F433250

General Info

Members Datasets Scaffolds Average Seq Length
395 254 790 159

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10009167|Ga0265314_100091676
Length 173
Sequence MSFSLKVNGKAVTVDVPPDMPLLWVLRDVLELKGTKFGCGIAQCGACTVHLKGAPVRSCSMPISALQGMEITTIEGLSADGTHPVQKAWQEIDVPQCGYCQAGQIMSAAALLANKKNPSDADIDAAMNGNICRCATYNRIRKAIHRAAAIGGASAXXGAGHAPADDAALEATR

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
210 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
211 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
229 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
252 2842694124 Methylopila sp. R-72369 Isolate Unclassified
253 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
254 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 1.52
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 1.01
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10009167 3300031711 Bacteria 8395
2 SwRhRL2b_contig_2381925 2162886007 Bacteria 45817
3 JGI24752J21851_1027691 3300001976 Bacteria 745
4 Ga0058861_11352708 3300004800 Bacteria 683
5 Ga0065704_10070189 3300005289 Bacteria 114786
6 Ga0070676_10057815 3300005328 Bacteria 2296
7 Ga0070683_100022225 3300005329 Bacteria 5667
8 Ga0070690_100108782 3300005330 Bacteria 1847
9 Ga0070670_100721521 3300005331 Bacteria 897
10 Ga0070670_100721995 3300005331 Bacteria 897
11 Ga0068869_100091046 3300005334 Bacteria 2294
12 Ga0068869_100203392 3300005334 Bacteria 1562
13 Ga0070666_10664087 3300005335 Bacteria 763
14 Ga0070680_100046659 3300005336 Bacteria 3525
15 Ga0070682_100002639 3300005337 Bacteria 9906
16 Ga0068868_100199805 3300005338 Bacteria 1666
17 Ga0070660_100127690 3300005339 Bacteria 2033
18 Ga0070689_100047996 3300005340 Bacteria 3292
19 Ga0070687_100010172 3300005343 Bacteria 4056
20 Ga0070687_100207577 3300005343 Bacteria 1191
21 Ga0070661_100001798 3300005344 Bacteria 14878
22 Ga0070668_100527597 3300005347 Bacteria 1025
23 Ga0070668_100710342 3300005347 Bacteria 887
24 Ga0070669_100000983 3300005353 Bacteria 20780
25 Ga0070669_100048493 3300005353 Bacteria 3100
26 Ga0070669_100117367 3300005353 Bacteria 2026
27 Ga0070669_100569591 3300005353 Bacteria 946
28 Ga0070675_100034436 3300005354 Bacteria 4110
29 Ga0070675_100195546 3300005354 Bacteria 1754
30 Ga0070675_100206902 3300005354 Bacteria 1705
31 Ga0070675_100299033 3300005354 Bacteria 1418
32 Ga0070671_100105340 3300005355 Bacteria 2367
33 Ga0070671_100529025 3300005355 Bacteria 1016
34 Ga0070674_100012520 3300005356 Bacteria 5211
35 Ga0070674_100145745 3300005356 Bacteria 1782
36 Ga0070673_100085334 3300005364 Bacteria 2570
37 Ga0070673_100158387 3300005364 Bacteria 1923
38 Ga0070673_100724652 3300005364 Bacteria 914
39 Ga0070688_100029704 3300005365 Bacteria 3275
40 Ga0070688_100254015 3300005365 Bacteria 1253
41 Ga0070688_100806021 3300005365 Bacteria 735
42 Ga0070688_100958526 3300005365 Bacteria 677
43 Ga0070659_100009305 3300005366 Bacteria 7214
44 Ga0070667_100000737 3300005367 Bacteria 31316
45 Ga0070667_100071439 3300005367 Bacteria 2956
46 Ga0070667_100140222 3300005367 Bacteria 2117
47 Ga0070667_100463380 3300005367 Bacteria 1159
48 Ga0070713_100254426 3300005436 Bacteria 1603
49 Ga0070663_100111448 3300005455 Bacteria 2056
50 Ga0070678_100627902 3300005456 Bacteria 962
51 Ga0070662_100085244 3300005457 Bacteria 2361
52 Ga0070662_100620609 3300005457 Bacteria 910
53 Ga0070681_10026117 3300005458 Bacteria 5872
54 Ga0068867_100019425 3300005459 Bacteria 4842
55 Ga0068867_100149793 3300005459 Bacteria 1831
56 Ga0070699_100759455 3300005518 Bacteria 887
57 Ga0070679_100011050 3300005530 Bacteria 8588
58 Ga0070684_100078596 3300005535 Bacteria 2915
59 Ga0068853_100819612 3300005539 Bacteria 892
60 Ga0070672_101580423 3300005543 Bacteria 588
61 Ga0070686_100017715 3300005544 Bacteria 4168
62 Ga0070686_100387129 3300005544 Bacteria 1060
63 Ga0070695_100028656 3300005545 Bacteria 3456
64 Ga0070696_100059243 3300005546 Bacteria 2676
65 Ga0070693_100019656 3300005547 Bacteria 3546
66 Ga0070665_100000686 3300005548 Bacteria 45211
67 Ga0070665_100204310 3300005548 Bacteria 1976
68 Ga0070665_100661097 3300005548 Bacteria 1058
69 Ga0070704_100016649 3300005549 Bacteria 4651
70 Ga0068855_100060851 3300005563 Bacteria 4414
71 Ga0070664_100348584 3300005564 Bacteria 1346
72 Ga0068857_100622225 3300005577 Bacteria 1022
73 Ga0068856_100099661 3300005614 Bacteria 2896
74 Ga0068856_100412192 3300005614 Bacteria 1371
75 Ga0070702_100006190 3300005615 Bacteria 5643
76 Ga0070702_100013511 3300005615 Bacteria 4122
77 Ga0070702_100418995 3300005615 Bacteria 963
78 Ga0068852_101301766 3300005616 Bacteria 748
79 Ga0068859_100034630 3300005617 Bacteria 5068
80 Ga0068859_100044693 3300005617 Bacteria 4450
81 Ga0068859_100136426 3300005617 Bacteria 2526
82 Ga0068864_100005687 3300005618 Bacteria 10219
83 Ga0068864_100210367 3300005618 Bacteria 1791
84 Ga0068864_100608809 3300005618 Bacteria 1061
85 Ga0068866_10035923 3300005718 Bacteria 2424
86 Ga0068861_100019484 3300005719 Bacteria 4846
87 Ga0068870_10103533 3300005840 Bacteria 1613
88 Ga0068863_100000980 3300005841 Bacteria 28685
89 Ga0068863_100033428 3300005841 Bacteria 4899
90 Ga0068858_100208791 3300005842 Bacteria 1848
91 Ga0068860_100001156 3300005843 Bacteria 28867
92 Ga0068860_100006722 3300005843 Bacteria 11537
93 Ga0068860_100031597 3300005843 Bacteria 5089
94 Ga0068860_100364309 3300005843 Bacteria 1425
95 Ga0068862_100042073 3300005844 Bacteria 3890
96 Ga0081539_10259687 3300005985 Bacteria 767
97 Ga0075365_10025964 3300006038 Bacteria 3713
98 Ga0075368_10009188 3300006042 Bacteria 3552
99 Ga0075364_10013045 3300006051 Bacteria 5099
100 Ga0075362_10020129 3300006177 Bacteria 2785
101 Ga0075367_10000316 3300006178 Bacteria 17081
102 Ga0075366_10133140 3300006195 Bacteria 1501
103 Ga0097621_100018759 3300006237 Bacteria 5293
104 Ga0097621_100123385 3300006237 Bacteria 2199
105 Ga0068871_100505572 3300006358 Bacteria 1090
106 Ga0075428_100002558 3300006844 Bacteria 19750
107 Ga0075428_100025730 3300006844 Bacteria 6517
108 Ga0075428_100116776 3300006844 Bacteria 2906
109 Ga0075430_100003971 3300006846 Bacteria 12470
110 Ga0075430_100387901 3300006846 Bacteria 1153
111 Ga0075431_100002364 3300006847 Bacteria 18119
112 Ga0075431_100010176 3300006847 Bacteria 9456
113 Ga0075431_100211432 3300006847 Bacteria 1981
114 Ga0075434_100156481 3300006871 Bacteria 2298
115 Ga0075434_100195676 3300006871 Bacteria 2041
116 Ga0075429_100003953 3300006880 Bacteria 12672
117 Ga0075429_100036097 3300006880 Bacteria 4299
118 Ga0068865_100018079 3300006881 Bacteria 4543
119 Ga0097620_100034624 3300006931 Bacteria 5068
120 Ga0097620_100044696 3300006931 Bacteria 4450
121 Ga0097620_100136423 3300006931 Bacteria 2526
122 Ga0105251_10003303 3300009011 Bacteria 11797
123 Ga0105240_11860834 3300009093 Bacteria 627
124 Ga0111539_10001215 3300009094 Bacteria 34303
125 Ga0111539_10002323 3300009094 Bacteria 25318
126 Ga0111539_10112008 3300009094 Bacteria 3201
127 Ga0111539_10438664 3300009094 Bacteria 1521
128 Ga0111539_11167396 3300009094 Bacteria 895
129 Ga0105245_10029246 3300009098 Bacteria 4867
130 Ga0105245_10152799 3300009098 Bacteria 2184
131 Ga0105245_10187564 3300009098 Bacteria 1979
132 Ga0105245_11987140 3300009098 Bacteria 635
133 Ga0105247_10362171 3300009101 Bacteria 1023
134 Ga0114129_10000532 3300009147 Bacteria 46632
135 Ga0114129_10663863 3300009147 Bacteria 1344
136 Ga0114129_11388387 3300009147 Bacteria 867
137 Ga0105243_10049128 3300009148 Bacteria 3327
138 Ga0105243_10183265 3300009148 Bacteria 1823
139 Ga0105241_10039541 3300009174 Bacteria 3558
140 Ga0105248_10002933 3300009177 Bacteria 18934
141 Ga0105248_10027954 3300009177 Bacteria 6280
142 Ga0105248_10147069 3300009177 Bacteria 2659
143 Ga0105248_10857717 3300009177 Bacteria 1025
144 Ga0105248_11024758 3300009177 Bacteria 932
145 Ga0105237_11264339 3300009545 Bacteria 744
146 Ga0105249_10212945 3300009553 Bacteria 1897
147 Ga0105239_10020606 3300010375 Bacteria 7275
148 Ga0105246_10001421 3300011119 Bacteria 14186
149 Ga0157373_10036655 3300013100 Bacteria 3519
150 Ga0157373_10681800 3300013100 Bacteria 752
151 Ga0157371_10020880 3300013102 Bacteria 4816
152 Ga0157369_10420113 3300013105 Bacteria 1386
153 Ga0157374_10026371 3300013296 Bacteria 5228
154 Ga0157378_10212606 3300013297 Bacteria 1834
155 Ga0157378_10486654 3300013297 Bacteria 1230
156 Ga0157372_10051408 3300013307 Bacteria 4586
157 Ga0157372_10086047 3300013307 Bacteria 3566
158 Ga0157372_10102708 3300013307 Bacteria 3266
159 Ga0157372_10488694 3300013307 Bacteria 1435
160 Ga0157375_10086368 3300013308 Bacteria 3188
161 Ga0157375_10618757 3300013308 Bacteria 1241
162 Ga0157375_10872684 3300013308 Bacteria 1045
163 Ga0163163_10049280 3300014325 Bacteria 4144
164 Ga0163163_10081362 3300014325 Bacteria 3241
165 Ga0163163_10263969 3300014325 Bacteria 1773
166 Ga0163163_10669816 3300014325 Bacteria 1101
167 Ga0163163_11348686 3300014325 Bacteria 775
168 Ga0157380_10060778 3300014326 Bacteria 3021
169 Ga0157377_10042330 3300014745 Bacteria 2529
170 Ga0157377_10052702 3300014745 Bacteria 2298
171 Ga0157379_10166604 3300014968 Bacteria 1989
172 Ga0157379_10200692 3300014968 Bacteria 1804
173 Ga0157376_10009155 3300014969 Bacteria 7181
174 Ga0157376_10494365 3300014969 Bacteria 1201
175 Ga0163161_10652406 3300017792 Bacteria 872
176 Ga0207697_10142666 3300025315 Bacteria 1039
177 Ga0207713_1006239 3300025735 Bacteria 7296
178 Ga0207710_10217277 3300025900 Bacteria 948
179 Ga0207688_10365402 3300025901 Bacteria 891
180 Ga0207680_10124310 3300025903 Bacteria 1691
181 Ga0207647_10097998 3300025904 Bacteria 1743
182 Ga0207647_10219301 3300025904 Bacteria 1097
183 Ga0207647_10518884 3300025904 Bacteria 663
184 Ga0207645_10079181 3300025907 Bacteria 2106
185 Ga0207643_10067887 3300025908 Bacteria 2047
186 Ga0207654_10031002 3300025911 Bacteria 2941
187 Ga0207707_10045838 3300025912 Bacteria 3808
188 Ga0207671_10736711 3300025914 Bacteria 783
189 Ga0207660_10163501 3300025917 Bacteria 1719
190 Ga0207662_10000938 3300025918 Bacteria 13533
191 Ga0207657_10120293 3300025919 Bacteria 2161
192 Ga0207652_10073182 3300025921 Bacteria 2981
193 Ga0207681_10000635 3300025923 Bacteria 23457
194 Ga0207681_10077209 3300025923 Bacteria 2341
195 Ga0207681_10132021 3300025923 Bacteria 1848
196 Ga0207681_10664324 3300025923 Bacteria 865
197 Ga0207694_10401866 3300025924 Bacteria 1139
198 Ga0207650_10002341 3300025925 Bacteria 13193
199 Ga0207650_10007538 3300025925 Bacteria 7419
200 Ga0207659_10068121 3300025926 Bacteria 2588
201 Ga0207659_10121626 3300025926 Bacteria 2001
202 Ga0207687_10140168 3300025927 Bacteria 1834
203 Ga0207700_10688489 3300025928 Bacteria 912
204 Ga0207644_10090235 3300025931 Bacteria 2283
205 Ga0207706_10170683 3300025933 Bacteria 1911
206 Ga0207706_10244970 3300025933 Bacteria 1566
207 Ga0207686_10091394 3300025934 Bacteria 2010
208 Ga0207709_10120234 3300025935 Bacteria 1772
209 Ga0207670_10069819 3300025936 Bacteria 2424
210 Ga0207670_10772493 3300025936 Bacteria 799
211 Ga0207669_11028640 3300025937 Bacteria 693
212 Ga0207704_10020859 3300025938 Bacteria 3476
213 Ga0207691_10005948 3300025940 Bacteria 11784
214 Ga0207691_10130637 3300025940 Bacteria 2219
215 Ga0207711_10069093 3300025941 Bacteria 3061
216 Ga0207711_10473199 3300025941 Bacteria 1167
217 Ga0207689_10032495 3300025942 Bacteria 4341
218 Ga0207689_10055223 3300025942 Bacteria 3269
219 Ga0207689_10313357 3300025942 Bacteria 1301
220 Ga0207661_10003817 3300025944 Bacteria 10503
221 Ga0207679_10001825 3300025945 Bacteria 13268
222 Ga0207679_10617339 3300025945 Bacteria 978
223 Ga0207667_10292393 3300025949 Bacteria 1664
224 Ga0207651_10262895 3300025960 Bacteria 1418
225 Ga0207651_10293455 3300025960 Bacteria 1349
226 Ga0207651_10312503 3300025960 Bacteria 1311
227 Ga0207712_10466001 3300025961 Bacteria 1074
228 Ga0207668_10001649 3300025972 Bacteria 13042
229 Ga0207668_10019983 3300025972 Bacteria 4247
230 Ga0207668_10146253 3300025972 Bacteria 1824
231 Ga0207658_10000358 3300025986 Bacteria 45036
232 Ga0207658_10068047 3300025986 Bacteria 2685
233 Ga0207658_10151828 3300025986 Bacteria 1888
234 Ga0207658_10753449 3300025986 Bacteria 882
235 Ga0207677_10154643 3300026023 Bacteria 1774
236 Ga0207677_10685018 3300026023 Bacteria 908
237 Ga0207703_10119217 3300026035 Bacteria 2263
238 Ga0207703_10275345 3300026035 Bacteria 1526
239 Ga0207639_10448406 3300026041 Bacteria 1171
240 Ga0207639_10740780 3300026041 Bacteria 913
241 Ga0207678_10305641 3300026067 Bacteria 1367
242 Ga0207678_11368890 3300026067 Bacteria 626
243 Ga0207708_10432453 3300026075 Bacteria 1093
244 Ga0207702_10036046 3300026078 Bacteria 4136
245 Ga0207702_10175848 3300026078 Bacteria 1967
246 Ga0207702_10396399 3300026078 Bacteria 1330
247 Ga0207641_10000469 3300026088 Bacteria 45572
248 Ga0207641_10254142 3300026088 Bacteria 1642
249 Ga0207648_10010659 3300026089 Bacteria 8689
250 Ga0207648_10080124 3300026089 Bacteria 2849
251 Ga0207648_12081794 3300026089 Bacteria 528
252 Ga0207676_10252519 3300026095 Bacteria 1588
253 Ga0207676_10305170 3300026095 Bacteria 1455
254 Ga0207676_10832277 3300026095 Bacteria 902
255 Ga0207674_10002535 3300026116 Bacteria 23011
256 Ga0207675_100984616 3300026118 Bacteria 861
257 Ga0207683_10129680 3300026121 Bacteria 2267
258 Ga0207698_10848424 3300026142 Bacteria 918
259 Ga0209813_10008609 3300027866 Bacteria 2584
260 Ga0207428_10000079 3300027907 Bacteria 136472
261 Ga0207428_10004712 3300027907 Bacteria 12899
262 Ga0207428_10076629 3300027907 Bacteria 2618
263 Ga0268266_10000804 3300028379 Bacteria 41628
264 Ga0268266_10191118 3300028379 Bacteria 1869
265 Ga0268265_10054476 3300028380 Bacteria 3035
266 Ga0268265_10075503 3300028380 Bacteria 2640
267 Ga0268265_10914858 3300028380 Bacteria 862
268 Ga0268264_10001282 3300028381 Bacteria 23789
269 Ga0268264_10562219 3300028381 Bacteria 1120
270 Ga0307515_10000716 3300028794 Bacteria 76332
271 Ga0307513_10116315 3300031456 Bacteria 2654
272 Ga0307408_100010475 3300031548 Bacteria 6113
273 Ga0307408_100088160 3300031548 Bacteria 2336
274 Ga0307408_100250752 3300031548 Bacteria 1460
275 Ga0307405_10054432 3300031731 Bacteria 2498
276 Ga0307405_10776881 3300031731 Bacteria 800
277 Ga0307405_11500949 3300031731 Bacteria 592
278 Ga0307410_10260168 3300031852 Bacteria 1353
279 Ga0307407_10940815 3300031903 Bacteria 665
280 Ga0307407_11133839 3300031903 Bacteria 609
281 Ga0307412_10773885 3300031911 Bacteria 831
282 Ga0307412_10869713 3300031911 Bacteria 788
283 Ga0307409_100146969 3300031995 Bacteria 2040
284 Ga0307416_100011084 3300032002 Bacteria 5992
285 Ga0307411_10740184 3300032005 Bacteria 860
286 Ga0307415_100776202 3300032126 Bacteria 872
287 Ga0307415_101220337 3300032126 Bacteria 709
288 Ga0307510_10084182 3300033180 Bacteria 3065
289 Ga0307510_10089539 3300033180 Bacteria 2929
290 Ga0316574_0428105 3300035398 Bacteria 831
291 Ga0316574_0448216 3300035398 Bacteria 809
292 Ga0373931_0008396 3300035691 Bacteria 4897
293 Ga0373937_0822976 3300036401 Bacteria 877
294 Ga0436365_1562404 3300039437 Bacteria 1126
295 Ga0436360_0801113 3300039438 Bacteria 575
296 Ga0451847_0688388 3300041503 Bacteria 1174
297 Ga0451853_0838294 3300041512 Bacteria 1216
298 Ga0439450_030805 3300042008 Bacteria 1205
299 Ga0450889_050766 3300042144 Bacteria 510
300 Ga0439444_0104750 3300042437 Bacteria 645
301 Ga0439464_0000836 3300042439 Bacteria 6807
302 Ga0439460_0043377 3300042461 Bacteria 1329
303 Ga0451577_1558060 3300042876 Bacteria 583
304 Ga0439440_0120221 3300042993 Bacteria 731
305 Ga0466965_0377282 3300044683 Bacteria 780
306 Ga0466970_0001100 3300044765 Bacteria 13106
307 Ga0451576_0147476 3300045051 Bacteria 2453
308 Ga0451576_1858484 3300045051 Bacteria 622
309 Ga0495650_0008000 3300046471 Bacteria 6254
310 Ga0495594_0466845 3300046499 Bacteria 717
311 Ga0495606_0320534 3300046507 Bacteria 833
312 Ga0495643_0067092 3300046522 Bacteria 1891
313 Ga0495588_0152814 3300046674 Bacteria 1220
314 Ga0495670_0235761 3300046691 Bacteria 974
315 Ga0495649_0094605 3300046694 Bacteria 1590
316 Ga0495672_0009508 3300047320 Bacteria 7038
317 Ga0496102_1449267 3300048905 Bacteria 605
318 Ga0496103_0024970 3300048906 Bacteria 3608
319 Ga0496110_0439905 3300048913 Bacteria 1188
320 Ga0496112_0004649 3300048915 Bacteria 11669
321 Ga0496116_0091452 3300048919 Bacteria 1849
322 Ga0496117_0036479 3300048920 Bacteria 3678
323 Ga0496120_0138237 3300048923 Bacteria 1239
324 Ga0496123_0147498 3300048926 Bacteria 1275
325 Ga0496124_0001047 3300048927 Bacteria 43685
326 Ga0496124_0008258 3300048927 Bacteria 10917
327 Ga0496124_0204768 3300048927 Bacteria 1497
328 Ga0496125_0006637 3300048928 Bacteria 12452
329 Ga0496125_0076568 3300048928 Bacteria 2582
330 Ga0496125_0128552 3300048928 Bacteria 1789
331 Ga0496126_0009686 3300048929 Bacteria 10206
332 Ga0496126_0137397 3300048929 Bacteria 2107
333 Ga0501306_078259 3300049127 Bacteria 567
334 Ga0501308_046825 3300049128 Bacteria 624
335 Ga0501308_059219 3300049128 Bacteria 575
336 Ga0495678_142838 3300049459 Bacteria 781
337 Ga0501290_012701 3300049513 Bacteria 1094
338 Ga0501291_001760 3300049514 Bacteria 2535
339 Ga0501312_041022 3300049528 Bacteria 757
340 Ga0501031_0001198 3300049568 Bacteria 15821
341 Ga0501032_0673536 3300049569 Bacteria 656
342 Ga0501033_0770246 3300049570 Bacteria 652
343 Ga0501034_0001099 3300049571 Bacteria 38041
344 Ga0501034_0131869 3300049571 Bacteria 2482
345 Ga0501036_0000924 3300049572 Bacteria 22042
346 Ga0501037_0004936 3300049573 Bacteria 9703
347 Ga0501038_0001262 3300049574 Bacteria 22998
348 Ga0501039_0955438 3300049575 Bacteria 666
349 Ga0501040_0453049 3300049576 Bacteria 924
350 Ga0501043_0002612 3300049579 Bacteria 15193
351 Ga0501046_0000741 3300049580 Bacteria 31610
352 Ga0501047_0004374 3300049581 Bacteria 13295
353 Ga0501047_0176175 3300049581 Bacteria 2006
354 Ga0501048_0040717 3300049582 Bacteria 3328
355 Ga0501070_0105907 3300049586 Bacteria 2325
356 Ga0501073_0000176 3300049589 Bacteria 41996
357 Ga0501074_0128824 3300049590 Bacteria 1811
358 Ga0501207_038160 3300049654 Bacteria 828
359 Ga0501228_001155 3300049666 Bacteria 1866
360 Ga0501080_0006938 3300049742 Bacteria 10219
361 Ga0501035_0002773 3300049822 Bacteria 16962
362 Ga0501044_0007761 3300049823 Bacteria 11796
363 Ga0501045_0343086 3300049824 Bacteria 1112
364 nmdc:mga03683_22538_c1 3300050489 Bacteria 2443
365 nmdc:mga03n38_110865_c1 3300050490 Bacteria 1336
366 nmdc:mga00v17_316749_c1 3300050491 Bacteria 1014
367 nmdc:mga0yw44_25341_c1 3300050492 Bacteria 3371
368 nmdc:mga0k408_117513_c1 3300050493 Bacteria 1574
369 nmdc:mga0k408_1223_c1 3300050493 Bacteria 14078
370 nmdc:mga06z11_1087_c1 3300050494 Bacteria 9902
371 nmdc:mga04h51_25667_c1 3300050495 Bacteria 1816
372 nmdc:mga05p37_1165_c1 3300050507 Bacteria 30287
373 nmdc:mga05p37_203550_c1 3300050507 Bacteria 2396
374 nmdc:mga09592_144122_c1 3300050508 Bacteria 2054
375 nmdc:mga09592_294238_c1 3300050508 Bacteria 1408
376 nmdc:mga0qj67_267289_c1 3300050509 Bacteria 1387
377 nmdc:mga0qj67_558163_c1 3300050509 Bacteria 918
378 nmdc:mga0qj67_6253_c1 3300050509 Bacteria 8738
379 nmdc:mga06r32_511788_c1 3300050510 Bacteria 1177
380 nmdc:mga08y16_2617_c1 3300050511 Bacteria 18486
381 nmdc:mga08y16_327880_c1 3300050511 Bacteria 1575
382 nmdc:mga08y16_346244_c1 3300050511 Bacteria 1527
383 nmdc:mga08y16_488511_c1 3300050511 Bacteria 1252
384 nmdc:mga08y16_717_c1 3300050511 Bacteria 31525
385 nmdc:mga0n895_152766_c1 3300050512 Bacteria 2339
386 nmdc:mga0n895_2091816_c1 3300050512 Bacteria 523
387 nmdc:mga0a205_404256_c1 3300050515 Bacteria 1229
388 nmdc:mga0a205_695518_c1 3300050515 Bacteria 867
389 Ga0500643_000757 3300053087 Bacteria 21048
390 Ga0500608_277274 3300053122 Bacteria 637
391 Ga0587111_0168279 3300060346 Bacteria 601
392 Ga0530510_0528750 3300061734 Bacteria 895
393 2842694842 2842694124 Bacteria 4063419
394 2954012579 2954011201 Bacteria 4762601
395 8054303332 8054302542 Bacteria 5698134
396 Ga0265314_10009167
397 SwRhRL2b_contig_2381925
398 JGI24752J21851_1027691
399 Ga0058861_11352708
400 Ga0065704_10070189
401 Ga0070676_10057815
402 Ga0070683_100022225
403 Ga0070690_100108782
404 Ga0070670_100721521
405 Ga0070670_100721995
406 Ga0068869_100091046
407 Ga0068869_100203392
408 Ga0070666_10664087
409 Ga0070680_100046659
410 Ga0070682_100002639
411 Ga0068868_100199805
412 Ga0070660_100127690
413 Ga0070689_100047996
414 Ga0070687_100010172
415 Ga0070687_100207577
416 Ga0070661_100001798
417 Ga0070668_100527597
418 Ga0070668_100710342
419 Ga0070669_100000983
420 Ga0070669_100048493
421 Ga0070669_100117367
422 Ga0070669_100569591
423 Ga0070675_100034436
424 Ga0070675_100195546
425 Ga0070675_100206902
426 Ga0070675_100299033
427 Ga0070671_100105340
428 Ga0070671_100529025
429 Ga0070674_100012520
430 Ga0070674_100145745
431 Ga0070673_100085334
432 Ga0070673_100158387
433 Ga0070673_100724652
434 Ga0070688_100029704
435 Ga0070688_100254015
436 Ga0070688_100806021
437 Ga0070688_100958526
438 Ga0070659_100009305
439 Ga0070667_100000737
440 Ga0070667_100071439
441 Ga0070667_100140222
442 Ga0070667_100463380
443 Ga0070713_100254426
444 Ga0070663_100111448
445 Ga0070678_100627902
446 Ga0070662_100085244
447 Ga0070662_100620609
448 Ga0070681_10026117
449 Ga0068867_100019425
450 Ga0068867_100149793
451 Ga0070699_100759455
452 Ga0070679_100011050
453 Ga0070684_100078596
454 Ga0068853_100819612
455 Ga0070672_101580423
456 Ga0070686_100017715
457 Ga0070686_100387129
458 Ga0070695_100028656
459 Ga0070696_100059243
460 Ga0070693_100019656
461 Ga0070665_100000686
462 Ga0070665_100204310
463 Ga0070665_100661097
464 Ga0070704_100016649
465 Ga0068855_100060851
466 Ga0070664_100348584
467 Ga0068857_100622225
468 Ga0068856_100099661
469 Ga0068856_100412192
470 Ga0070702_100006190
471 Ga0070702_100013511
472 Ga0070702_100418995
473 Ga0068852_101301766
474 Ga0068859_100034630
475 Ga0068859_100044693
476 Ga0068859_100136426
477 Ga0068864_100005687
478 Ga0068864_100210367
479 Ga0068864_100608809
480 Ga0068866_10035923
481 Ga0068861_100019484
482 Ga0068870_10103533
483 Ga0068863_100000980
484 Ga0068863_100033428
485 Ga0068858_100208791
486 Ga0068860_100001156
487 Ga0068860_100006722
488 Ga0068860_100031597
489 Ga0068860_100364309
490 Ga0068862_100042073
491 Ga0081539_10259687
492 Ga0075365_10025964
493 Ga0075368_10009188
494 Ga0075364_10013045
495 Ga0075362_10020129
496 Ga0075367_10000316
497 Ga0075366_10133140
498 Ga0097621_100018759
499 Ga0097621_100123385
500 Ga0068871_100505572
501 Ga0075428_100002558
502 Ga0075428_100025730
503 Ga0075428_100116776
504 Ga0075430_100003971
505 Ga0075430_100387901
506 Ga0075431_100002364
507 Ga0075431_100010176
508 Ga0075431_100211432
509 Ga0075434_100156481
510 Ga0075434_100195676
511 Ga0075429_100003953
512 Ga0075429_100036097
513 Ga0068865_100018079
514 Ga0097620_100034624
515 Ga0097620_100044696
516 Ga0097620_100136423
517 Ga0105251_10003303
518 Ga0105240_11860834
519 Ga0111539_10001215
520 Ga0111539_10002323
521 Ga0111539_10112008
522 Ga0111539_10438664
523 Ga0111539_11167396
524 Ga0105245_10029246
525 Ga0105245_10152799
526 Ga0105245_10187564
527 Ga0105245_11987140
528 Ga0105247_10362171
529 Ga0114129_10000532
530 Ga0114129_10663863
531 Ga0114129_11388387
532 Ga0105243_10049128
533 Ga0105243_10183265
534 Ga0105241_10039541
535 Ga0105248_10002933
536 Ga0105248_10027954
537 Ga0105248_10147069
538 Ga0105248_10857717
539 Ga0105248_11024758
540 Ga0105237_11264339
541 Ga0105249_10212945
542 Ga0105239_10020606
543 Ga0105246_10001421
544 Ga0157373_10036655
545 Ga0157373_10681800
546 Ga0157371_10020880
547 Ga0157369_10420113
548 Ga0157374_10026371
549 Ga0157378_10212606
550 Ga0157378_10486654
551 Ga0157372_10051408
552 Ga0157372_10086047
553 Ga0157372_10102708
554 Ga0157372_10488694
555 Ga0157375_10086368
556 Ga0157375_10618757
557 Ga0157375_10872684
558 Ga0163163_10049280
559 Ga0163163_10081362
560 Ga0163163_10263969
561 Ga0163163_10669816
562 Ga0163163_11348686
563 Ga0157380_10060778
564 Ga0157377_10042330
565 Ga0157377_10052702
566 Ga0157379_10166604
567 Ga0157379_10200692
568 Ga0157376_10009155
569 Ga0157376_10494365
570 Ga0163161_10652406
571 Ga0207697_10142666
572 Ga0207713_1006239
573 Ga0207710_10217277
574 Ga0207688_10365402
575 Ga0207680_10124310
576 Ga0207647_10097998
577 Ga0207647_10219301
578 Ga0207647_10518884
579 Ga0207645_10079181
580 Ga0207643_10067887
581 Ga0207654_10031002
582 Ga0207707_10045838
583 Ga0207671_10736711
584 Ga0207660_10163501
585 Ga0207662_10000938
586 Ga0207657_10120293
587 Ga0207652_10073182
588 Ga0207681_10000635
589 Ga0207681_10077209
590 Ga0207681_10132021
591 Ga0207681_10664324
592 Ga0207694_10401866
593 Ga0207650_10002341
594 Ga0207650_10007538
595 Ga0207659_10068121
596 Ga0207659_10121626
597 Ga0207687_10140168
598 Ga0207700_10688489
599 Ga0207644_10090235
600 Ga0207706_10170683
601 Ga0207706_10244970
602 Ga0207686_10091394
603 Ga0207709_10120234
604 Ga0207670_10069819
605 Ga0207670_10772493
606 Ga0207669_11028640
607 Ga0207704_10020859
608 Ga0207691_10005948
609 Ga0207691_10130637
610 Ga0207711_10069093
611 Ga0207711_10473199
612 Ga0207689_10032495
613 Ga0207689_10055223
614 Ga0207689_10313357
615 Ga0207661_10003817
616 Ga0207679_10001825
617 Ga0207679_10617339
618 Ga0207667_10292393
619 Ga0207651_10262895
620 Ga0207651_10293455
621 Ga0207651_10312503
622 Ga0207712_10466001
623 Ga0207668_10001649
624 Ga0207668_10019983
625 Ga0207668_10146253
626 Ga0207658_10000358
627 Ga0207658_10068047
628 Ga0207658_10151828
629 Ga0207658_10753449
630 Ga0207677_10154643
631 Ga0207677_10685018
632 Ga0207703_10119217
633 Ga0207703_10275345
634 Ga0207639_10448406
635 Ga0207639_10740780
636 Ga0207678_10305641
637 Ga0207678_11368890
638 Ga0207708_10432453
639 Ga0207702_10036046
640 Ga0207702_10175848
641 Ga0207702_10396399
642 Ga0207641_10000469
643 Ga0207641_10254142
644 Ga0207648_10010659
645 Ga0207648_10080124
646 Ga0207648_12081794
647 Ga0207676_10252519
648 Ga0207676_10305170
649 Ga0207676_10832277
650 Ga0207674_10002535
651 Ga0207675_100984616
652 Ga0207683_10129680
653 Ga0207698_10848424
654 Ga0209813_10008609
655 Ga0207428_10000079
656 Ga0207428_10004712
657 Ga0207428_10076629
658 Ga0268266_10000804
659 Ga0268266_10191118
660 Ga0268265_10054476
661 Ga0268265_10075503
662 Ga0268265_10914858
663 Ga0268264_10001282
664 Ga0268264_10562219
665 Ga0307515_10000716
666 Ga0307513_10116315
667 Ga0307408_100010475
668 Ga0307408_100088160
669 Ga0307408_100250752
670 Ga0307405_10054432
671 Ga0307405_10776881
672 Ga0307405_11500949
673 Ga0307410_10260168
674 Ga0307407_10940815
675 Ga0307407_11133839
676 Ga0307412_10773885
677 Ga0307412_10869713
678 Ga0307409_100146969
679 Ga0307416_100011084
680 Ga0307411_10740184
681 Ga0307415_100776202
682 Ga0307415_101220337
683 Ga0307510_10084182
684 Ga0307510_10089539
685 Ga0316574_0428105
686 Ga0316574_0448216
687 Ga0373931_0008396
688 Ga0373937_0822976
689 Ga0436365_1562404
690 Ga0436360_0801113
691 Ga0451847_0688388
692 Ga0451853_0838294
693 Ga0439450_030805
694 Ga0450889_050766
695 Ga0439444_0104750
696 Ga0439464_0000836
697 Ga0439460_0043377
698 Ga0451577_1558060
699 Ga0439440_0120221
700 Ga0466965_0377282
701 Ga0466970_0001100
702 Ga0451576_0147476
703 Ga0451576_1858484
704 Ga0495650_0008000
705 Ga0495594_0466845
706 Ga0495606_0320534
707 Ga0495643_0067092
708 Ga0495588_0152814
709 Ga0495670_0235761
710 Ga0495649_0094605
711 Ga0495672_0009508
712 Ga0496102_1449267
713 Ga0496103_0024970
714 Ga0496110_0439905
715 Ga0496112_0004649
716 Ga0496116_0091452
717 Ga0496117_0036479
718 Ga0496120_0138237
719 Ga0496123_0147498
720 Ga0496124_0001047
721 Ga0496124_0008258
722 Ga0496124_0204768
723 Ga0496125_0006637
724 Ga0496125_0076568
725 Ga0496125_0128552
726 Ga0496126_0009686
727 Ga0496126_0137397
728 Ga0501306_078259
729 Ga0501308_046825
730 Ga0501308_059219
731 Ga0495678_142838
732 Ga0501290_012701
733 Ga0501291_001760
734 Ga0501312_041022
735 Ga0501031_0001198
736 Ga0501032_0673536
737 Ga0501033_0770246
738 Ga0501034_0001099
739 Ga0501034_0131869
740 Ga0501036_0000924
741 Ga0501037_0004936
742 Ga0501038_0001262
743 Ga0501039_0955438
744 Ga0501040_0453049
745 Ga0501043_0002612
746 Ga0501046_0000741
747 Ga0501047_0004374
748 Ga0501047_0176175
749 Ga0501048_0040717
750 Ga0501070_0105907
751 Ga0501073_0000176
752 Ga0501074_0128824
753 Ga0501207_038160
754 Ga0501228_001155
755 Ga0501080_0006938
756 Ga0501035_0002773
757 Ga0501044_0007761
758 Ga0501045_0343086
759 nmdc:mga03683_22538_c1
760 nmdc:mga03n38_110865_c1
761 nmdc:mga00v17_316749_c1
762 nmdc:mga0yw44_25341_c1
763 nmdc:mga0k408_117513_c1
764 nmdc:mga0k408_1223_c1
765 nmdc:mga06z11_1087_c1
766 nmdc:mga04h51_25667_c1
767 nmdc:mga05p37_1165_c1
768 nmdc:mga05p37_203550_c1
769 nmdc:mga09592_144122_c1
770 nmdc:mga09592_294238_c1
771 nmdc:mga0qj67_267289_c1
772 nmdc:mga0qj67_558163_c1
773 nmdc:mga0qj67_6253_c1
774 nmdc:mga06r32_511788_c1
775 nmdc:mga08y16_2617_c1
776 nmdc:mga08y16_327880_c1
777 nmdc:mga08y16_346244_c1
778 nmdc:mga08y16_488511_c1
779 nmdc:mga08y16_717_c1
780 nmdc:mga0n895_152766_c1
781 nmdc:mga0n895_2091816_c1
782 nmdc:mga0a205_404256_c1
783 nmdc:mga0a205_695518_c1
784 Ga0500643_000757
785 Ga0500608_277274
786 Ga0587111_0168279
787 Ga0530510_0528750
788 2842694842
789 2954012579
790 8054303332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

145

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

5

73

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.7243 2 140
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.7211 1 140
1uwm-assembly1.cif.gz_A reduced ferredoxin 6 from rhodobacter capsulatus 0.7182 1 72
7dqx-assembly1.cif.gz_F crystal structure of xanthine dehydrogenase family protein 0.7165 1 139
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.7154 1 140
ID Description Score Start End Superfamily
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9128 1 71 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9068 1 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8943 1 75 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8929 1 75 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8795 1 73 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A800BKA9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9359 1 75 GO:0051537
AF-A0A6L9J6X1-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9342 1 73 GO:0051537
AF-A0A3S2KEJ2-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9136 1 75 GO:0016903
GO:0051537
AF-A0A7V5NVP3-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.913 1 75 GO:0051537
AF-A0A2P6FP46-F1-model_v4 (2Fe-2S)-binding protein 0.8859 1 79 GO:0051537

Map