F433144

General Info

Members Datasets Scaffolds Average Seq Length
395 161 790 426

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100126489|Ga0070662_1001264891
Length 475
Sequence MTSSDTGDRPESSPAWMINYLPIILWQRRYYVLTCFLVMLALGLAAAFGLPRTYRSTATLLVQSQDLPTTLVESPTNGAVEQRIARIREQVLSRGDLIQLIEQDDLYPKERRSQPLSKIIEKMRHSTAVGALSSDIGQQSGTQNNTIAIAMSFDYPDAGKAQAVLQSFVSKFLTMDSQDVEDQATLTVRFLQDQATKLQTQIAXXEGQLTALKSRNGAALASSGVPAVLDTGSFSAQIAGLQNENRQLLAQSRRGNGNDALSSAEAALAAAQAQYSDTHPDVIAARERVKELRQMSASARPDTTLQDQIAANNAAIRQLMEQRDAAMGRANAAVAGSARAPAILEQAMQLENRVSTLRTQYQQISENLLKAQNSARMATEQRAERLSLVEPANLPDQPFSPNRLQLIAAGAAGGLLLGLLVALGLEFVNRPVRSPRQLEQLDIPVIGLVPLIKTKTQSRPKGLRGLLSREKRLAA

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.54
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 15.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100126489 3300005457 Bacteria 1965
2 JGI24741J21665_1001705 3300001915 Bacteria 6077
3 JGI24740J21852_10002403 3300001979 Bacteria 8507
4 JGI24737J22298_10005369 3300001990 Bacteria 4429
5 JGI24735J21928_10002010 3300002067 Bacteria 7153
6 JGI24735J21928_10005193 3300002067 Bacteria 4331
7 JGI24744J21845_10000630 3300002077 Bacteria 6428
8 Ga0070658_10006874 3300005327 Bacteria 9194
9 Ga0070658_10007081 3300005327 Bacteria 9051
10 Ga0070658_10007726 3300005327 Bacteria 8663
11 Ga0070658_10017983 3300005327 Bacteria 5654
12 Ga0070658_10025215 3300005327 Unclassified 4766
13 Ga0070658_10036091 3300005327 Bacteria 3983
14 Ga0070658_10044916 3300005327 Bacteria 3571
15 Ga0070658_10154925 3300005327 Bacteria 1920
16 Ga0070683_100002629 3300005329 Bacteria 14360
17 Ga0070683_100020068 3300005329 Bacteria 5943
18 Ga0070690_100084593 3300005330 Bacteria 2080
19 Ga0070670_100001961 3300005331 Bacteria 16853
20 Ga0070670_100013946 3300005331 Bacteria 6892
21 Ga0070677_10016640 3300005333 Bacteria 2621
22 Ga0070666_10001302 3300005335 Bacteria 15102
23 Ga0070680_100015094 3300005336 Bacteria 6048
24 Ga0068868_100003463 3300005338 Bacteria 10990
25 Ga0068868_100032055 3300005338 Bacteria 4040
26 Ga0070660_100003869 3300005339 Bacteria 10336
27 Ga0070660_100006193 3300005339 Bacteria 8277
28 Ga0070660_100019162 3300005339 Bacteria 5009
29 Ga0070660_100029227 3300005339 Unclassified 4129
30 Ga0070660_100030635 3300005339 Unclassified 4036
31 Ga0070660_100040329 3300005339 Bacteria 3553
32 Ga0070660_100123847 3300005339 Bacteria 2064
33 Ga0070660_100129840 3300005339 Bacteria 2016
34 Ga0070691_10013440 3300005341 Bacteria 3749
35 Ga0070661_100005291 3300005344 Bacteria 8893
36 Ga0070661_100013143 3300005344 Bacteria 5809
37 Ga0070661_100060349 3300005344 Bacteria 2783
38 Ga0070661_100123614 3300005344 Unclassified 1940
39 Ga0070668_100010859 3300005347 Bacteria 6776
40 Ga0070675_100002093 3300005354 Bacteria 14774
41 Ga0070671_100000585 3300005355 Bacteria 25984
42 Ga0070671_100001443 3300005355 Bacteria 17754
43 Ga0070671_100047290 3300005355 Unclassified 3578
44 Ga0070671_100055112 3300005355 Bacteria 3307
45 Ga0070671_100094987 3300005355 Unclassified 2499
46 Ga0070671_100138427 3300005355 Unclassified 2053
47 Ga0070674_100029659 3300005356 Bacteria 3607
48 Ga0070673_100001113 3300005364 Bacteria 15429
49 Ga0070673_100002199 3300005364 Bacteria 11788
50 Ga0070659_100005596 3300005366 Bacteria 9030
51 Ga0070659_100012286 3300005366 Bacteria 6349
52 Ga0070659_100012487 3300005366 Bacteria 6298
53 Ga0070659_100021733 3300005366 Bacteria 4892
54 Ga0070659_100047592 3300005366 Bacteria 3364
55 Ga0070667_100011143 3300005367 Bacteria 7437
56 Ga0070667_100042020 3300005367 Unclassified 3835
57 Ga0070667_100045587 3300005367 Bacteria 3687
58 Ga0070667_100056368 3300005367 Bacteria 3320
59 Ga0070667_100060864 3300005367 Unclassified 3196
60 Ga0070714_100002190 3300005435 Bacteria 14377
61 Ga0070678_100003931 3300005456 Bacteria 8357
62 Ga0070678_100011216 3300005456 Bacteria 5518
63 Ga0070678_100034156 3300005456 Bacteria 3539
64 Ga0070662_100017163 3300005457 Unclassified 4873
65 Ga0070662_100017466 3300005457 Bacteria 4838
66 Ga0070662_100046932 3300005457 Bacteria 3105
67 Ga0070662_100069094 3300005457 Bacteria 2599
68 Ga0070662_100082929 3300005457 Bacteria 2392
69 Ga0068867_100024122 3300005459 Bacteria 4359
70 Ga0068867_100083385 3300005459 Bacteria 2413
71 Ga0070679_100071472 3300005530 Unclassified 3461
72 Ga0070684_100004092 3300005535 Bacteria 11038
73 Ga0068853_100053206 3300005539 Bacteria 3487
74 Ga0070665_100001865 3300005548 Bacteria 23913
75 Ga0068855_100005824 3300005563 Bacteria 15041
76 Ga0068855_100006659 3300005563 Bacteria 14033
77 Ga0068855_100014977 3300005563 Bacteria 9340
78 Ga0068855_100017060 3300005563 Bacteria 8734
79 Ga0068855_100091341 3300005563 Unclassified 3512
80 Ga0070664_100003503 3300005564 Bacteria 12676
81 Ga0070664_100011435 3300005564 Bacteria 7203
82 Ga0070664_100012603 3300005564 Bacteria 6880
83 Ga0070664_100020715 3300005564 Bacteria 5415
84 Ga0070664_100021899 3300005564 Bacteria 5269
85 Ga0070664_100072273 3300005564 Bacteria 2958
86 Ga0068857_100005367 3300005577 Bacteria 10928
87 Ga0068854_100005714 3300005578 Bacteria 7860
88 Ga0068854_100011868 3300005578 Bacteria 5690
89 Ga0068856_100074992 3300005614 Bacteria 3350
90 Ga0068852_100007810 3300005616 Bacteria 7833
91 Ga0068852_100008650 3300005616 Bacteria 7522
92 Ga0068852_100055678 3300005616 Unclassified 3414
93 Ga0068852_100152063 3300005616 Bacteria 2153
94 Ga0068864_100014870 3300005618 Bacteria 6466
95 Ga0068864_100290228 3300005618 Bacteria 1529
96 Ga0068866_10004286 3300005718 Bacteria 5859
97 Ga0068863_100181792 3300005841 Bacteria 2019
98 Ga0068863_100198439 3300005841 Unclassified 1929
99 Ga0068858_100158228 3300005842 Bacteria 2132
100 Ga0068860_100046428 3300005843 Unclassified 4141
101 Ga0068862_100045117 3300005844 Bacteria 3760
102 Ga0081539_10032737 3300005985 Unclassified 3179
103 Ga0097621_100039548 3300006237 Bacteria 3789
104 Ga0068865_100009762 3300006881 Bacteria 5956
105 Ga0068865_100010945 3300006881 Bacteria 5662
106 Ga0105240_10045600 3300009093 Bacteria 5560
107 Ga0105240_10231671 3300009093 Bacteria 2146
108 Ga0105245_10006582 3300009098 Bacteria 10199
109 Ga0105245_10026618 3300009098 Bacteria 5092
110 Ga0105245_10105808 3300009098 Unclassified 2610
111 Ga0105243_10059570 3300009148 Bacteria 3048
112 Ga0105241_10037309 3300009174 Bacteria 3660
113 Ga0105241_10182325 3300009174 Bacteria 1742
114 Ga0105242_10066374 3300009176 Bacteria 2979
115 Ga0105242_10128942 3300009176 Bacteria 2181
116 Ga0105248_10000864 3300009177 Bacteria 34121
117 Ga0105248_10001731 3300009177 Bacteria 24252
118 Ga0105248_10013859 3300009177 Bacteria 8870
119 Ga0105248_10021840 3300009177 Bacteria 7092
120 Ga0105248_10030620 3300009177 Bacteria 6009
121 Ga0105248_10093113 3300009177 Bacteria 3393
122 Ga0105238_10013299 3300009551 Bacteria 8304
123 Ga0105239_10068875 3300010375 Plasmid 3889
124 Ga0157373_10004072 3300013100 Bacteria 11014
125 Ga0157373_10008312 3300013100 Bacteria 7711
126 Ga0157373_10057171 3300013100 Bacteria 2767
127 Ga0157371_10008598 3300013102 Bacteria 8109
128 Ga0157371_10018990 3300013102 Bacteria 5074
129 Ga0157371_10021331 3300013102 Bacteria 4756
130 Ga0157371_10024427 3300013102 Bacteria 4413
131 Ga0157371_10033332 3300013102 Unclassified 3701
132 Ga0157371_10050388 3300013102 Bacteria 2959
133 Ga0157371_10055071 3300013102 Plasmid 2822
134 Ga0157370_10008977 3300013104 Bacteria 10729
135 Ga0157370_10016993 3300013104 Bacteria 7353
136 Ga0157370_10022730 3300013104 Bacteria 6240
137 Ga0157369_10002126 3300013105 Bacteria 23887
138 Ga0157369_10039305 3300013105 Bacteria 5170
139 Ga0157369_10079594 3300013105 Unclassified 3509
140 Ga0157369_10193520 3300013105 Bacteria 2136
141 Ga0157378_10007867 3300013297 Bacteria 9302
142 Ga0157378_10007999 3300013297 Bacteria 9230
143 Ga0157378_10087846 3300013297 Bacteria 2820
144 Ga0163162_10019694 3300013306 Bacteria 6623
145 Ga0157372_10001798 3300013307 Bacteria 23289
146 Ga0157372_10012759 3300013307 Bacteria 8952
147 Ga0157375_10054613 3300013308 Bacteria 3934
148 Ga0157375_10341901 3300013308 Unclassified 1662
149 Ga0163163_10013953 3300014325 Bacteria 7373
150 Ga0157379_10041194 3300014968 Bacteria 4123
151 Ga0163161_10013190 3300017792 Bacteria 5744
152 Ga0207697_10002640 3300025315 Bacteria 9180
153 Ga0207656_10012603 3300025321 Bacteria 3218
154 Ga0207656_10022167 3300025321 Bacteria 2546
155 Ga0207682_10005198 3300025893 Bacteria 5327
156 Ga0207682_10041014 3300025893 Unclassified 1888
157 Ga0207642_10032462 3300025899 Unclassified 2199
158 Ga0207688_10002725 3300025901 Bacteria 9558
159 Ga0207680_10000843 3300025903 Bacteria 14479
160 Ga0207680_10052784 3300025903 Bacteria 2438
161 Ga0207680_10062973 3300025903 Bacteria 2268
162 Ga0207647_10000652 3300025904 Bacteria 27131
163 Ga0207647_10000953 3300025904 Bacteria 22378
164 Ga0207647_10003821 3300025904 Bacteria 11264
165 Ga0207647_10008914 3300025904 Bacteria 7154
166 Ga0207647_10018812 3300025904 Bacteria 4659
167 Ga0207645_10049594 3300025907 Bacteria 2680
168 Ga0207645_10070580 3300025907 Bacteria 2234
169 Ga0207705_10000387 3300025909 Bacteria 39128
170 Ga0207705_10002376 3300025909 Bacteria 14545
171 Ga0207705_10004357 3300025909 Bacteria 10702
172 Ga0207705_10007452 3300025909 Bacteria 8046
173 Ga0207705_10013606 3300025909 Bacteria 5873
174 Ga0207705_10015198 3300025909 Bacteria 5531
175 Ga0207705_10016676 3300025909 Bacteria 5261
176 Ga0207705_10056195 3300025909 Unclassified 2838
177 Ga0207705_10059912 3300025909 Unclassified 2748
178 Ga0207654_10113157 3300025911 Bacteria 1692
179 Ga0207695_10084758 3300025913 Bacteria 3199
180 Ga0207660_10024656 3300025917 Bacteria 4074
181 Ga0207662_10006219 3300025918 Bacteria 6429
182 Ga0207657_10004145 3300025919 Bacteria 15365
183 Ga0207657_10007353 3300025919 Bacteria 11299
184 Ga0207657_10007984 3300025919 Bacteria 10789
185 Ga0207657_10012093 3300025919 Bacteria 8529
186 Ga0207657_10017538 3300025919 Bacteria 6860
187 Ga0207657_10022416 3300025919 Bacteria 5909
188 Ga0207657_10032686 3300025919 Unclassified 4697
189 Ga0207657_10041650 3300025919 Unclassified 4059
190 Ga0207657_10050002 3300025919 Bacteria 3640
191 Ga0207657_10062697 3300025919 Bacteria 3182
192 Ga0207657_10088046 3300025919 Unclassified 2596
193 Ga0207649_10012070 3300025920 Bacteria 4780
194 Ga0207649_10031782 3300025920 Unclassified 3141
195 Ga0207649_10039230 3300025920 Bacteria 2870
196 Ga0207649_10052452 3300025920 Bacteria 2530
197 Ga0207649_10069007 3300025920 Bacteria 2249
198 Ga0207649_10075096 3300025920 Bacteria 2171
199 Ga0207652_10036935 3300025921 Bacteria 4132
200 Ga0207694_10030974 3300025924 Bacteria 4085
201 Ga0207650_10029377 3300025925 Bacteria 3952
202 Ga0207650_10121817 3300025925 Bacteria 2032
203 Ga0207687_10144803 3300025927 Bacteria 1807
204 Ga0207700_10023556 3300025928 Bacteria 4248
205 Ga0207664_10017766 3300025929 Bacteria 5224
206 Ga0207644_10000110 3300025931 Bacteria 60867
207 Ga0207644_10002394 3300025931 Bacteria 12090
208 Ga0207644_10002765 3300025931 Bacteria 11299
209 Ga0207644_10013186 3300025931 Bacteria 5506
210 Ga0207690_10002722 3300025932 Bacteria 10672
211 Ga0207690_10003887 3300025932 Bacteria 8831
212 Ga0207690_10004350 3300025932 Bacteria 8367
213 Ga0207690_10040855 3300025932 Bacteria 3035
214 Ga0207690_10125572 3300025932 Bacteria 1870
215 Ga0207706_10005674 3300025933 Bacteria 11630
216 Ga0207706_10011549 3300025933 Bacteria 8042
217 Ga0207706_10016645 3300025933 Bacteria 6635
218 Ga0207706_10027754 3300025933 Bacteria 5060
219 Ga0207706_10080899 3300025933 Bacteria 2856
220 Ga0207709_10029567 3300025935 Bacteria 3179
221 Ga0207669_10034730 3300025937 Unclassified 2860
222 Ga0207669_10053310 3300025937 Bacteria 2435
223 Ga0207704_10024627 3300025938 Unclassified 3268
224 Ga0207691_10022908 3300025940 Bacteria 5886
225 Ga0207711_10001548 3300025941 Bacteria 21289
226 Ga0207711_10001690 3300025941 Bacteria 20318
227 Ga0207711_10001939 3300025941 Bacteria 18783
228 Ga0207711_10006835 3300025941 Bacteria 9589
229 Ga0207711_10014822 3300025941 Bacteria 6477
230 Ga0207661_10001486 3300025944 Bacteria 15865
231 Ga0207661_10041999 3300025944 Bacteria 3603
232 Ga0207679_10004156 3300025945 Bacteria 8994
233 Ga0207679_10018211 3300025945 Bacteria 4701
234 Ga0207667_10004629 3300025949 Bacteria 16877
235 Ga0207667_10005521 3300025949 Bacteria 15429
236 Ga0207667_10012704 3300025949 Bacteria 9677
237 Ga0207667_10030071 3300025949 Bacteria 5880
238 Ga0207667_10049572 3300025949 Unclassified 4434
239 Ga0207667_10076378 3300025949 Bacteria 3476
240 Ga0207651_10002266 3300025960 Bacteria 9135
241 Ga0207651_10052024 3300025960 Bacteria 2790
242 Ga0207668_10001163 3300025972 Bacteria 15629
243 Ga0207640_10015813 3300025981 Bacteria 4376
244 Ga0207640_10073104 3300025981 Bacteria 2316
245 Ga0207658_10002182 3300025986 Bacteria 14559
246 Ga0207658_10028479 3300025986 Unclassified 3934
247 Ga0207658_10068155 3300025986 Unclassified 2683
248 Ga0207658_10072760 3300025986 Bacteria 2607
249 Ga0207677_10047174 3300026023 Unclassified 2891
250 Ga0207677_10055604 3300026023 Unclassified 2707
251 Ga0207703_10003041 3300026035 Bacteria 14194
252 Ga0207639_10015848 3300026041 Bacteria 5322
253 Ga0207639_10051051 3300026041 Bacteria 3144
254 Ga0207678_10007049 3300026067 Bacteria 9982
255 Ga0207678_10007874 3300026067 Bacteria 9399
256 Ga0207678_10013246 3300026067 Bacteria 7237
257 Ga0207702_10005931 3300026078 Bacteria 10614
258 Ga0207702_10018054 3300026078 Bacteria 5837
259 Ga0207641_10195784 3300026088 Bacteria 1860
260 Ga0207648_10009677 3300026089 Bacteria 9220
261 Ga0207648_10037185 3300026089 Plasmid 4287
262 Ga0207676_10143649 3300026095 Bacteria 2046
263 Ga0207674_10002992 3300026116 Bacteria 20959
264 Ga0207674_10007460 3300026116 Bacteria 12748
265 Ga0207674_10064830 3300026116 Bacteria 3684
266 Ga0207674_10134177 3300026116 Bacteria 2438
267 Ga0207683_10001954 3300026121 Bacteria 18251
268 Ga0207683_10002536 3300026121 Bacteria 15941
269 Ga0207683_10007409 3300026121 Bacteria 9410
270 Ga0207683_10021162 3300026121 Bacteria 5567
271 Ga0207698_10004870 3300026142 Bacteria 8229
272 Ga0207698_10007906 3300026142 Bacteria 6697
273 Ga0207698_10007964 3300026142 Bacteria 6676
274 Ga0207698_10009963 3300026142 Bacteria 6080
275 Ga0207698_10164868 3300026142 Unclassified 1943
276 Ga0207698_10187763 3300026142 Bacteria 1837
277 Ga0268265_10034865 3300028380 Bacteria 3671
278 Ga0307408_100008775 3300031548 Bacteria 6673
279 Ga0307413_10016776 3300031824 Bacteria 3795
280 Ga0307410_10005503 3300031852 Bacteria 6711
281 Ga0307410_10031504 3300031852 Bacteria 3404
282 Ga0307407_10025932 3300031903 Unclassified 3097
283 Ga0307412_10058573 3300031911 Bacteria 2577
284 Ga0307409_100016188 3300031995 Bacteria 4925
285 Ga0307411_10185396 3300032005 Unclassified 1583
286 Ga0307415_100008308 3300032126 Bacteria 5746
287 Ga0307415_100009449 3300032126 Bacteria 5467
288 Ga0307415_100095657 3300032126 Bacteria 2163
289 Ga0373927_0055888 3300035695 Unclassified 2552
290 Ga0373947_0028006 3300035725 Unclassified 3300
291 Ga0395899_0000274 3300037312 Bacteria 67210
292 Ga0395899_0002261 3300037312 Bacteria 15752
293 Ga0395899_0013744 3300037312 Bacteria 6189
294 Ga0395899_0018865 3300037312 Bacteria 5242
295 Ga0395899_0033039 3300037312 Unclassified 3887
296 Ga0395899_0038774 3300037312 Unclassified 3567
297 Ga0395899_0068288 3300037312 Bacteria 2606
298 Ga0395899_0132578 3300037312 Bacteria 1778
299 Ga0395900_0004150 3300037418 Bacteria 15419
300 Ga0395900_0012141 3300037418 Bacteria 8801
301 Ga0395900_0012170 3300037418 Bacteria 8795
302 Ga0395900_0021697 3300037418 Bacteria 6566
303 Ga0395900_0032009 3300037418 Bacteria 5406
304 Ga0395900_0046219 3300037418 Unclassified 4483
305 Ga0395900_0069021 3300037418 Unclassified 3632
306 Ga0395900_0071637 3300037418 Bacteria 3563
307 Ga0395900_0071825 3300037418 Unclassified 3558
308 Ga0395900_0118437 3300037418 Bacteria 2717
309 Ga0395900_0154229 3300037418 Bacteria 2346
310 Ga0395900_0193710 3300037418 Bacteria 2060
311 Ga0395900_0202056 3300037418 Bacteria 2010
312 Ga0395898_0000087 3300037466 Bacteria 239211
313 Ga0395898_0005114 3300037466 Bacteria 14209
314 Ga0395898_0006829 3300037466 Bacteria 12138
315 Ga0395898_0017203 3300037466 Bacteria 7384
316 Ga0395898_0017744 3300037466 Bacteria 7263
317 Ga0395898_0020380 3300037466 Bacteria 6733
318 Ga0395898_0026720 3300037466 Bacteria 5802
319 Ga0395898_0075296 3300037466 Bacteria 3260
320 Ga0395898_0075325 3300037466 Bacteria 3260
321 Ga0395898_0083421 3300037466 Bacteria 3080
322 Ga0395905_0000005 3300037471 Bacteria 557808
323 Ga0395905_0002328 3300037471 Bacteria 21216
324 Ga0395905_0003746 3300037471 Bacteria 16115
325 Ga0395905_0017132 3300037471 Bacteria 6881
326 Ga0395905_0021701 3300037471 Bacteria 6074
327 Ga0395905_0028988 3300037471 Bacteria 5217
328 Ga0395905_0031595 3300037471 Unclassified 4984
329 Ga0395905_0052491 3300037471 Bacteria 3816
330 Ga0395905_0053310 3300037471 Bacteria 3785
331 Ga0395905_0055083 3300037471 Bacteria 3722
332 Ga0395905_0055245 3300037471 Unclassified 3716
333 Ga0395905_0127980 3300037471 Bacteria 2388
334 Ga0395905_0134841 3300037471 Bacteria 2322
335 Ga0395905_0180015 3300037471 Bacteria 1984
336 Ga0395905_0180035 3300037471 Unclassified 1984
337 Ga0395905_0224333 3300037471 Bacteria 1758
338 Ga0395901_0001391 3300038443 Bacteria 25281
339 Ga0395901_0003881 3300038443 Bacteria 15029
340 Ga0395901_0005012 3300038443 Bacteria 13368
341 Ga0395901_0012026 3300038443 Bacteria 8780
342 Ga0395901_0012920 3300038443 Bacteria 8471
343 Ga0395901_0014443 3300038443 Bacteria 8036
344 Ga0395901_0031335 3300038443 Bacteria 5483
345 Ga0395901_0034344 3300038443 Bacteria 5237
346 Ga0395901_0054510 3300038443 Bacteria 4155
347 Ga0395901_0062179 3300038443 Bacteria 3886
348 Ga0395901_0094539 3300038443 Bacteria 3131
349 Ga0436365_0736792 3300039437 Bacteria 14837
350 Ga0439448_0003296 3300042005 Bacteria 4464
351 Ga0439458_0000082 3300042157 Bacteria 17715
352 Ga0466969_0065282 3300044656 Unclassified 1760
353 Ga0466972_0006850 3300044658 Bacteria 5718
354 Ga0466966_0020728 3300044684 Unclassified 4320
355 Ga0466966_0046861 3300044684 Bacteria 2758
356 Ga0466966_0061094 3300044684 Bacteria 2378
357 Ga0466961_0017556 3300044693 Bacteria 4598
358 Ga0466961_0057319 3300044693 Unclassified 2480
359 Ga0466963_0030074 3300044694 Unclassified 3501
360 Ga0466963_0040784 3300044694 Bacteria 3043
361 Ga0466971_0012442 3300044719 Bacteria 3730
362 Ga0466970_0009215 3300044765 Unclassified 4981
363 Ga0466957_0019065 3300044842 Unclassified 4034
364 Ga0466957_0085087 3300044842 Bacteria 1974
365 Ga0466960_0088014 3300044901 Unclassified 1578
366 Ga0466959_0007425 3300045049 Bacteria 7689
367 Ga0466959_0022708 3300045049 Bacteria 4639
368 Ga0466959_0031093 3300045049 Unclassified 3951
369 Ga0466959_0039781 3300045049 Bacteria 3475
370 Ga0466958_0051943 3300045836 Bacteria 2483
371 Ga0466958_0093804 3300045836 Bacteria 1859
372 Ga0466967_0057628 3300045976 Bacteria 3430
373 Ga0466967_0064179 3300045976 Unclassified 3265
374 Ga0466967_0087753 3300045976 Bacteria 2821
375 Ga0466967_0137659 3300045976 Bacteria 2272
376 Ga0495643_0035170 3300046522 Bacteria 2760
377 Ga0495669_0000706 3300046684 Bacteria 14559
378 Ga0496100_0001297 3300048903 Bacteria 12196
379 Ga0496101_0010923 3300048904 Bacteria 6010
380 Ga0496102_0013872 3300048905 Bacteria 6992
381 Ga0496106_0020047 3300048909 Bacteria 4959
382 Ga0496107_0085004 3300048910 Bacteria 2309
383 Ga0496108_0004915 3300048911 Bacteria 10796
384 Ga0496108_0058796 3300048911 Unclassified 3232
385 Ga0496109_0011392 3300048912 Bacteria 7642
386 Ga0496110_0001671 3300048913 Bacteria 16272
387 Ga0496111_0039329 3300048914 Bacteria 3390
388 Ga0496111_0051863 3300048914 Bacteria 2962
389 Ga0496112_0065076 3300048915 Unclassified 3598
390 Ga0496113_0028606 3300048916 Unclassified 4011
391 Ga0496114_0000006 3300048917 Bacteria 472921
392 Ga0496117_0021876 3300048920 Bacteria 5153
393 Ga0496118_0003914 3300048921 Bacteria 18229
394 Ga0501249_004235 3300049679 Unclassified 2910
395 Ga0466962_0033578 3300061719 Bacteria 2455
396 Ga0070662_100126489
397 JGI24741J21665_1001705
398 JGI24740J21852_10002403
399 JGI24737J22298_10005369
400 JGI24735J21928_10002010
401 JGI24735J21928_10005193
402 JGI24744J21845_10000630
403 Ga0070658_10006874
404 Ga0070658_10007081
405 Ga0070658_10007726
406 Ga0070658_10017983
407 Ga0070658_10025215
408 Ga0070658_10036091
409 Ga0070658_10044916
410 Ga0070658_10154925
411 Ga0070683_100002629
412 Ga0070683_100020068
413 Ga0070690_100084593
414 Ga0070670_100001961
415 Ga0070670_100013946
416 Ga0070677_10016640
417 Ga0070666_10001302
418 Ga0070680_100015094
419 Ga0068868_100003463
420 Ga0068868_100032055
421 Ga0070660_100003869
422 Ga0070660_100006193
423 Ga0070660_100019162
424 Ga0070660_100029227
425 Ga0070660_100030635
426 Ga0070660_100040329
427 Ga0070660_100123847
428 Ga0070660_100129840
429 Ga0070691_10013440
430 Ga0070661_100005291
431 Ga0070661_100013143
432 Ga0070661_100060349
433 Ga0070661_100123614
434 Ga0070668_100010859
435 Ga0070675_100002093
436 Ga0070671_100000585
437 Ga0070671_100001443
438 Ga0070671_100047290
439 Ga0070671_100055112
440 Ga0070671_100094987
441 Ga0070671_100138427
442 Ga0070674_100029659
443 Ga0070673_100001113
444 Ga0070673_100002199
445 Ga0070659_100005596
446 Ga0070659_100012286
447 Ga0070659_100012487
448 Ga0070659_100021733
449 Ga0070659_100047592
450 Ga0070667_100011143
451 Ga0070667_100042020
452 Ga0070667_100045587
453 Ga0070667_100056368
454 Ga0070667_100060864
455 Ga0070714_100002190
456 Ga0070678_100003931
457 Ga0070678_100011216
458 Ga0070678_100034156
459 Ga0070662_100017163
460 Ga0070662_100017466
461 Ga0070662_100046932
462 Ga0070662_100069094
463 Ga0070662_100082929
464 Ga0068867_100024122
465 Ga0068867_100083385
466 Ga0070679_100071472
467 Ga0070684_100004092
468 Ga0068853_100053206
469 Ga0070665_100001865
470 Ga0068855_100005824
471 Ga0068855_100006659
472 Ga0068855_100014977
473 Ga0068855_100017060
474 Ga0068855_100091341
475 Ga0070664_100003503
476 Ga0070664_100011435
477 Ga0070664_100012603
478 Ga0070664_100020715
479 Ga0070664_100021899
480 Ga0070664_100072273
481 Ga0068857_100005367
482 Ga0068854_100005714
483 Ga0068854_100011868
484 Ga0068856_100074992
485 Ga0068852_100007810
486 Ga0068852_100008650
487 Ga0068852_100055678
488 Ga0068852_100152063
489 Ga0068864_100014870
490 Ga0068864_100290228
491 Ga0068866_10004286
492 Ga0068863_100181792
493 Ga0068863_100198439
494 Ga0068858_100158228
495 Ga0068860_100046428
496 Ga0068862_100045117
497 Ga0081539_10032737
498 Ga0097621_100039548
499 Ga0068865_100009762
500 Ga0068865_100010945
501 Ga0105240_10045600
502 Ga0105240_10231671
503 Ga0105245_10006582
504 Ga0105245_10026618
505 Ga0105245_10105808
506 Ga0105243_10059570
507 Ga0105241_10037309
508 Ga0105241_10182325
509 Ga0105242_10066374
510 Ga0105242_10128942
511 Ga0105248_10000864
512 Ga0105248_10001731
513 Ga0105248_10013859
514 Ga0105248_10021840
515 Ga0105248_10030620
516 Ga0105248_10093113
517 Ga0105238_10013299
518 Ga0105239_10068875
519 Ga0157373_10004072
520 Ga0157373_10008312
521 Ga0157373_10057171
522 Ga0157371_10008598
523 Ga0157371_10018990
524 Ga0157371_10021331
525 Ga0157371_10024427
526 Ga0157371_10033332
527 Ga0157371_10050388
528 Ga0157371_10055071
529 Ga0157370_10008977
530 Ga0157370_10016993
531 Ga0157370_10022730
532 Ga0157369_10002126
533 Ga0157369_10039305
534 Ga0157369_10079594
535 Ga0157369_10193520
536 Ga0157378_10007867
537 Ga0157378_10007999
538 Ga0157378_10087846
539 Ga0163162_10019694
540 Ga0157372_10001798
541 Ga0157372_10012759
542 Ga0157375_10054613
543 Ga0157375_10341901
544 Ga0163163_10013953
545 Ga0157379_10041194
546 Ga0163161_10013190
547 Ga0207697_10002640
548 Ga0207656_10012603
549 Ga0207656_10022167
550 Ga0207682_10005198
551 Ga0207682_10041014
552 Ga0207642_10032462
553 Ga0207688_10002725
554 Ga0207680_10000843
555 Ga0207680_10052784
556 Ga0207680_10062973
557 Ga0207647_10000652
558 Ga0207647_10000953
559 Ga0207647_10003821
560 Ga0207647_10008914
561 Ga0207647_10018812
562 Ga0207645_10049594
563 Ga0207645_10070580
564 Ga0207705_10000387
565 Ga0207705_10002376
566 Ga0207705_10004357
567 Ga0207705_10007452
568 Ga0207705_10013606
569 Ga0207705_10015198
570 Ga0207705_10016676
571 Ga0207705_10056195
572 Ga0207705_10059912
573 Ga0207654_10113157
574 Ga0207695_10084758
575 Ga0207660_10024656
576 Ga0207662_10006219
577 Ga0207657_10004145
578 Ga0207657_10007353
579 Ga0207657_10007984
580 Ga0207657_10012093
581 Ga0207657_10017538
582 Ga0207657_10022416
583 Ga0207657_10032686
584 Ga0207657_10041650
585 Ga0207657_10050002
586 Ga0207657_10062697
587 Ga0207657_10088046
588 Ga0207649_10012070
589 Ga0207649_10031782
590 Ga0207649_10039230
591 Ga0207649_10052452
592 Ga0207649_10069007
593 Ga0207649_10075096
594 Ga0207652_10036935
595 Ga0207694_10030974
596 Ga0207650_10029377
597 Ga0207650_10121817
598 Ga0207687_10144803
599 Ga0207700_10023556
600 Ga0207664_10017766
601 Ga0207644_10000110
602 Ga0207644_10002394
603 Ga0207644_10002765
604 Ga0207644_10013186
605 Ga0207690_10002722
606 Ga0207690_10003887
607 Ga0207690_10004350
608 Ga0207690_10040855
609 Ga0207690_10125572
610 Ga0207706_10005674
611 Ga0207706_10011549
612 Ga0207706_10016645
613 Ga0207706_10027754
614 Ga0207706_10080899
615 Ga0207709_10029567
616 Ga0207669_10034730
617 Ga0207669_10053310
618 Ga0207704_10024627
619 Ga0207691_10022908
620 Ga0207711_10001548
621 Ga0207711_10001690
622 Ga0207711_10001939
623 Ga0207711_10006835
624 Ga0207711_10014822
625 Ga0207661_10001486
626 Ga0207661_10041999
627 Ga0207679_10004156
628 Ga0207679_10018211
629 Ga0207667_10004629
630 Ga0207667_10005521
631 Ga0207667_10012704
632 Ga0207667_10030071
633 Ga0207667_10049572
634 Ga0207667_10076378
635 Ga0207651_10002266
636 Ga0207651_10052024
637 Ga0207668_10001163
638 Ga0207640_10015813
639 Ga0207640_10073104
640 Ga0207658_10002182
641 Ga0207658_10028479
642 Ga0207658_10068155
643 Ga0207658_10072760
644 Ga0207677_10047174
645 Ga0207677_10055604
646 Ga0207703_10003041
647 Ga0207639_10015848
648 Ga0207639_10051051
649 Ga0207678_10007049
650 Ga0207678_10007874
651 Ga0207678_10013246
652 Ga0207702_10005931
653 Ga0207702_10018054
654 Ga0207641_10195784
655 Ga0207648_10009677
656 Ga0207648_10037185
657 Ga0207676_10143649
658 Ga0207674_10002992
659 Ga0207674_10007460
660 Ga0207674_10064830
661 Ga0207674_10134177
662 Ga0207683_10001954
663 Ga0207683_10002536
664 Ga0207683_10007409
665 Ga0207683_10021162
666 Ga0207698_10004870
667 Ga0207698_10007906
668 Ga0207698_10007964
669 Ga0207698_10009963
670 Ga0207698_10164868
671 Ga0207698_10187763
672 Ga0268265_10034865
673 Ga0307408_100008775
674 Ga0307413_10016776
675 Ga0307410_10005503
676 Ga0307410_10031504
677 Ga0307407_10025932
678 Ga0307412_10058573
679 Ga0307409_100016188
680 Ga0307411_10185396
681 Ga0307415_100008308
682 Ga0307415_100009449
683 Ga0307415_100095657
684 Ga0373927_0055888
685 Ga0373947_0028006
686 Ga0395899_0000274
687 Ga0395899_0002261
688 Ga0395899_0013744
689 Ga0395899_0018865
690 Ga0395899_0033039
691 Ga0395899_0038774
692 Ga0395899_0068288
693 Ga0395899_0132578
694 Ga0395900_0004150
695 Ga0395900_0012141
696 Ga0395900_0012170
697 Ga0395900_0021697
698 Ga0395900_0032009
699 Ga0395900_0046219
700 Ga0395900_0069021
701 Ga0395900_0071637
702 Ga0395900_0071825
703 Ga0395900_0118437
704 Ga0395900_0154229
705 Ga0395900_0193710
706 Ga0395900_0202056
707 Ga0395898_0000087
708 Ga0395898_0005114
709 Ga0395898_0006829
710 Ga0395898_0017203
711 Ga0395898_0017744
712 Ga0395898_0020380
713 Ga0395898_0026720
714 Ga0395898_0075296
715 Ga0395898_0075325
716 Ga0395898_0083421
717 Ga0395905_0000005
718 Ga0395905_0002328
719 Ga0395905_0003746
720 Ga0395905_0017132
721 Ga0395905_0021701
722 Ga0395905_0028988
723 Ga0395905_0031595
724 Ga0395905_0052491
725 Ga0395905_0053310
726 Ga0395905_0055083
727 Ga0395905_0055245
728 Ga0395905_0127980
729 Ga0395905_0134841
730 Ga0395905_0180015
731 Ga0395905_0180035
732 Ga0395905_0224333
733 Ga0395901_0001391
734 Ga0395901_0003881
735 Ga0395901_0005012
736 Ga0395901_0012026
737 Ga0395901_0012920
738 Ga0395901_0014443
739 Ga0395901_0031335
740 Ga0395901_0034344
741 Ga0395901_0054510
742 Ga0395901_0062179
743 Ga0395901_0094539
744 Ga0436365_0736792
745 Ga0439448_0003296
746 Ga0439458_0000082
747 Ga0466969_0065282
748 Ga0466972_0006850
749 Ga0466966_0020728
750 Ga0466966_0046861
751 Ga0466966_0061094
752 Ga0466961_0017556
753 Ga0466961_0057319
754 Ga0466963_0030074
755 Ga0466963_0040784
756 Ga0466971_0012442
757 Ga0466970_0009215
758 Ga0466957_0019065
759 Ga0466957_0085087
760 Ga0466960_0088014
761 Ga0466959_0007425
762 Ga0466959_0022708
763 Ga0466959_0031093
764 Ga0466959_0039781
765 Ga0466958_0051943
766 Ga0466958_0093804
767 Ga0466967_0057628
768 Ga0466967_0064179
769 Ga0466967_0087753
770 Ga0466967_0137659
771 Ga0495643_0035170
772 Ga0495669_0000706
773 Ga0496100_0001297
774 Ga0496101_0010923
775 Ga0496102_0013872
776 Ga0496106_0020047
777 Ga0496107_0085004
778 Ga0496108_0004915
779 Ga0496108_0058796
780 Ga0496109_0011392
781 Ga0496110_0001671
782 Ga0496111_0039329
783 Ga0496111_0051863
784 Ga0496112_0065076
785 Ga0496113_0028606
786 Ga0496114_0000006
787 Ga0496117_0021876
788 Ga0496118_0003914
789 Ga0501249_004235
790 Ga0466962_0033578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map