F433401

General Info

Members Datasets Scaffolds Average Seq Length
396 241 396 150

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100201321|Ga0070683_1002013212
Length 177
Sequence MDRMSDKAAGPWRLERFVTAQDQRGTYQRAVAELRAGAKASHWMWFIFPQIAGLGLSEISQRYAIGSLGEARAYLAHPVLGPRLRECARIVADTEGKSAERIFGPVDAMKLRSSMTLFAAADEEPGESVFHAVLAKYFNGIADEATVTRLLPARGRLWQWAGAACGPGRTAWRRPGL

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
180 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
188 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 6.06
Rhizosphere 75.51
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10144995 3300001991 Bacteria 530
2 JGI24735J21928_10063561 3300002067 Bacteria 1059
3 JGI24748J21848_1009573 3300002074 Bacteria 1141
4 JGI24748J21848_1025363 3300002074 Bacteria 723
5 JGI24738J21930_10054779 3300002075 Bacteria 815
6 JGI24749J21850_1029324 3300002076 Bacteria 788
7 JGI24744J21845_10000226 3300002077 Bacteria 8994
8 JGI24034J26672_10002361 3300002239 Bacteria 2586
9 JGI24034J26672_10023353 3300002239 Bacteria 981
10 JGI24034J26672_10065878 3300002239 Bacteria 642
11 JGI24742J22300_10004297 3300002244 Bacteria 2330
12 Ga0070676_10017923 3300005328 Bacteria 3920
13 Ga0070683_100201321 3300005329 Bacteria 1891
14 Ga0070690_100039717 3300005330 Bacteria 2974
15 Ga0070670_100517998 3300005331 Bacteria 1062
16 Ga0070677_10086411 3300005333 Bacteria 1355
17 Ga0068869_100256418 3300005334 Bacteria 1399
18 Ga0070666_10059968 3300005335 Bacteria 2574
19 Ga0070666_10310874 3300005335 Bacteria 1123
20 Ga0070682_100060413 3300005337 Bacteria 2397
21 Ga0070682_100547324 3300005337 Bacteria 905
22 Ga0068868_100000582 3300005338 Bacteria 24501
23 Ga0068868_100356637 3300005338 Bacteria 1254
24 Ga0070660_100168713 3300005339 Bacteria 1767
25 Ga0070660_100998579 3300005339 Bacteria 707
26 Ga0070689_100001541 3300005340 Bacteria 14693
27 Ga0070691_10006121 3300005341 Bacteria 5492
28 Ga0070687_100062164 3300005343 Bacteria 1976
29 Ga0070668_100049519 3300005347 Bacteria 3232
30 Ga0070668_100050031 3300005347 Bacteria 3217
31 Ga0070669_100016429 3300005353 Bacteria 5280
32 Ga0070669_100029005 3300005353 Bacteria 3988
33 Ga0070675_100188298 3300005354 Bacteria 1787
34 Ga0070671_100362940 3300005355 Bacteria 1237
35 Ga0070674_100001347 3300005356 Bacteria 12944
36 Ga0070674_100761029 3300005356 Bacteria 833
37 Ga0070673_100411551 3300005364 Bacteria 1211
38 Ga0070688_100482775 3300005365 Bacteria 932
39 Ga0070659_100101704 3300005366 Bacteria 2313
40 Ga0070659_100382855 3300005366 Bacteria 1185
41 Ga0070667_100004738 3300005367 Bacteria 11399
42 Ga0070667_100029808 3300005367 Bacteria 4549
43 Ga0070667_100425688 3300005367 Bacteria 1211
44 Ga0070709_10294681 3300005434 Bacteria 1183
45 Ga0070709_10745979 3300005434 Bacteria 765
46 Ga0070714_100082102 3300005435 Bacteria 2807
47 Ga0070713_100043738 3300005436 Bacteria 3663
48 Ga0070713_100653085 3300005436 Bacteria 1002
49 Ga0070713_100995320 3300005436 Bacteria 809
50 Ga0070710_10000230 3300005437 Bacteria 26115
51 Ga0070710_10083131 3300005437 Bacteria 1873
52 Ga0070701_10002124 3300005438 Bacteria 7542
53 Ga0070711_100011498 3300005439 Bacteria 5499
54 Ga0070711_100791229 3300005439 Bacteria 804
55 Ga0070705_100014215 3300005440 Bacteria 4091
56 Ga0070700_100027060 3300005441 Bacteria 3396
57 Ga0070694_100020644 3300005444 Bacteria 4202
58 Ga0070678_100002658 3300005456 Bacteria 9842
59 Ga0070662_100005597 3300005457 Bacteria 8030
60 Ga0068867_100054257 3300005459 Bacteria 2961
61 Ga0070697_100920778 3300005536 Bacteria 776
62 Ga0068853_100041206 3300005539 Bacteria 3943
63 Ga0070672_100204368 3300005543 Bacteria 1652
64 Ga0070686_100070360 3300005544 Bacteria 2288
65 Ga0070686_100484123 3300005544 Bacteria 957
66 Ga0070696_100001412 3300005546 Bacteria 15688
67 Ga0070693_100070857 3300005547 Bacteria 2052
68 Ga0070665_100024959 3300005548 Bacteria 6025
69 Ga0070665_100509515 3300005548 Bacteria 1215
70 Ga0070704_100002411 3300005549 Bacteria 10498
71 Ga0068855_100893835 3300005563 Bacteria 939
72 Ga0068854_100014497 3300005578 Bacteria 5197
73 Ga0070702_100007927 3300005615 Bacteria 5115
74 Ga0068859_100002920 3300005617 Bacteria 17355
75 Ga0068859_100099145 3300005617 Bacteria 2969
76 Ga0068859_102485698 3300005617 Bacteria 570
77 Ga0068864_100168623 3300005618 Bacteria 1995
78 Ga0068866_10005077 3300005718 Bacteria 5422
79 Ga0068861_100000980 3300005719 Bacteria 17434
80 Ga0068863_100003502 3300005841 Bacteria 15485
81 Ga0068858_100026595 3300005842 Bacteria 5375
82 Ga0068858_100393291 3300005842 Bacteria 1331
83 Ga0068860_100004106 3300005843 Bacteria 14910
84 Ga0068860_100298935 3300005843 Bacteria 1576
85 Ga0068860_102097797 3300005843 Bacteria 586
86 Ga0068862_100019024 3300005844 Bacteria 5727
87 Ga0068862_101741460 3300005844 Bacteria 632
88 Ga0081455_10009614 3300005937 Bacteria 9930
89 Ga0081455_10234431 3300005937 Unclassified 1352
90 Ga0070717_10199310 3300006028 Bacteria 1753
91 Ga0070717_10604822 3300006028 Bacteria 994
92 Ga0075365_10009545 3300006038 Bacteria 5588
93 Ga0075365_10163930 3300006038 Bacteria 1550
94 Ga0075365_10672038 3300006038 Bacteria 732
95 Ga0075368_10116590 3300006042 Bacteria 1104
96 Ga0075368_10118159 3300006042 Bacteria 1096
97 Ga0075363_100000794 3300006048 Bacteria 10910
98 Ga0075363_100002179 3300006048 Bacteria 7892
99 Ga0075363_100008090 3300006048 Bacteria 4880
100 Ga0075363_100027365 3300006048 Bacteria 2923
101 Ga0075363_100033614 3300006048 Bacteria 2672
102 Ga0075363_100043951 3300006048 Bacteria 2365
103 Ga0075363_100078765 3300006048 Bacteria 1799
104 Ga0075363_100106910 3300006048 Bacteria 1552
105 Ga0075364_10005061 3300006051 Bacteria 7643
106 Ga0075364_10013429 3300006051 Bacteria 5034
107 Ga0075364_10027121 3300006051 Bacteria 3658
108 Ga0075364_10032366 3300006051 Bacteria 3361
109 Ga0075364_10171504 3300006051 Bacteria 1467
110 Ga0075364_10595898 3300006051 Bacteria 755
111 Ga0070716_100120600 3300006173 Bacteria 1641
112 Ga0070716_101228569 3300006173 Bacteria 603
113 Ga0070712_100003668 3300006175 Bacteria 9469
114 Ga0070712_100736646 3300006175 Bacteria 843
115 Ga0075367_10006813 3300006178 Bacteria 5806
116 Ga0075367_10064200 3300006178 Bacteria 2196
117 Ga0075367_10158889 3300006178 Bacteria 1405
118 Ga0075367_10178968 3300006178 Bacteria 1322
119 Ga0075369_10029856 3300006186 Bacteria 2293
120 Ga0075369_10049807 3300006186 Bacteria 1810
121 Ga0075369_10177436 3300006186 Bacteria 980
122 Ga0075369_10203128 3300006186 Bacteria 915
123 Ga0075369_10276053 3300006186 Bacteria 782
124 Ga0075370_10007431 3300006353 Bacteria 5581
125 Ga0075370_10035894 3300006353 Bacteria 2783
126 Ga0075370_10245380 3300006353 Bacteria 1061
127 Ga0075370_10356177 3300006353 Bacteria 875
128 Ga0075428_100009624 3300006844 Bacteria 10729
129 Ga0075430_100012921 3300006846 Bacteria 7116
130 Ga0075430_100148943 3300006846 Bacteria 1949
131 Ga0075431_100056065 3300006847 Bacteria 4065
132 Ga0075429_100219805 3300006880 Bacteria 1664
133 Ga0068865_100001501 3300006881 Bacteria 13611
134 Ga0068865_100212515 3300006881 Bacteria 1508
135 Ga0097620_100002920 3300006931 Bacteria 17355
136 Ga0097620_100099145 3300006931 Bacteria 2969
137 Ga0097620_102486032 3300006931 Bacteria 570
138 Ga0105250_10036680 3300009092 Bacteria 1967
139 Ga0105250_10041366 3300009092 Bacteria 1848
140 Ga0111539_10899935 3300009094 Bacteria 1029
141 Ga0105245_10005292 3300009098 Bacteria 11339
142 Ga0105247_10000366 3300009101 Bacteria 38409
143 Ga0105247_10214880 3300009101 Bacteria 1299
144 Ga0105247_10368079 3300009101 Bacteria 1015
145 Ga0114129_10012555 3300009147 Bacteria 12063
146 Ga0105243_10005823 3300009148 Bacteria 9558
147 Ga0105241_10013380 3300009174 Bacteria 6014
148 Ga0105242_10004963 3300009176 Bacteria 10293
149 Ga0105248_10211357 3300009177 Bacteria 2186
150 Ga0105248_10867619 3300009177 Bacteria 1019
151 Ga0105237_10021356 3300009545 Bacteria 6656
152 Ga0105238_10535399 3300009551 Bacteria 1175
153 Ga0105249_10007211 3300009553 Bacteria 9699
154 Ga0105249_10028732 3300009553 Bacteria 5019
155 Ga0099796_10179071 3300010159 Bacteria 850
156 Ga0105239_10043737 3300010375 Bacteria 4911
157 Ga0157374_12735200 3300013296 Bacteria 521
158 Ga0157378_10265059 3300013297 Bacteria 1650
159 Ga0163162_10007849 3300013306 Bacteria 10399
160 Ga0163162_10018951 3300013306 Bacteria 6749
161 Ga0163162_10201599 3300013306 Bacteria 2118
162 Ga0163162_11032910 3300013306 Bacteria 930
163 Ga0163162_11910347 3300013306 Bacteria 680
164 Ga0157372_10010579 3300013307 Bacteria 9815
165 Ga0157375_10001947 3300013308 Bacteria 17806
166 Ga0157375_10851515 3300013308 Bacteria 1058
167 Ga0163163_10054201 3300014325 Bacteria 3961
168 Ga0163163_10433037 3300014325 Bacteria 1374
169 Ga0157380_10001014 3300014326 Bacteria 17849
170 Ga0157379_10056101 3300014968 Bacteria 3520
171 Ga0157379_11495057 3300014968 Bacteria 657
172 Ga0163161_10010688 3300017792 Bacteria 6356
173 Ga0163161_10085478 3300017792 Bacteria 2327
174 Ga0213874_10101496 3300021377 Bacteria 957
175 Ga0209051_1063181 3300025303 Bacteria 1154
176 Ga0207696_1069372 3300025711 Bacteria 982
177 Ga0207682_10166221 3300025893 Bacteria 1002
178 Ga0207692_10002849 3300025898 Bacteria 6687
179 Ga0207642_10000139 3300025899 Bacteria 20385
180 Ga0207710_10002206 3300025900 Bacteria 9152
181 Ga0207688_10028878 3300025901 Bacteria 3051
182 Ga0207680_10143900 3300025903 Bacteria 1583
183 Ga0207680_10958476 3300025903 Bacteria 613
184 Ga0207685_10000650 3300025905 Bacteria 6164
185 Ga0207699_10007110 3300025906 Bacteria 5457
186 Ga0207645_10020583 3300025907 Bacteria 4316
187 Ga0207654_10014458 3300025911 Bacteria 4078
188 Ga0207671_10758084 3300025914 Bacteria 771
189 Ga0207693_10001766 3300025915 Bacteria 18968
190 Ga0207663_10008198 3300025916 Bacteria 5450
191 Ga0207663_10660048 3300025916 Bacteria 826
192 Ga0207662_10124504 3300025918 Bacteria 1620
193 Ga0207657_10081839 3300025919 Bacteria 2711
194 Ga0207681_10076105 3300025923 Bacteria 2356
195 Ga0207681_10461911 3300025923 Bacteria 1034
196 Ga0207694_10424950 3300025924 Bacteria 1107
197 Ga0207659_10347194 3300025926 Bacteria 1230
198 Ga0207687_10001412 3300025927 Bacteria 16409
199 Ga0207700_10329434 3300025928 Bacteria 1325
200 Ga0207700_10586306 3300025928 Bacteria 992
201 Ga0207664_10979320 3300025929 Bacteria 758
202 Ga0207644_10212765 3300025931 Bacteria 1529
203 Ga0207644_10946841 3300025931 Bacteria 722
204 Ga0207690_10006559 3300025932 Bacteria 6901
205 Ga0207706_10022538 3300025933 Bacteria 5651
206 Ga0207706_10032701 3300025933 Bacteria 4630
207 Ga0207686_10023099 3300025934 Bacteria 3587
208 Ga0207709_10096854 3300025935 Bacteria 1942
209 Ga0207670_10549563 3300025936 Bacteria 943
210 Ga0207669_10000309 3300025937 Bacteria 22278
211 Ga0207704_10001181 3300025938 Bacteria 11638
212 Ga0207665_10142955 3300025939 Bacteria 1708
213 Ga0207665_10211387 3300025939 Bacteria 1417
214 Ga0207691_10478440 3300025940 Bacteria 1058
215 Ga0207711_10181838 3300025941 Bacteria 1912
216 Ga0207711_11049900 3300025941 Bacteria 755
217 Ga0207689_10081017 3300025942 Bacteria 2669
218 Ga0207667_10147602 3300025949 Bacteria 2420
219 Ga0207712_10010987 3300025961 Bacteria 5763
220 Ga0207668_10008510 3300025972 Bacteria 6120
221 Ga0207668_10031122 3300025972 Bacteria 3512
222 Ga0207668_10052936 3300025972 Bacteria 2811
223 Ga0207668_10541898 3300025972 Bacteria 1007
224 Ga0207640_10023763 3300025981 Bacteria 3689
225 Ga0207658_10020251 3300025986 Bacteria 4606
226 Ga0207658_10058793 3300025986 Bacteria 2862
227 Ga0207658_10093042 3300025986 Bacteria 2343
228 Ga0207658_10342726 3300025986 Bacteria 1299
229 Ga0207677_10028983 3300026023 Bacteria 3511
230 Ga0207677_10603790 3300026023 Bacteria 963
231 Ga0207703_10017861 3300026035 Bacteria 5540
232 Ga0207703_10129768 3300026035 Bacteria 2175
233 Ga0207703_10715553 3300026035 Bacteria 953
234 Ga0207639_10044961 3300026041 Bacteria 3323
235 Ga0207678_10074493 3300026067 Bacteria 2909
236 Ga0207678_11235073 3300026067 Bacteria 661
237 Ga0207708_10052739 3300026075 Bacteria 3098
238 Ga0207708_10175929 3300026075 Bacteria 1697
239 Ga0207641_10025990 3300026088 Bacteria 4830
240 Ga0207648_10000349 3300026089 Bacteria 50786
241 Ga0207676_10065324 3300026095 Bacteria 2897
242 Ga0207675_100002951 3300026118 Bacteria 16725
243 Ga0207675_100058062 3300026118 Bacteria 3611
244 Ga0207683_10000040 3300026121 Bacteria 95127
245 Ga0268266_10003565 3300028379 Bacteria 15420
246 Ga0268265_10006992 3300028380 Bacteria 7631
247 Ga0268264_10005904 3300028381 Bacteria 10363
248 Ga0268264_10389875 3300028381 Bacteria 1336
249 Ga0265337_1000358 3300028556 Bacteria 24450
250 Ga0265326_10000471 3300028558 Bacteria 15531
251 Ga0265319_1006823 3300028563 Bacteria 5222
252 Ga0265334_10003105 3300028573 Bacteria 7576
253 Ga0265318_10003849 3300028577 Bacteria 7420
254 Ga0265323_10004561 3300028653 Bacteria 5964
255 Ga0265322_10015354 3300028654 Bacteria 2213
256 Ga0265338_10001357 3300028800 Bacteria 39875
257 Ga0265332_10003275 3300031238 Bacteria 7868
258 Ga0265320_10008713 3300031240 Bacteria 6179
259 Ga0265325_10018483 3300031241 Bacteria 3866
260 Ga0265329_10186956 3300031242 Bacteria 679
261 Ga0265339_10064782 3300031249 Bacteria 1960
262 Ga0265316_10028130 3300031344 Bacteria 4641
263 Ga0265314_10022467 3300031711 Bacteria 4831
264 Ga0265342_10004931 3300031712 Bacteria 10304
265 Ga0307413_10032172 3300031824 Bacteria 2970
266 Ga0307413_10071704 3300031824 Bacteria 2184
267 Ga0307410_10158990 3300031852 Bacteria 1691
268 Ga0307407_11291918 3300031903 Bacteria 572
269 Ga0307412_10755078 3300031911 Bacteria 840
270 Ga0307409_100038658 3300031995 Bacteria 3532
271 Ga0307409_100752258 3300031995 Bacteria 978
272 Ga0307416_100017930 3300032002 Bacteria 4972
273 Ga0307416_101390190 3300032002 Bacteria 808
274 Ga0307415_100057221 3300032126 Bacteria 2678
275 Ga0316215_1012477 3300033544 Bacteria 844
276 Ga0316214_1000298 3300033545 Bacteria 4758
277 Ga0373938_0091403 3300034957 Bacteria 753
278 Ga0373939_0247541 3300035114 Bacteria 692
279 Ga0373942_0091757 3300035207 Bacteria 916
280 Ga0372808_008926 3300036459 Bacteria 1395
281 Ga0436361_0364820 3300039447 Bacteria 634
282 Ga0436363_0179673 3300039450 Bacteria 1472
283 Ga0436363_0480362 3300039450 Bacteria 2170
284 Ga0439461_0010559 3300041410 Bacteria 1698
285 Ga0439461_0019249 3300041410 Bacteria 1343
286 Ga0439466_0007613 3300041411 Bacteria 4090
287 Ga0439466_0033532 3300041411 Bacteria 1744
288 Ga0439465_0006345 3300041413 Bacteria 3756
289 Ga0439465_0011566 3300041413 Bacteria 2769
290 Ga0439465_0058518 3300041413 Bacteria 1273
291 Ga0466969_0027627 3300044656 Bacteria 2905
292 Ga0466969_0060140 3300044656 Bacteria 1847
293 Ga0466972_0009345 3300044658 Bacteria 4928
294 Ga0466972_0038651 3300044658 Bacteria 2331
295 Ga0466972_0048012 3300044658 Bacteria 2063
296 Ga0466965_0021153 3300044683 Bacteria 3130
297 Ga0466965_0915217 3300044683 Bacteria 512
298 Ga0466966_0002346 3300044684 Bacteria 12364
299 Ga0466966_0078641 3300044684 Bacteria 2056
300 Ga0466961_0014479 3300044693 Bacteria 5065
301 Ga0466961_0030336 3300044693 Bacteria 3475
302 Ga0466964_0189461 3300044706 Bacteria 980
303 Ga0466968_0012581 3300044735 Bacteria 3315
304 Ga0466970_0036545 3300044765 Bacteria 2602
305 Ga0466970_0057864 3300044765 Bacteria 2074
306 Ga0466970_0636584 3300044765 Bacteria 620
307 Ga0466957_0005544 3300044842 Bacteria 7089
308 Ga0466957_0205597 3300044842 Bacteria 1295
309 Ga0466960_0065796 3300044901 Bacteria 1791
310 Ga0466960_0131122 3300044901 Bacteria 1323
311 Ga0466959_0063957 3300045049 Bacteria 2671
312 Ga0466958_0001179 3300045836 Bacteria 12170
313 Ga0466958_0048258 3300045836 Bacteria 2572
314 Ga0466958_0352590 3300045836 Bacteria 947
315 Ga0466967_0070698 3300045976 Bacteria 3123
316 Ga0466967_0143667 3300045976 Bacteria 2224
317 Ga0466967_0210648 3300045976 Bacteria 1843
318 Ga0466967_0887204 3300045976 Bacteria 887
319 Ga0466967_1275427 3300045976 Bacteria 732
320 Ga0496100_0002195 3300048903 Bacteria 9845
321 Ga0496100_0972462 3300048903 Bacteria 668
322 Ga0496101_0006100 3300048904 Bacteria 7739
323 Ga0496102_0003228 3300048905 Bacteria 13830
324 Ga0496102_0004887 3300048905 Bacteria 11347
325 Ga0496102_0925377 3300048905 Bacteria 793
326 Ga0496103_0004626 3300048906 Bacteria 8332
327 Ga0496104_0152211 3300048907 Bacteria 2220
328 Ga0496104_0459936 3300048907 Bacteria 1184
329 Ga0496104_1559463 3300048907 Bacteria 563
330 Ga0496106_0004173 3300048909 Bacteria 10770
331 Ga0496106_0111822 3300048909 Bacteria 2128
332 Ga0496107_0000718 3300048910 Bacteria 18910
333 Ga0496108_0191763 3300048911 Bacteria 1771
334 Ga0496109_0167505 3300048912 Bacteria 2060
335 Ga0496109_0180695 3300048912 Bacteria 1981
336 Ga0496109_0645139 3300048912 Bacteria 996
337 Ga0496111_0038739 3300048914 Bacteria 3416
338 Ga0496111_0586123 3300048914 Bacteria 817
339 Ga0496112_0004850 3300048915 Bacteria 11491
340 Ga0496112_1258934 3300048915 Bacteria 656
341 Ga0496113_0009031 3300048916 Bacteria 6528
342 Ga0496114_0064429 3300048917 Bacteria 3069
343 Ga0496115_0000807 3300048918 Bacteria 22983
344 Ga0496126_0076043 3300048929 Bacteria 2979
345 Ga0501031_0616078 3300049568 Bacteria 698
346 Ga0501032_0027162 3300049569 Bacteria 3934
347 Ga0501034_0056626 3300049571 Bacteria 3944
348 Ga0501034_0168074 3300049571 Bacteria 2161
349 Ga0501037_0404846 3300049573 Bacteria 935
350 Ga0501043_0181457 3300049579 Bacteria 1640
351 Ga0501047_0095344 3300049581 Bacteria 2854
352 Ga0501070_0040058 3300049586 Bacteria 3908
353 Ga0501070_0934531 3300049586 Bacteria 675
354 Ga0501080_0400318 3300049742 Bacteria 1235
355 Ga0501080_0746445 3300049742 Bacteria 861
356 Ga0501035_0005928 3300049822 Bacteria 11503
357 Ga0501044_0000498 3300049823 Bacteria 47714
358 nmdc:mga03n38_1356_c1 3300050490 Bacteria 6936
359 nmdc:mga03n38_177593_c1 3300050490 Bacteria 1089
360 nmdc:mga03n38_206784_c1 3300050490 Bacteria 1018
361 nmdc:mga03n38_464473_c1 3300050490 Bacteria 706
362 nmdc:mga03n38_52718_c1 3300050490 Bacteria 1822
363 nmdc:mga00v17_117307_c1 3300050491 Bacteria 1693
364 nmdc:mga00v17_380282_c1 3300050491 Bacteria 918
365 nmdc:mga00v17_610_c2 3300050491 Bacteria 10564
366 nmdc:mga00v17_61951_c1 3300050491 Bacteria 2300
367 nmdc:mga00v17_6505_c1 3300050491 Bacteria 6202
368 nmdc:mga00v17_89937_c1 3300050491 Bacteria 1927
369 nmdc:mga0yw44_1204_c1 3300050492 Bacteria 10121
370 nmdc:mga0yw44_16179_c1 3300050492 Bacteria 4023
371 nmdc:mga0yw44_253409_c1 3300050492 Bacteria 1172
372 nmdc:mga0yw44_25526_c1 3300050492 Bacteria 3361
373 nmdc:mga0yw44_416347_c1 3300050492 Bacteria 909
374 nmdc:mga0yw44_46003_c1 3300050492 Bacteria 2619
375 nmdc:mga06z11_43281_c1 3300050494 Bacteria 2264
376 nmdc:mga06z11_72184_c1 3300050494 Bacteria 1829
377 nmdc:mga06z11_88440_c1 3300050494 Bacteria 1677
378 nmdc:mga07m45_18604_c1 3300050496 Bacteria 1982
379 nmdc:mga07m45_41786_c1 3300050496 Bacteria 2568
380 nmdc:mga07m45_6971_c1 3300050496 Bacteria 5745
381 nmdc:mga05p37_6127_c2 3300050507 Bacteria 8833
382 nmdc:mga0qj67_129954_c1 3300050509 Bacteria 2040
383 nmdc:mga0qj67_131045_c1 3300050509 Bacteria 2031
384 nmdc:mga06r32_29170_c1 3300050510 Bacteria 5168
385 nmdc:mga08y16_696729_c1 3300050511 Bacteria 1016
386 nmdc:mga0sz30_1414_c1 3300050516 Bacteria 3291
387 nmdc:mga0sz30_216789_c1 3300050516 Bacteria 851
388 nmdc:mga0sz30_266285_c1 3300050516 Bacteria 763
389 nmdc:mga0sz30_4195_c2 3300050516 Bacteria 4651
390 nmdc:mga0sz30_43150_c1 3300050516 Bacteria 1898
391 nmdc:mga0sz30_46398_c1 3300050516 Bacteria 1834
392 nmdc:mga0sz30_63330_c1 3300050516 Bacteria 1583
393 Ga0500641_0148768 3300053096 Bacteria 1011
394 Ga0500568_0103264 3300053139 Bacteria 1068
395 Ga0500588_0104844 3300053146 Bacteria 979
396 Ga0466962_0007464 3300061719 Bacteria 5247

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0636584 Ga0466970_0636584_28_444 135
2 3300045836 Ga0466958_0352590 Ga0466958_0352590_214_630 135
3 3300045976 Ga0466967_0210648 Ga0466967_0210648_870_1286 135
4 3300005337 Ga0070682_100547324 Ga0070682_1005473242 137
5 3300005356 Ga0070674_100761029 Ga0070674_1007610292 137
6 3300005548 Ga0070665_100509515 Ga0070665_1005095151 137
7 3300005617 Ga0068859_102485698 Ga0068859_1024856982 137
8 3300006881 Ga0068865_100212515 Ga0068865_1002125151 137
9 3300006931 Ga0097620_102486032 Ga0097620_1024860322 137
10 3300009101 Ga0105247_10214880 Ga0105247_102148802 137
11 3300013306 Ga0163162_11032910 Ga0163162_110329101 137
12 3300013308 Ga0157375_10851515 Ga0157375_108515152 137
13 3300014968 Ga0157379_11495057 Ga0157379_114950571 137
14 3300026067 Ga0207678_11235073 Ga0207678_112350732 137
15 3300026075 Ga0207708_10175929 Ga0207708_101759293 137
16 3300048911 Ga0496108_0191763 Ga0496108_0191763_1313_1735 137
17 3300048912 Ga0496109_0167505 Ga0496109_0167505_327_749 137
18 3300006038 Ga0075365_10163930 Ga0075365_101639302 138
19 3300025303 Ga0209051_1063181 Ga0209051_10631812 138
20 3300050492 nmdc:mga0yw44_25526_c1 nmdc:mga0yw44_25526_c1_1443_1859 138
21 3300050516 nmdc:mga0sz30_43150_c1 nmdc:mga0sz30_43150_c1_1088_1504 138
22 3300053139 Ga0500568_0103264 Ga0500568_0103264_610_1029 139
23 3300053146 Ga0500588_0104844 Ga0500588_0104844_29_448 139
24 3300006051 Ga0075364_10595898 Ga0075364_105958982 140
25 3300050492 nmdc:mga0yw44_253409_c1 nmdc:mga0yw44_253409_c1_714_1154 140
26 3300053096 Ga0500641_0148768 Ga0500641_0148768_50_484 140
27 3300005436 Ga0070713_100653085 Ga0070713_1006530852 142
28 3300006048 Ga0075363_100008090 Ga0075363_1000080903 142
29 3300006051 Ga0075364_10005061 Ga0075364_100050614 142
30 3300006186 Ga0075369_10276053 Ga0075369_102760532 142
31 3300009092 Ga0105250_10036680 Ga0105250_100366802 142
32 3300025711 Ga0207696_1069372 Ga0207696_10693722 142
33 3300025928 Ga0207700_10586306 Ga0207700_105863062 142
34 3300033544 Ga0316215_1012477 Ga0316215_10124772 142
35 3300033545 Ga0316214_1000298 Ga0316214_10002983 142
36 3300036459 Ga0372808_008926 Ga0372808_008926_266_718 142
37 3300050490 nmdc:mga03n38_464473_c1 nmdc:mga03n38_464473_c1_110_538 142
38 3300050491 nmdc:mga00v17_6505_c1 nmdc:mga00v17_6505_c1_1370_1798 142
39 3300050516 nmdc:mga0sz30_216789_c1 nmdc:mga0sz30_216789_c1_230_658 142
40 3300005335 Ga0070666_10310874 Ga0070666_103108742 143
41 3300005339 Ga0070660_100998579 Ga0070660_1009985791 143
42 3300005366 Ga0070659_100382855 Ga0070659_1003828551 143
43 3300005436 Ga0070713_100043738 Ga0070713_1000437382 143
44 3300005437 Ga0070710_10083131 Ga0070710_100831311 143
45 3300005544 Ga0070686_100484123 Ga0070686_1004841232 143
46 3300006028 Ga0070717_10199310 Ga0070717_101993102 143
47 3300006173 Ga0070716_100120600 Ga0070716_1001206002 143
48 3300013296 Ga0157374_12735200 Ga0157374_127352001 143
49 3300013306 Ga0163162_10201599 Ga0163162_102015992 143
50 3300014325 Ga0163163_10433037 Ga0163163_104330372 143
51 3300025901 Ga0207688_10028878 Ga0207688_100288782 143
52 3300025928 Ga0207700_10329434 Ga0207700_103294342 143
53 3300025929 Ga0207664_10979320 Ga0207664_109793202 143
54 3300025939 Ga0207665_10211387 Ga0207665_102113872 143
55 3300039447 Ga0436361_0364820 Ga0436361_0364820_22_453 143
56 3300039450 Ga0436363_0179673 Ga0436363_0179673_461_895 143
57 3300044656 Ga0466969_0027627 Ga0466969_0027627_52_483 143
58 3300044683 Ga0466965_0915217 Ga0466965_0915217_48_482 143
59 3300044684 Ga0466966_0002346 Ga0466966_0002346_3651_4082 143
60 3300044693 Ga0466961_0030336 Ga0466961_0030336_2078_2509 143
61 3300044735 Ga0466968_0012581 Ga0466968_0012581_556_987 143
62 3300044765 Ga0466970_0057864 Ga0466970_0057864_627_1058 143
63 3300044842 Ga0466957_0005544 Ga0466957_0005544_5951_6382 143
64 3300045049 Ga0466959_0063957 Ga0466959_0063957_778_1209 143
65 3300045836 Ga0466958_0001179 Ga0466958_0001179_8388_8819 143
66 3300045976 Ga0466967_0887204 Ga0466967_0887204_92_523 143
67 3300048903 Ga0496100_0972462 Ga0496100_0972462_136_597 143
68 3300048905 Ga0496102_0925377 Ga0496102_0925377_125_577 143
69 3300048907 Ga0496104_0459936 Ga0496104_0459936_585_1028 143
70 3300049568 Ga0501031_0616078 Ga0501031_0616078_49_480 143
71 3300049569 Ga0501032_0027162 Ga0501032_0027162_564_995 143
72 3300049571 Ga0501034_0056626 Ga0501034_0056626_1858_2298 143
73 3300049571 Ga0501034_0168074 Ga0501034_0168074_1166_1597 143
74 3300049573 Ga0501037_0404846 Ga0501037_0404846_317_748 143
75 3300049579 Ga0501043_0181457 Ga0501043_0181457_285_716 143
76 3300049581 Ga0501047_0095344 Ga0501047_0095344_2098_2529 143
77 3300049742 Ga0501080_0746445 Ga0501080_0746445_241_681 143
78 3300049822 Ga0501035_0005928 Ga0501035_0005928_7350_7781 143
79 3300049823 Ga0501044_0000498 Ga0501044_0000498_35655_36086 143
80 3300002074 JGI24748J21848_1025363 JGI24748J21848_10253632 144
81 3300006038 Ga0075365_10672038 Ga0075365_106720382 144
82 3300006042 Ga0075368_10116590 Ga0075368_101165902 144
83 3300006042 Ga0075368_10118159 Ga0075368_101181592 144
84 3300006048 Ga0075363_100000794 Ga0075363_1000007942 144
85 3300006048 Ga0075363_100002179 Ga0075363_1000021796 144
86 3300006048 Ga0075363_100027365 Ga0075363_1000273651 144
87 3300006048 Ga0075363_100033614 Ga0075363_1000336142 144
88 3300006048 Ga0075363_100043951 Ga0075363_1000439512 144
89 3300006051 Ga0075364_10027121 Ga0075364_100271212 144
90 3300006051 Ga0075364_10032366 Ga0075364_100323663 144
91 3300006051 Ga0075364_10171504 Ga0075364_101715041 144
92 3300006178 Ga0075367_10006813 Ga0075367_100068132 144
93 3300006178 Ga0075367_10064200 Ga0075367_100642002 144
94 3300006186 Ga0075369_10049807 Ga0075369_100498072 144
95 3300006186 Ga0075369_10203128 Ga0075369_102031282 144
96 3300006353 Ga0075370_10007431 Ga0075370_100074313 144
97 3300006353 Ga0075370_10035894 Ga0075370_100358942 144
98 3300006353 Ga0075370_10356177 Ga0075370_103561772 144
99 3300028556 Ga0265337_1000358 Ga0265337_100035820 144
100 3300028558 Ga0265326_10000471 Ga0265326_100004719 144
101 3300028563 Ga0265319_1006823 Ga0265319_10068235 144
102 3300028573 Ga0265334_10003105 Ga0265334_100031055 144
103 3300028577 Ga0265318_10003849 Ga0265318_100038494 144
104 3300028653 Ga0265323_10004561 Ga0265323_100045615 144
105 3300028654 Ga0265322_10015354 Ga0265322_100153543 144
106 3300028800 Ga0265338_10001357 Ga0265338_1000135716 144
107 3300031238 Ga0265332_10003275 Ga0265332_100032754 144
108 3300031240 Ga0265320_10008713 Ga0265320_100087133 144
109 3300031241 Ga0265325_10018483 Ga0265325_100184831 144
110 3300031242 Ga0265329_10186956 Ga0265329_101869561 144
111 3300031249 Ga0265339_10064782 Ga0265339_100647823 144
112 3300031344 Ga0265316_10028130 Ga0265316_100281302 144
113 3300031711 Ga0265314_10022467 Ga0265314_100224673 144
114 3300031712 Ga0265342_10004931 Ga0265342_100049313 144
115 3300031824 Ga0307413_10032172 Ga0307413_100321722 144
116 3300031824 Ga0307413_10071704 Ga0307413_100717042 144
117 3300031852 Ga0307410_10158990 Ga0307410_101589903 144
118 3300031911 Ga0307412_10755078 Ga0307412_107550782 144
119 3300031995 Ga0307409_100038658 Ga0307409_1000386583 144
120 3300031995 Ga0307409_100752258 Ga0307409_1007522582 144
121 3300032002 Ga0307416_100017930 Ga0307416_1000179304 144
122 3300032002 Ga0307416_101390190 Ga0307416_1013901902 144
123 3300032126 Ga0307415_100057221 Ga0307415_1000572213 144
124 3300041413 Ga0439465_0011566 Ga0439465_0011566_491_949 144
125 3300044842 Ga0466957_0205597 Ga0466957_0205597_645_1106 144
126 3300045976 Ga0466967_0143667 Ga0466967_0143667_1474_1935 144
127 3300049586 Ga0501070_0040058 Ga0501070_0040058_3179_3637 144
128 3300049742 Ga0501080_0400318 Ga0501080_0400318_726_1184 144
129 3300050490 nmdc:mga03n38_1356_c1 nmdc:mga03n38_1356_c1_4813_5316 144
130 3300050490 nmdc:mga03n38_206784_c1 nmdc:mga03n38_206784_c1_347_850 144
131 3300050490 nmdc:mga03n38_52718_c1 nmdc:mga03n38_52718_c1_1160_1663 144
132 3300050491 nmdc:mga00v17_117307_c1 nmdc:mga00v17_117307_c1_344_847 144
133 3300050491 nmdc:mga00v17_380282_c1 nmdc:mga00v17_380282_c1_144_656 144
134 3300050491 nmdc:mga00v17_610_c2 nmdc:mga00v17_610_c2_9568_10071 144
135 3300050491 nmdc:mga00v17_61951_c1 nmdc:mga00v17_61951_c1_480_983 144
136 3300050492 nmdc:mga0yw44_1204_c1 nmdc:mga0yw44_1204_c1_5196_5699 144
137 3300050492 nmdc:mga0yw44_46003_c1 nmdc:mga0yw44_46003_c1_999_1511 144
138 3300050494 nmdc:mga06z11_43281_c1 nmdc:mga06z11_43281_c1_1639_2151 144
139 3300050494 nmdc:mga06z11_88440_c1 nmdc:mga06z11_88440_c1_1151_1654 144
140 3300050496 nmdc:mga07m45_18604_c1 nmdc:mga07m45_18604_c1_1074_1577 144
141 3300050496 nmdc:mga07m45_6971_c1 nmdc:mga07m45_6971_c1_2869_3372 144
142 3300050516 nmdc:mga0sz30_266285_c1 nmdc:mga0sz30_266285_c1_79_582 144
143 3300050516 nmdc:mga0sz30_46398_c1 nmdc:mga0sz30_46398_c1_899_1411 144
144 3300031903 Ga0307407_11291918 Ga0307407_112919181 145
145 3300044656 Ga0466969_0060140 Ga0466969_0060140_1309_1746 145
146 3300044658 Ga0466972_0009345 Ga0466972_0009345_2311_2748 145
147 3300044658 Ga0466972_0048012 Ga0466972_0048012_569_1006 145
148 3300044683 Ga0466965_0021153 Ga0466965_0021153_1360_1797 145
149 3300044684 Ga0466966_0078641 Ga0466966_0078641_1337_1774 145
150 3300044693 Ga0466961_0014479 Ga0466961_0014479_1889_2326 145
151 3300044706 Ga0466964_0189461 Ga0466964_0189461_481_918 145
152 3300044765 Ga0466970_0036545 Ga0466970_0036545_701_1138 145
153 3300044901 Ga0466960_0131122 Ga0466960_0131122_43_480 145
154 3300045836 Ga0466958_0048258 Ga0466958_0048258_852_1289 145
155 3300045976 Ga0466967_0070698 Ga0466967_0070698_1916_2353 145
156 3300045976 Ga0466967_1275427 Ga0466967_1275427_276_722 145
157 3300049586 Ga0501070_0934531 Ga0501070_0934531_76_528 145
158 3300061719 Ga0466962_0007464 Ga0466962_0007464_4603_5040 145
159 3300001991 JGI24743J22301_10144995 JGI24743J22301_101449952 146
160 3300002067 JGI24735J21928_10063561 JGI24735J21928_100635612 146
161 3300002074 JGI24748J21848_1009573 JGI24748J21848_10095732 146
162 3300002075 JGI24738J21930_10054779 JGI24738J21930_100547792 146
163 3300002076 JGI24749J21850_1029324 JGI24749J21850_10293241 146
164 3300002077 JGI24744J21845_10000226 JGI24744J21845_1000022611 146
165 3300002239 JGI24034J26672_10002361 JGI24034J26672_100023611 146
166 3300002239 JGI24034J26672_10023353 JGI24034J26672_100233532 146
167 3300002239 JGI24034J26672_10065878 JGI24034J26672_100658781 146
168 3300002244 JGI24742J22300_10004297 JGI24742J22300_100042972 146
169 3300005328 Ga0070676_10017923 Ga0070676_100179231 146
170 3300005329 Ga0070683_100201321 Ga0070683_1002013212 146
171 3300005330 Ga0070690_100039717 Ga0070690_1000397172 146
172 3300005331 Ga0070670_100517998 Ga0070670_1005179982 146
173 3300005333 Ga0070677_10086411 Ga0070677_100864112 146
174 3300005334 Ga0068869_100256418 Ga0068869_1002564181 146
175 3300005335 Ga0070666_10059968 Ga0070666_100599683 146
176 3300005337 Ga0070682_100060413 Ga0070682_1000604133 146
177 3300005338 Ga0068868_100000582 Ga0068868_1000005825 146
178 3300005338 Ga0068868_100356637 Ga0068868_1003566372 146
179 3300005339 Ga0070660_100168713 Ga0070660_1001687132 146
180 3300005340 Ga0070689_100001541 Ga0070689_1000015414 146
181 3300005341 Ga0070691_10006121 Ga0070691_100061213 146
182 3300005343 Ga0070687_100062164 Ga0070687_1000621642 146
183 3300005347 Ga0070668_100049519 Ga0070668_1000495193 146
184 3300005347 Ga0070668_100050031 Ga0070668_1000500312 146
185 3300005353 Ga0070669_100016429 Ga0070669_1000164292 146
186 3300005353 Ga0070669_100029005 Ga0070669_1000290053 146
187 3300005354 Ga0070675_100188298 Ga0070675_1001882982 146
188 3300005355 Ga0070671_100362940 Ga0070671_1003629402 146
189 3300005356 Ga0070674_100001347 Ga0070674_1000013474 146
190 3300005364 Ga0070673_100411551 Ga0070673_1004115512 146
191 3300005365 Ga0070688_100482775 Ga0070688_1004827752 146
192 3300005366 Ga0070659_100101704 Ga0070659_1001017043 146
193 3300005367 Ga0070667_100004738 Ga0070667_10000473813 146
194 3300005367 Ga0070667_100029808 Ga0070667_1000298083 146
195 3300005367 Ga0070667_100425688 Ga0070667_1004256882 146
196 3300005434 Ga0070709_10294681 Ga0070709_102946812 146
197 3300005434 Ga0070709_10745979 Ga0070709_107459791 146
198 3300005435 Ga0070714_100082102 Ga0070714_1000821023 146
199 3300005436 Ga0070713_100995320 Ga0070713_1009953202 146
200 3300005437 Ga0070710_10000230 Ga0070710_1000023015 146
201 3300005438 Ga0070701_10002124 Ga0070701_1000212410 146
202 3300005439 Ga0070711_100011498 Ga0070711_1000114984 146
203 3300005439 Ga0070711_100791229 Ga0070711_1007912291 146
204 3300005440 Ga0070705_100014215 Ga0070705_1000142153 146
205 3300005441 Ga0070700_100027060 Ga0070700_1000270604 146
206 3300005444 Ga0070694_100020644 Ga0070694_1000206442 146
207 3300005456 Ga0070678_100002658 Ga0070678_1000026589 146
208 3300005457 Ga0070662_100005597 Ga0070662_1000055976 146
209 3300005459 Ga0068867_100054257 Ga0068867_1000542574 146
210 3300005536 Ga0070697_100920778 Ga0070697_1009207781 146
211 3300005539 Ga0068853_100041206 Ga0068853_1000412062 146
212 3300005543 Ga0070672_100204368 Ga0070672_1002043683 146
213 3300005544 Ga0070686_100070360 Ga0070686_1000703602 146
214 3300005546 Ga0070696_100001412 Ga0070696_10000141221 146
215 3300005547 Ga0070693_100070857 Ga0070693_1000708573 146
216 3300005548 Ga0070665_100024959 Ga0070665_1000249593 146
217 3300005549 Ga0070704_100002411 Ga0070704_1000024114 146
218 3300005563 Ga0068855_100893835 Ga0068855_1008938351 146
219 3300005578 Ga0068854_100014497 Ga0068854_1000144974 146
220 3300005615 Ga0070702_100007927 Ga0070702_1000079274 146
221 3300005617 Ga0068859_100002920 Ga0068859_10000292023 146
222 3300005617 Ga0068859_100099145 Ga0068859_1000991453 146
223 3300005618 Ga0068864_100168623 Ga0068864_1001686232 146
224 3300005718 Ga0068866_10005077 Ga0068866_100050774 146
225 3300005719 Ga0068861_100000980 Ga0068861_10000098023 146
226 3300005841 Ga0068863_100003502 Ga0068863_1000035027 146
227 3300005842 Ga0068858_100026595 Ga0068858_1000265954 146
228 3300005842 Ga0068858_100393291 Ga0068858_1003932912 146
229 3300005843 Ga0068860_100004106 Ga0068860_10000410618 146
230 3300005843 Ga0068860_100298935 Ga0068860_1002989352 146
231 3300005843 Ga0068860_102097797 Ga0068860_1020977972 146
232 3300005844 Ga0068862_100019024 Ga0068862_1000190244 146
233 3300005844 Ga0068862_101741460 Ga0068862_1017414602 146
234 3300005937 Ga0081455_10009614 Ga0081455_100096142 146
235 3300005937 Ga0081455_10234431 Ga0081455_102344312 146
236 3300006028 Ga0070717_10604822 Ga0070717_106048222 146
237 3300006038 Ga0075365_10009545 Ga0075365_100095452 146
238 3300006048 Ga0075363_100078765 Ga0075363_1000787652 146
239 3300006048 Ga0075363_100106910 Ga0075363_1001069102 146
240 3300006051 Ga0075364_10013429 Ga0075364_100134291 146
241 3300006173 Ga0070716_101228569 Ga0070716_1012285692 146
242 3300006175 Ga0070712_100003668 Ga0070712_10000366813 146
243 3300006175 Ga0070712_100736646 Ga0070712_1007366462 146
244 3300006178 Ga0075367_10158889 Ga0075367_101588892 146
245 3300006178 Ga0075367_10178968 Ga0075367_101789682 146
246 3300006186 Ga0075369_10029856 Ga0075369_100298562 146
247 3300006186 Ga0075369_10177436 Ga0075369_101774361 146
248 3300006353 Ga0075370_10245380 Ga0075370_102453802 146
249 3300006844 Ga0075428_100009624 Ga0075428_1000096245 146
250 3300006846 Ga0075430_100012921 Ga0075430_1000129214 146
251 3300006846 Ga0075430_100148943 Ga0075430_1001489432 146
252 3300006847 Ga0075431_100056065 Ga0075431_1000560652 146
253 3300006880 Ga0075429_100219805 Ga0075429_1002198051 146
254 3300006881 Ga0068865_100001501 Ga0068865_10000150116 146
255 3300006931 Ga0097620_100002920 Ga0097620_10000292023 146
256 3300006931 Ga0097620_100099145 Ga0097620_1000991453 146
257 3300009092 Ga0105250_10041366 Ga0105250_100413661 146
258 3300009094 Ga0111539_10899935 Ga0111539_108999352 146
259 3300009098 Ga0105245_10005292 Ga0105245_1000529214 146
260 3300009101 Ga0105247_10000366 Ga0105247_100003663 146
261 3300009101 Ga0105247_10368079 Ga0105247_103680792 146
262 3300009147 Ga0114129_10012555 Ga0114129_1001255514 146
263 3300009148 Ga0105243_10005823 Ga0105243_100058239 146
264 3300009174 Ga0105241_10013380 Ga0105241_100133803 146
265 3300009176 Ga0105242_10004963 Ga0105242_1000496311 146
266 3300009177 Ga0105248_10211357 Ga0105248_102113572 146
267 3300009177 Ga0105248_10867619 Ga0105248_108676192 146
268 3300009545 Ga0105237_10021356 Ga0105237_100213569 146
269 3300009551 Ga0105238_10535399 Ga0105238_105353991 146
270 3300009553 Ga0105249_10007211 Ga0105249_100072117 146
271 3300009553 Ga0105249_10028732 Ga0105249_100287324 146
272 3300010159 Ga0099796_10179071 Ga0099796_101790712 146
273 3300010375 Ga0105239_10043737 Ga0105239_100437374 146
274 3300013297 Ga0157378_10265059 Ga0157378_102650592 146
275 3300013306 Ga0163162_10007849 Ga0163162_1000784911 146
276 3300013306 Ga0163162_10018951 Ga0163162_100189514 146
277 3300013306 Ga0163162_11910347 Ga0163162_119103471 146
278 3300013307 Ga0157372_10010579 Ga0157372_100105794 146
279 3300013308 Ga0157375_10001947 Ga0157375_100019474 146
280 3300014325 Ga0163163_10054201 Ga0163163_100542013 146
281 3300014326 Ga0157380_10001014 Ga0157380_1000101422 146
282 3300014968 Ga0157379_10056101 Ga0157379_100561012 146
283 3300017792 Ga0163161_10010688 Ga0163161_100106886 146
284 3300017792 Ga0163161_10085478 Ga0163161_100854782 146
285 3300021377 Ga0213874_10101496 Ga0213874_101014962 146
286 3300025893 Ga0207682_10166221 Ga0207682_101662212 146
287 3300025898 Ga0207692_10002849 Ga0207692_100028498 146
288 3300025899 Ga0207642_10000139 Ga0207642_1000013923 146
289 3300025900 Ga0207710_10002206 Ga0207710_100022063 146
290 3300025903 Ga0207680_10143900 Ga0207680_101439002 146
291 3300025903 Ga0207680_10958476 Ga0207680_109584762 146
292 3300025905 Ga0207685_10000650 Ga0207685_100006501 146
293 3300025906 Ga0207699_10007110 Ga0207699_100071102 146
294 3300025907 Ga0207645_10020583 Ga0207645_100205832 146
295 3300025911 Ga0207654_10014458 Ga0207654_100144583 146
296 3300025914 Ga0207671_10758084 Ga0207671_107580841 146
297 3300025915 Ga0207693_10001766 Ga0207693_100017664 146
298 3300025916 Ga0207663_10008198 Ga0207663_100081984 146
299 3300025916 Ga0207663_10660048 Ga0207663_106600482 146
300 3300025918 Ga0207662_10124504 Ga0207662_101245042 146
301 3300025919 Ga0207657_10081839 Ga0207657_100818392 146
302 3300025923 Ga0207681_10076105 Ga0207681_100761053 146
303 3300025923 Ga0207681_10461911 Ga0207681_104619112 146
304 3300025924 Ga0207694_10424950 Ga0207694_104249501 146
305 3300025926 Ga0207659_10347194 Ga0207659_103471942 146
306 3300025927 Ga0207687_10001412 Ga0207687_100014127 146
307 3300025931 Ga0207644_10212765 Ga0207644_102127652 146
308 3300025931 Ga0207644_10946841 Ga0207644_109468412 146
309 3300025932 Ga0207690_10006559 Ga0207690_100065593 146
310 3300025933 Ga0207706_10022538 Ga0207706_100225384 146
311 3300025933 Ga0207706_10032701 Ga0207706_100327012 146
312 3300025934 Ga0207686_10023099 Ga0207686_100230991 146
313 3300025935 Ga0207709_10096854 Ga0207709_100968542 146
314 3300025936 Ga0207670_10549563 Ga0207670_105495632 146
315 3300025937 Ga0207669_10000309 Ga0207669_1000030919 146
316 3300025938 Ga0207704_10001181 Ga0207704_1000118111 146
317 3300025939 Ga0207665_10142955 Ga0207665_101429553 146
318 3300025940 Ga0207691_10478440 Ga0207691_104784402 146
319 3300025941 Ga0207711_10181838 Ga0207711_101818382 146
320 3300025941 Ga0207711_11049900 Ga0207711_110499001 146
321 3300025942 Ga0207689_10081017 Ga0207689_100810172 146
322 3300025949 Ga0207667_10147602 Ga0207667_101476024 146
323 3300025961 Ga0207712_10010987 Ga0207712_100109874 146
324 3300025972 Ga0207668_10008510 Ga0207668_100085103 146
325 3300025972 Ga0207668_10031122 Ga0207668_100311222 146
326 3300025972 Ga0207668_10052936 Ga0207668_100529361 146
327 3300025972 Ga0207668_10541898 Ga0207668_105418982 146
328 3300025981 Ga0207640_10023763 Ga0207640_100237634 146
329 3300025986 Ga0207658_10020251 Ga0207658_100202514 146
330 3300025986 Ga0207658_10058793 Ga0207658_100587932 146
331 3300025986 Ga0207658_10093042 Ga0207658_100930422 146
332 3300025986 Ga0207658_10342726 Ga0207658_103427262 146
333 3300026023 Ga0207677_10028983 Ga0207677_100289834 146
334 3300026023 Ga0207677_10603790 Ga0207677_106037902 146
335 3300026035 Ga0207703_10017861 Ga0207703_100178616 146
336 3300026035 Ga0207703_10129768 Ga0207703_101297682 146
337 3300026035 Ga0207703_10715553 Ga0207703_107155531 146
338 3300026041 Ga0207639_10044961 Ga0207639_100449611 146
339 3300026067 Ga0207678_10074493 Ga0207678_100744933 146
340 3300026075 Ga0207708_10052739 Ga0207708_100527392 146
341 3300026088 Ga0207641_10025990 Ga0207641_100259902 146
342 3300026089 Ga0207648_10000349 Ga0207648_1000034952 146
343 3300026095 Ga0207676_10065324 Ga0207676_100653242 146
344 3300026118 Ga0207675_100002951 Ga0207675_10000295120 146
345 3300026118 Ga0207675_100058062 Ga0207675_1000580625 146
346 3300026121 Ga0207683_10000040 Ga0207683_1000004083 146
347 3300028379 Ga0268266_10003565 Ga0268266_100035654 146
348 3300028380 Ga0268265_10006992 Ga0268265_100069927 146
349 3300028381 Ga0268264_10005904 Ga0268264_100059043 146
350 3300028381 Ga0268264_10389875 Ga0268264_103898752 146
351 3300034957 Ga0373938_0091403 Ga0373938_0091403_95_535 146
352 3300035114 Ga0373939_0247541 Ga0373939_0247541_184_624 146
353 3300035207 Ga0373942_0091757 Ga0373942_0091757_114_554 146
354 3300039450 Ga0436363_0480362 Ga0436363_0480362_343_792 146
355 3300041410 Ga0439461_0010559 Ga0439461_0010559_646_1107 146
356 3300041410 Ga0439461_0019249 Ga0439461_0019249_468_932 146
357 3300041411 Ga0439466_0007613 Ga0439466_0007613_3214_3675 146
358 3300041411 Ga0439466_0033532 Ga0439466_0033532_469_933 146
359 3300041413 Ga0439465_0006345 Ga0439465_0006345_3065_3526 146
360 3300041413 Ga0439465_0058518 Ga0439465_0058518_210_674 146
361 3300044658 Ga0466972_0038651 Ga0466972_0038651_830_1291 146
362 3300044901 Ga0466960_0065796 Ga0466960_0065796_733_1194 146
363 3300048903 Ga0496100_0002195 Ga0496100_0002195_7413_7853 146
364 3300048904 Ga0496101_0006100 Ga0496101_0006100_192_632 146
365 3300048905 Ga0496102_0003228 Ga0496102_0003228_12979_13419 146
366 3300048905 Ga0496102_0004887 Ga0496102_0004887_6429_6899 146
367 3300048906 Ga0496103_0004626 Ga0496103_0004626_2521_2961 146
368 3300048907 Ga0496104_0152211 Ga0496104_0152211_1195_1665 146
369 3300048907 Ga0496104_1559463 Ga0496104_1559463_103_543 146
370 3300048909 Ga0496106_0004173 Ga0496106_0004173_7863_8303 146
371 3300048909 Ga0496106_0111822 Ga0496106_0111822_407_877 146
372 3300048910 Ga0496107_0000718 Ga0496107_0000718_7686_8126 146
373 3300048912 Ga0496109_0180695 Ga0496109_0180695_1022_1492 146
374 3300048912 Ga0496109_0645139 Ga0496109_0645139_92_553 146
375 3300048914 Ga0496111_0038739 Ga0496111_0038739_681_1151 146
376 3300048914 Ga0496111_0586123 Ga0496111_0586123_134_604 146
377 3300048915 Ga0496112_0004850 Ga0496112_0004850_1374_1844 146
378 3300048915 Ga0496112_1258934 Ga0496112_1258934_42_512 146
379 3300048916 Ga0496113_0009031 Ga0496113_0009031_6001_6471 146
380 3300048917 Ga0496114_0064429 Ga0496114_0064429_2494_2934 146
381 3300048918 Ga0496115_0000807 Ga0496115_0000807_14475_14915 146
382 3300048929 Ga0496126_0076043 Ga0496126_0076043_1473_1958 146
383 3300050490 nmdc:mga03n38_177593_c1 nmdc:mga03n38_177593_c1_225_686 146
384 3300050491 nmdc:mga00v17_89937_c1 nmdc:mga00v17_89937_c1_1130_1600 146
385 3300050492 nmdc:mga0yw44_16179_c1 nmdc:mga0yw44_16179_c1_2654_3124 146
386 3300050492 nmdc:mga0yw44_416347_c1 nmdc:mga0yw44_416347_c1_60_503 146
387 3300050494 nmdc:mga06z11_72184_c1 nmdc:mga06z11_72184_c1_926_1396 146
388 3300050496 nmdc:mga07m45_41786_c1 nmdc:mga07m45_41786_c1_1796_2257 146
389 3300050507 nmdc:mga05p37_6127_c2 nmdc:mga05p37_6127_c2_2228_2692 146
390 3300050509 nmdc:mga0qj67_129954_c1 nmdc:mga0qj67_129954_c1_451_912 146
391 3300050509 nmdc:mga0qj67_131045_c1 nmdc:mga0qj67_131045_c1_329_793 146
392 3300050510 nmdc:mga06r32_29170_c1 nmdc:mga06r32_29170_c1_1293_1757 146
393 3300050511 nmdc:mga08y16_696729_c1 nmdc:mga08y16_696729_c1_510_971 146
394 3300050516 nmdc:mga0sz30_1414_c1 nmdc:mga0sz30_1414_c1_2232_2693 146
395 3300050516 nmdc:mga0sz30_4195_c2 nmdc:mga0sz30_4195_c2_1211_1681 146
396 3300050516 nmdc:mga0sz30_63330_c1 nmdc:mga0sz30_63330_c1_791_1252 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

11

150

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9995 7 143
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9711 7 143
8cdj-assembly1.cif.gz_D cand1 b-hairpin++-scf-skp2 cand1 rolling scf engaged 0.443 62 145
8i9w-assembly1.cif.gz_CY cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - dbp10-3 0.3886 13 117
8bhz-assembly1.cif.gz_A-2 the apo-crystal structure of a variant form of the 28-kda schistosoma bovis glutathione transferase in orthorhombic form 0.3682 1 146
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9995 7 143 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9711 7 143 1.25.40.380
af_Q9W1C5_327_407_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5166 62 129 1.25.10.10
af_A0A1D6MC86_145_338_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4556 7 145 1.25.10.10
af_A0A1D6JDC4_716_850_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4483 62 143 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A256WSQ0-F1-model_v4 deleted 1.003 64 144
AF-A0A1A3NPW0-F1-model_v4 Calpastatin 1.001 10 142
AF-A0A7W8RUX6-F1-model_v4 Uncharacterized protein (DUF1810 family) 1.001 6 142
AF-A0A6P2L4H0-F1-model_v4 deleted 1.001 6 140
AF-X7ZDZ6-F1-model_v4 Calpastatin 0.9998 11 144

Feature Viewer

pLDDT pTM Quality
95.04 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map