 | Ga0307409_1000386583 | 144 |
| 120 | 3300031995 | Ga0307409_100752258 | Ga0307409_1007522582 | 144 |
| 121 | 3300032002 | Ga0307416_100017930 | Ga0307416_1000179304 | 144 |
| 122 | 3300032002 | Ga0307416_101390190 | Ga0307416_1013901902 | 144 |
| 123 | 3300032126 | Ga0307415_100057221 | Ga0307415_1000572213 | 144 |
| 124 | 3300041413 | Ga0439465_0011566 | Ga0439465_0011566_491_949 | 144 |
| 125 | 3300044842 | Ga0466957_0205597 | Ga0466957_0205597_645_1106 | 144 |
| 126 | 3300045976 | Ga0466967_0143667 | Ga0466967_0143667_1474_1935 | 144 |
| 127 | 3300049586 | Ga0501070_0040058 | Ga0501070_0040058_3179_3637 | 144 |
| 128 | 3300049742 | Ga0501080_0400318 | Ga0501080_0400318_726_1184 | 144 |
| 129 | 3300050490 | nmdc:mga03n38_1356_c1 | nmdc:mga03n38_1356_c1_4813_5316 | 144 |
| 130 | 3300050490 | nmdc:mga03n38_206784_c1 | nmdc:mga03n38_206784_c1_347_850 | 144 |
| 131 | 3300050490 | nmdc:mga03n38_52718_c1 | nmdc:mga03n38_52718_c1_1160_1663 | 144 |
| 132 | 3300050491 | nmdc:mga00v17_117307_c1 | nmdc:mga00v17_117307_c1_344_847 | 144 |
| 133 | 3300050491 | nmdc:mga00v17_380282_c1 | nmdc:mga00v17_380282_c1_144_656 | 144 |
| 134 | 3300050491 | nmdc:mga00v17_610_c2 | nmdc:mga00v17_610_c2_9568_10071 | 144 |
| 135 | 3300050491 | nmdc:mga00v17_61951_c1 | nmdc:mga00v17_61951_c1_480_983 | 144 |
| 136 | 3300050492 | nmdc:mga0yw44_1204_c1 | nmdc:mga0yw44_1204_c1_5196_5699 | 144 |
| 137 | 3300050492 | nmdc:mga0yw44_46003_c1 | nmdc:mga0yw44_46003_c1_999_1511 | 144 |
| 138 | 3300050494 | nmdc:mga06z11_43281_c1 | nmdc:mga06z11_43281_c1_1639_2151 | 144 |
| 139 | 3300050494 | nmdc:mga06z11_88440_c1 | nmdc:mga06z11_88440_c1_1151_1654 | 144 |
| 140 | 3300050496 | nmdc:mga07m45_18604_c1 | nmdc:mga07m45_18604_c1_1074_1577 | 144 |
| 141 | 3300050496 | nmdc:mga07m45_6971_c1 | nmdc:mga07m45_6971_c1_2869_3372 | 144 |
| 142 | 3300050516 | nmdc:mga0sz30_266285_c1 | nmdc:mga0sz30_266285_c1_79_582 | 144 |
| 143 | 3300050516 | nmdc:mga0sz30_46398_c1 | nmdc:mga0sz30_46398_c1_899_1411 | 144 |
| 144 | 3300031903 | Ga0307407_11291918 | Ga0307407_112919181 | 145 |
| 145 | 3300044656 | Ga0466969_0060140 | Ga0466969_0060140_1309_1746 | 145 |
| 146 | 3300044658 | Ga0466972_0009345 | Ga0466972_0009345_2311_2748 | 145 |
| 147 | 3300044658 | Ga0466972_0048012 | Ga0466972_0048012_569_1006 | 145 |
| 148 | 3300044683 | Ga0466965_0021153 | Ga0466965_0021153_1360_1797 | 145 |
| 149 | 3300044684 | Ga0466966_0078641 | Ga0466966_0078641_1337_1774 | 145 |
| 150 | 3300044693 | Ga0466961_0014479 | Ga0466961_0014479_1889_2326 | 145 |
| 151 | 3300044706 | Ga0466964_0189461 | Ga0466964_0189461_481_918 | 145 |
| 152 | 3300044765 | Ga0466970_0036545 | Ga0466970_0036545_701_1138 | 145 |
| 153 | 3300044901 | Ga0466960_0131122 | Ga0466960_0131122_43_480 | 145 |
| 154 | 3300045836 | Ga0466958_0048258 | Ga0466958_0048258_852_1289 | 145 |
| 155 | 3300045976 | Ga0466967_0070698 | Ga0466967_0070698_1916_2353 | 145 |
| 156 | 3300045976 | Ga0466967_1275427 | Ga0466967_1275427_276_722 | 145 |
| 157 | 3300049586 | Ga0501070_0934531 | Ga0501070_0934531_76_528 | 145 |
| 158 | 3300061719 | Ga0466962_0007464 | Ga0466962_0007464_4603_5040 | 145 |
| 159 | 3300001991 | JGI24743J22301_10144995 | JGI24743J22301_101449952 | 146 |
| 160 | 3300002067 | JGI24735J21928_10063561 | JGI24735J21928_100635612 | 146 |
| 161 | 3300002074 | JGI24748J21848_1009573 | JGI24748J21848_10095732 | 146 |
| 162 | 3300002075 | JGI24738J21930_10054779 | JGI24738J21930_100547792 | 146 |
| 163 | 3300002076 | JGI24749J21850_1029324 | JGI24749J21850_10293241 | 146 |
| 164 | 3300002077 | JGI24744J21845_10000226 | JGI24744J21845_1000022611 | 146 |
| 165 | 3300002239 | JGI24034J26672_10002361 | JGI24034J26672_100023611 | 146 |
| 166 | 3300002239 | JGI24034J26672_10023353 | JGI24034J26672_100233532 | 146 |
| 167 | 3300002239 | JGI24034J26672_10065878 | JGI24034J26672_100658781 | 146 |
| 168 | 3300002244 | JGI24742J22300_10004297 | JGI24742J22300_100042972 | 146 |
| 169 | 3300005328 | Ga0070676_10017923 | Ga0070676_100179231 | 146 |
| 170 | 3300005329 | Ga0070683_100201321 | Ga0070683_1002013212 | 146 |
| 171 | 3300005330 | Ga0070690_100039717 | Ga0070690_1000397172 | 146 |
| 172 | 3300005331 | Ga0070670_100517998 | Ga0070670_1005179982 | 146 |
| 173 | 3300005333 | Ga0070677_10086411 | Ga0070677_100864112 | 146 |
| 174 | 3300005334 | Ga0068869_100256418 | Ga0068869_1002564181 | 146 |
| 175 | 3300005335 | Ga0070666_10059968 | Ga0070666_100599683 | 146 |
| 176 | 3300005337 | Ga0070682_100060413 | Ga0070682_1000604133 | 146 |
| 177 | 3300005338 | Ga0068868_100000582 | Ga0068868_1000005825 | 146 |
| 178 | 3300005338 | Ga0068868_100356637 | Ga0068868_1003566372 | 146 |
| 179 | 3300005339 | Ga0070660_100168713 | Ga0070660_1001687132 | 146 |
| 180 | 3300005340 | Ga0070689_100001541 | Ga0070689_1000015414 | 146 |
| 181 | 3300005341 | Ga0070691_10006121 | Ga0070691_100061213 | 146 |
| 182 | 3300005343 | Ga0070687_100062164 | Ga0070687_1000621642 | 146 |
| 183 | 3300005347 | Ga0070668_100049519 | Ga0070668_1000495193 | 146 |
| 184 | 3300005347 | Ga0070668_100050031 | Ga0070668_1000500312 | 146 |
| 185 | 3300005353 | Ga0070669_100016429 | Ga0070669_1000164292 | 146 |
| 186 | 3300005353 | Ga0070669_100029005 | Ga0070669_1000290053 | 146 |
| 187 | 3300005354 | Ga0070675_100188298 | Ga0070675_1001882982 | 146 |
| 188 | 3300005355 | Ga0070671_100362940 | Ga0070671_1003629402 | 146 |
| 189 | 3300005356 | Ga0070674_100001347 | Ga0070674_1000013474 | 146 |
| 190 | 3300005364 | Ga0070673_100411551 | Ga0070673_1004115512 | 146 |
| 191 | 3300005365 | Ga0070688_100482775 | Ga0070688_1004827752 | 146 |
| 192 | 3300005366 | Ga0070659_100101704 | Ga0070659_1001017043 | 146 |
| 193 | 3300005367 | Ga0070667_100004738 | Ga0070667_10000473813 | 146 |
| 194 | 3300005367 | Ga0070667_100029808 | Ga0070667_1000298083 | 146 |
| 195 | 3300005367 | Ga0070667_100425688 | Ga0070667_1004256882 | 146 |
| 196 | 3300005434 | Ga0070709_10294681 | Ga0070709_102946812 | 146 |
| 197 | 3300005434 | Ga0070709_10745979 | Ga0070709_107459791 | 146 |
| 198 | 3300005435 | Ga0070714_100082102 | Ga0070714_1000821023 | 146 |
| 199 | 3300005436 | Ga0070713_100995320 | Ga0070713_1009953202 | 146 |
| 200 | 3300005437 | Ga0070710_10000230 | Ga0070710_1000023015 | 146 |
| 201 | 3300005438 | Ga0070701_10002124 | Ga0070701_1000212410 | 146 |
| 202 | 3300005439 | Ga0070711_100011498 | Ga0070711_1000114984 | 146 |
| 203 | 3300005439 | Ga0070711_100791229 | Ga0070711_1007912291 | 146 |
| 204 | 3300005440 | Ga0070705_100014215 | Ga0070705_1000142153 | 146 |
| 205 | 3300005441 | Ga0070700_100027060 | Ga0070700_1000270604 | 146 |
| 206 | 3300005444 | Ga0070694_100020644 | Ga0070694_1000206442 | 146 |
| 207 | 3300005456 | Ga0070678_100002658 | Ga0070678_1000026589 | 146 |
| 208 | 3300005457 | Ga0070662_100005597 | Ga0070662_1000055976 | 146 |
| 209 | 3300005459 | Ga0068867_100054257 | Ga0068867_1000542574 | 146 |
| 210 | 3300005536 | Ga0070697_100920778 | Ga0070697_1009207781 | 146 |
| 211 | 3300005539 | Ga0068853_100041206 | Ga0068853_1000412062 | 146 |
| 212 | 3300005543 | Ga0070672_100204368 | Ga0070672_1002043683 | 146 |
| 213 | 3300005544 | Ga0070686_100070360 | Ga0070686_1000703602 | 146 |
| 214 | 3300005546 | Ga0070696_100001412 | Ga0070696_10000141221 | 146 |
| 215 | 3300005547 | Ga0070693_100070857 | Ga0070693_1000708573 | 146 |
| 216 | 3300005548 | Ga0070665_100024959 | Ga0070665_1000249593 | 146 |
| 217 | 3300005549 | Ga0070704_100002411 | Ga0070704_1000024114 | 146 |
| 218 | 3300005563 | Ga0068855_100893835 | Ga0068855_1008938351 | 146 |
| 219 | 3300005578 | Ga0068854_100014497 | Ga0068854_1000144974 | 146 |
| 220 | 3300005615 | Ga0070702_100007927 | Ga0070702_1000079274 | 146 |
| 221 | 3300005617 | Ga0068859_100002920 | Ga0068859_10000292023 | 146 |
| 222 | 3300005617 | Ga0068859_100099145 | Ga0068859_1000991453 | 146 |
| 223 | 3300005618 | Ga0068864_100168623 | Ga0068864_1001686232 | 146 |
| 224 | 3300005718 | Ga0068866_10005077 | Ga0068866_100050774 | 146 |
| 225 | 3300005719 | Ga0068861_100000980 | Ga0068861_10000098023 | 146 |
| 226 | 3300005841 | Ga0068863_100003502 | Ga0068863_1000035027 | 146 |
| 227 | 3300005842 | Ga0068858_100026595 | Ga0068858_1000265954 | 146 |
| 228 | 3300005842 | Ga0068858_100393291 | Ga0068858_1003932912 | 146 |
| 229 | 3300005843 | Ga0068860_100004106 | Ga0068860_10000410618 | 146 |
| 230 | 3300005843 | Ga0068860_100298935 | Ga0068860_1002989352 | 146 |
| 231 | 3300005843 | Ga0068860_102097797 | Ga0068860_1020977972 | 146 |
| 232 | 3300005844 | Ga0068862_100019024 | Ga0068862_1000190244 | 146 |
| 233 | 3300005844 | Ga0068862_101741460 | Ga0068862_1017414602 | 146 |
| 234 | 3300005937 | Ga0081455_10009614 | Ga0081455_100096142 | 146 |
| 235 | 3300005937 | Ga0081455_10234431 | Ga0081455_102344312 | 146 |
| 236 | 3300006028 | Ga0070717_10604822 | Ga0070717_106048222 | 146 |
| 237 | 3300006038 | Ga0075365_10009545 | Ga0075365_100095452 | 146 |
| 238 | 3300006048 | Ga0075363_100078765 | Ga0075363_1000787652 | 146 |
| 239 | 3300006048 | Ga0075363_100106910 | Ga0075363_1001069102 | 146 |
| 240 | 3300006051 | Ga0075364_10013429 | Ga0075364_100134291 | 146 |
| 241 | 3300006173 | Ga0070716_101228569 | Ga0070716_1012285692 | 146 |
| 242 | 3300006175 | Ga0070712_100003668 | Ga0070712_10000366813 | 146 |
| 243 | 3300006175 | Ga0070712_100736646 | Ga0070712_1007366462 | 146 |
| 244 | 3300006178 | Ga0075367_10158889 | Ga0075367_101588892 | 146 |
| 245 | 3300006178 | Ga0075367_10178968 | Ga0075367_101789682 | 146 |
| 246 | 3300006186 | Ga0075369_10029856 | Ga0075369_100298562 | 146 |
| 247 | 3300006186 | Ga0075369_10177436 | Ga0075369_101774361 | 146 |
| 248 | 3300006353 | Ga0075370_10245380 | Ga0075370_102453802 | 146 |
| 249 | 3300006844 | Ga0075428_100009624 | Ga0075428_1000096245 | 146 |
| 250 | 3300006846 | Ga0075430_100012921 | Ga0075430_1000129214 | 146 |
| 251 | 3300006846 | Ga0075430_100148943 | Ga0075430_1001489432 | 146 |
| 252 | 3300006847 | Ga0075431_100056065 | Ga0075431_1000560652 | 146 |
| 253 | 3300006880 | Ga0075429_100219805 | Ga0075429_1002198051 | 146 |
| 254 | 3300006881 | Ga0068865_100001501 | Ga0068865_10000150116 | 146 |
| 255 | 3300006931 | Ga0097620_100002920 | Ga0097620_10000292023 | 146 |
| 256 | 3300006931 | Ga0097620_100099145 | Ga0097620_1000991453 | 146 |
| 257 | 3300009092 | Ga0105250_10041366 | Ga0105250_100413661 | 146 |
| 258 | 3300009094 | Ga0111539_10899935 | Ga0111539_108999352 | 146 |
| 259 | 3300009098 | Ga0105245_10005292 | Ga0105245_1000529214 | 146 |
| 260 | 3300009101 | Ga0105247_10000366 | Ga0105247_100003663 | 146 |
| 261 | 3300009101 | Ga0105247_10368079 | Ga0105247_103680792 | 146 |
| 262 | 3300009147 | Ga0114129_10012555 | Ga0114129_1001255514 | 146 |
| 263 | 3300009148 | Ga0105243_10005823 | Ga0105243_100058239 | 146 |
| 264 | 3300009174 | Ga0105241_10013380 | Ga0105241_100133803 | 146 |
| 265 | 3300009176 | Ga0105242_10004963 | Ga0105242_1000496311 | 146 |
| 266 | 3300009177 | Ga0105248_10211357 | Ga0105248_102113572 | 146 |
| 267 | 3300009177 | Ga0105248_10867619 | Ga0105248_108676192 | 146 |
| 268 | 3300009545 | Ga0105237_10021356 | Ga0105237_100213569 | 146 |
| 269 | 3300009551 | Ga0105238_10535399 | Ga0105238_105353991 | 146 |
| 270 | 3300009553 | Ga0105249_10007211 | Ga0105249_100072117 | 146 |
| 271 | 3300009553 | Ga0105249_10028732 | Ga0105249_100287324 | 146 |
| 272 | 3300010159 | Ga0099796_10179071 | Ga0099796_101790712 | 146 |
| 273 | 3300010375 | Ga0105239_10043737 | Ga0105239_100437374 | 146 |
| 274 | 3300013297 | Ga0157378_10265059 | Ga0157378_102650592 | 146 |
| 275 | 3300013306 | Ga0163162_10007849 | Ga0163162_1000784911 | 146 |
| 276 | 3300013306 | Ga0163162_10018951 | Ga0163162_100189514 | 146 |
| 277 | 3300013306 | Ga0163162_11910347 | Ga0163162_119103471 | 146 |
| 278 | 3300013307 | Ga0157372_10010579 | Ga0157372_100105794 | 146 |
| 279 | 3300013308 | Ga0157375_10001947 | Ga0157375_100019474 | 146 |
| 280 | 3300014325 | Ga0163163_10054201 | Ga0163163_100542013 | 146 |
| 281 | 3300014326 | Ga0157380_10001014 | Ga0157380_1000101422 | 146 |
| 282 | 3300014968 | Ga0157379_10056101 | Ga0157379_100561012 | 146 |
| 283 | 3300017792 | Ga0163161_10010688 | Ga0163161_100106886 | 146 |
| 284 | 3300017792 | Ga0163161_10085478 | Ga0163161_100854782 | 146 |
| 285 | 3300021377 | Ga0213874_10101496 | Ga0213874_101014962 | 146 |
| 286 | 3300025893 | Ga0207682_10166221 | Ga0207682_101662212 | 146 |
| 287 | 3300025898 | Ga0207692_10002849 | Ga0207692_100028498 | 146 |
| 288 | 3300025899 | Ga0207642_10000139 | Ga0207642_1000013923 | 146 |
| 289 | 3300025900 | Ga0207710_10002206 | Ga0207710_100022063 | 146 |
| 290 | 3300025903 | Ga0207680_10143900 | Ga0207680_101439002 | 146 |
| 291 | 3300025903 | Ga0207680_10958476 | Ga0207680_109584762 | 146 |
| 292 | 3300025905 | Ga0207685_10000650 | Ga0207685_100006501 | 146 |
| 293 | 3300025906 | Ga0207699_10007110 | Ga0207699_100071102 | 146 |
| 294 | 3300025907 | Ga0207645_10020583 | Ga0207645_100205832 | 146 |
| 295 | 3300025911 | Ga0207654_10014458 | Ga0207654_100144583 | 146 |
| 296 | 3300025914 | Ga0207671_10758084 | Ga0207671_107580841 | 146 |
| 297 | 3300025915 | Ga0207693_10001766 | Ga0207693_100017664 | 146 |
| 298 | 3300025916 | Ga0207663_10008198 | Ga0207663_100081984 | 146 |
| 299 | 3300025916 | Ga0207663_10660048 | Ga0207663_106600482 | 146 |
| 300 | 3300025918 | Ga0207662_10124504 | Ga0207662_101245042 | 146 |
| 301 | 3300025919 | Ga0207657_10081839 | Ga0207657_100818392 | 146 |
| 302 | 3300025923 | Ga0207681_10076105 | Ga0207681_100761053 | 146 |
| 303 | 3300025923 | Ga0207681_10461911 | Ga0207681_104619112 | 146 |
| 304 | 3300025924 | Ga0207694_10424950 | Ga0207694_104249501 | 146 |
| 305 | 3300025926 | Ga0207659_10347194 | Ga0207659_103471942 | 146 |
| 306 | 3300025927 | Ga0207687_10001412 | Ga0207687_100014127 | 146 |
| 307 | 3300025931 | Ga0207644_10212765 | Ga0207644_102127652 | 146 |
| 308 | 3300025931 | Ga0207644_10946841 | Ga0207644_109468412 | 146 |
| 309 | 3300025932 | Ga0207690_10006559 | Ga0207690_100065593 | 146 |
| 310 | 3300025933 | Ga0207706_10022538 | Ga0207706_100225384 | 146 |
| 311 | 3300025933 | Ga0207706_10032701 | Ga0207706_100327012 | 146 |
| 312 | 3300025934 | Ga0207686_10023099 | Ga0207686_100230991 | 146 |
| 313 | 3300025935 | Ga0207709_10096854 | Ga0207709_100968542 | 146 |
| 314 | 3300025936 | Ga0207670_10549563 | Ga0207670_105495632 | 146 |
| 315 | 3300025937 | Ga0207669_10000309 | Ga0207669_1000030919 | 146 |
| 316 | 3300025938 | Ga0207704_10001181 | Ga0207704_1000118111 | 146 |
| 317 | 3300025939 | Ga0207665_10142955 | Ga0207665_101429553 | 146 |
| 318 | 3300025940 | Ga0207691_10478440 | Ga0207691_104784402 | 146 |
| 319 | 3300025941 | Ga0207711_10181838 | Ga0207711_101818382 | 146 |
| 320 | 3300025941 | Ga0207711_11049900 | Ga0207711_110499001 | 146 |
| 321 | 3300025942 | Ga0207689_10081017 | Ga0207689_100810172 | 146 |
| 322 | 3300025949 | Ga0207667_10147602 | Ga0207667_101476024 | 146 |
| 323 | 3300025961 | Ga0207712_10010987 | Ga0207712_100109874 | 146 |
| 324 | 3300025972 | Ga0207668_10008510 | Ga0207668_100085103 | 146 |
| 325 | 3300025972 | Ga0207668_10031122 | Ga0207668_100311222 | 146 |
| 326 | 3300025972 | Ga0207668_10052936 | Ga0207668_100529361 | 146 |
| 327 | 3300025972 | Ga0207668_10541898 | Ga0207668_105418982 | 146 |
| 328 | 3300025981 | Ga0207640_10023763 | Ga0207640_100237634 | 146 |
| 329 | 3300025986 | Ga0207658_10020251 | Ga0207658_100202514 | 146 |
| 330 | 3300025986 | Ga0207658_10058793 | Ga0207658_100587932 | 146 |
| 331 | 3300025986 | Ga0207658_10093042 | Ga0207658_100930422 | 146 |
| 332 | 3300025986 | Ga0207658_10342726 | Ga0207658_103427262 | 146 |
| 333 | 3300026023 | Ga0207677_10028983 | Ga0207677_100289834 | 146 |
| 334 | 3300026023 | Ga0207677_10603790 | Ga0207677_106037902 | 146 |
| 335 | 3300026035 | Ga0207703_10017861 | Ga0207703_100178616 | 146 |
| 336 | 3300026035 | Ga0207703_10129768 | Ga0207703_101297682 | 146 |
| 337 | 3300026035 | Ga0207703_10715553 | Ga0207703_107155531 | 146 |
| 338 | 3300026041 | Ga0207639_10044961 | Ga0207639_100449611 | 146 |
| 339 | 3300026067 | Ga0207678_10074493 | Ga0207678_100744933 | 146 |
| 340 | 3300026075 | Ga0207708_10052739 | Ga0207708_100527392 | 146 |
| 341 | 3300026088 | Ga0207641_10025990 | Ga0207641_100259902 | 146 |
| 342 | 3300026089 | Ga0207648_10000349 | Ga0207648_1000034952 | 146 |
| 343 | 3300026095 | Ga0207676_10065324 | Ga0207676_100653242 | 146 |
| 344 | 3300026118 | Ga0207675_100002951 | Ga0207675_10000295120 | 146 |
| 345 | 3300026118 | Ga0207675_100058062 | Ga0207675_1000580625 | 146 |
| 346 | 3300026121 | Ga0207683_10000040 | Ga0207683_1000004083 | 146 |
| 347 | 3300028379 | Ga0268266_10003565 | Ga0268266_100035654 | 146 |
| 348 | 3300028380 | Ga0268265_10006992 | Ga0268265_100069927 | 146 |
| 349 | 3300028381 | Ga0268264_10005904 | Ga0268264_100059043 | 146 |
| 350 | 3300028381 | Ga0268264_10389875 | Ga0268264_103898752 | 146 |
| 351 | 3300034957 | Ga0373938_0091403 | Ga0373938_0091403_95_535 | 146 |
| 352 | 3300035114 | Ga0373939_0247541 | Ga0373939_0247541_184_624 | 146 |
| 353 | 3300035207 | Ga0373942_0091757 | Ga0373942_0091757_114_554 | 146 |
| 354 | 3300039450 | Ga0436363_0480362 | Ga0436363_0480362_343_792 | 146 |
| 355 | 3300041410 | Ga0439461_0010559 | Ga0439461_0010559_646_1107 | 146 |
| 356 | 3300041410 | Ga0439461_0019249 | Ga0439461_0019249_468_932 | 146 |
| 357 | 3300041411 | Ga0439466_0007613 | Ga0439466_0007613_3214_3675 | 146 |
| 358 | 3300041411 | Ga0439466_0033532 | Ga0439466_0033532_469_933 | 146 |
| 359 | 3300041413 | Ga0439465_0006345 | Ga0439465_0006345_3065_3526 | 146 |
| 360 | 3300041413 | Ga0439465_0058518 | Ga0439465_0058518_210_674 | 146 |
| 361 | 3300044658 | Ga0466972_0038651 | Ga0466972_0038651_830_1291 | 146 |
| 362 | 3300044901 | Ga0466960_0065796 | Ga0466960_0065796_733_1194 | 146 |
| 363 | 3300048903 | Ga0496100_0002195 | Ga0496100_0002195_7413_7853 | 146 |
| 364 | 3300048904 | Ga0496101_0006100 | Ga0496101_0006100_192_632 | 146 |
| 365 | 3300048905 | Ga0496102_0003228 | Ga0496102_0003228_12979_13419 | 146 |
| 366 | 3300048905 | Ga0496102_0004887 | Ga0496102_0004887_6429_6899 | 146 |
| 367 | 3300048906 | Ga0496103_0004626 | Ga0496103_0004626_2521_2961 | 146 |
| 368 | 3300048907 | Ga0496104_0152211 | Ga0496104_0152211_1195_1665 | 146 |
| 369 | 3300048907 | Ga0496104_1559463 | Ga0496104_1559463_103_543 | 146 |
| 370 | 3300048909 | Ga0496106_0004173 | Ga0496106_0004173_7863_8303 | 146 |
| 371 | 3300048909 | Ga0496106_0111822 | Ga0496106_0111822_407_877 | 146 |
| 372 | 3300048910 | Ga0496107_0000718 | Ga0496107_0000718_7686_8126 | 146 |
| 373 | 3300048912 | Ga0496109_0180695 | Ga0496109_0180695_1022_1492 | 146 |
| 374 | 3300048912 | Ga0496109_0645139 | Ga0496109_0645139_92_553 | 146 |
| 375 | 3300048914 | Ga0496111_0038739 | Ga0496111_0038739_681_1151 | 146 |
| 376 | 3300048914 | Ga0496111_0586123 | Ga0496111_0586123_134_604 | 146 |
| 377 | 3300048915 | Ga0496112_0004850 | Ga0496112_0004850_1374_1844 | 146 |
| 378 | 3300048915 | Ga0496112_1258934 | Ga0496112_1258934_42_512 | 146 |
| 379 | 3300048916 | Ga0496113_0009031 | Ga0496113_0009031_6001_6471 | 146 |
| 380 | 3300048917 | Ga0496114_0064429 | Ga0496114_0064429_2494_2934 | 146 |
| 381 | 3300048918 | Ga0496115_0000807 | Ga0496115_0000807_14475_14915 | 146 |
| 382 | 3300048929 | Ga0496126_0076043 | Ga0496126_0076043_1473_1958 | 146 |
| 383 | 3300050490 | nmdc:mga03n38_177593_c1 | nmdc:mga03n38_177593_c1_225_686 | 146 |
| 384 | 3300050491 | nmdc:mga00v17_89937_c1 | nmdc:mga00v17_89937_c1_1130_1600 | 146 |
| 385 | 3300050492 | nmdc:mga0yw44_16179_c1 | nmdc:mga0yw44_16179_c1_2654_3124 | 146 |
| 386 | 3300050492 | nmdc:mga0yw44_416347_c1 | nmdc:mga0yw44_416347_c1_60_503 | 146 |
| 387 | 3300050494 | nmdc:mga06z11_72184_c1 | nmdc:mga06z11_72184_c1_926_1396 | 146 |
| 388 | 3300050496 | nmdc:mga07m45_41786_c1 | nmdc:mga07m45_41786_c1_1796_2257 | 146 |
| 389 | 3300050507 | nmdc:mga05p37_6127_c2 | nmdc:mga05p37_6127_c2_2228_2692 | 146 |
| 390 | 3300050509 | nmdc:mga0qj67_129954_c1 | nmdc:mga0qj67_129954_c1_451_912 | 146 |
| 391 | 3300050509 | nmdc:mga0qj67_131045_c1 | nmdc:mga0qj67_131045_c1_329_793 | 146 |
| 392 | 3300050510 | nmdc:mga06r32_29170_c1 | nmdc:mga06r32_29170_c1_1293_1757 | 146 |
| 393 | 3300050511 | nmdc:mga08y16_696729_c1 | nmdc:mga08y16_696729_c1_510_971 | 146 |
| 394 | 3300050516 | nmdc:mga0sz30_1414_c1 | nmdc:mga0sz30_1414_c1_2232_2693 | 146 |
| 395 | 3300050516 | nmdc:mga0sz30_4195_c2 | nmdc:mga0sz30_4195_c2_1211_1681 | 146 |
| 396 | 3300050516 | nmdc:mga0sz30_63330_c1 | nmdc:mga0sz30_63330_c1_791_1252 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jek-assembly1.cif.gz_A | crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a | 0.9995 | 7 | 143 |
| 2jek-assembly1.cif.gz_A | crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a | 0.9711 | 7 | 143 |
| 8cdj-assembly1.cif.gz_D | cand1 b-hairpin++-scf-skp2 cand1 rolling scf engaged | 0.443 | 62 | 145 |
| 8i9w-assembly1.cif.gz_CY | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - dbp10-3 | 0.3886 | 13 | 117 |
| 8bhz-assembly1.cif.gz_A-2 | the apo-crystal structure of a variant form of the 28-kda schistosoma bovis glutathione transferase in orthorhombic form | 0.3682 | 1 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jekA00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 | 0.9995 | 7 | 143 | 1.25.40.380 |
| 2jekA00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 | 0.9711 | 7 | 143 | 1.25.40.380 |
| af_Q9W1C5_327_407_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5166 | 62 | 129 | 1.25.10.10 |
| af_A0A1D6MC86_145_338_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.4556 | 7 | 145 | 1.25.10.10 |
| af_A0A1D6JDC4_716_850_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.4483 | 62 | 143 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A256WSQ0-F1-model_v4 | deleted | 1.003 | 64 | 144 |
|
| AF-A0A1A3NPW0-F1-model_v4 | Calpastatin | 1.001 | 10 | 142 |
|
| AF-A0A7W8RUX6-F1-model_v4 | Uncharacterized protein (DUF1810 family) | 1.001 | 6 | 142 |
|
| AF-A0A6P2L4H0-F1-model_v4 | deleted | 1.001 | 6 | 140 |
|
| AF-X7ZDZ6-F1-model_v4 | Calpastatin | 0.9998 | 11 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar