F433111

General Info

Members Datasets Scaffolds Average Seq Length
395 194 790 204

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10112388|Ga0065715_101123883
Length 213
Sequence MDTRDTGHDVSGIVLAGGLSSRMGTAKALLPFGGVPLITRIVGTLRPLCGELIVVASTEHDLPALPVKVVFDEIAHQGPAGGIYYGLKAARRYASFVTACDSAFLNPLLIAYLVSQLAYHDVVVPHWHGRLQPLHAVYRTSVWPFLAEQLDRGELRTTALFERVRTRTVEEGEILKFDPEGASFFSMNTPEEYAAAVEQWERSRPDRAEAAGR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.27
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 21.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10112388 3300005293 Unclassified 2532
2 MBSR1b_contig_5364888 2162886012 Unclassified 815
3 JGI25406J46586_10028516 3300003203 Unclassified 2126
4 Ga0065707_10010353 3300005295 Unclassified 4100
5 Ga0070683_100515149 3300005329 Bacteria 1143
6 Ga0070690_100106325 3300005330 Bacteria 1866
7 Ga0070670_100182310 3300005331 Bacteria 1823
8 Ga0070670_100927622 3300005331 Unclassified 790
9 Ga0070677_10001078 3300005333 Bacteria 8810
10 Ga0068869_100123766 3300005334 Bacteria 1981
11 Ga0070666_10031384 3300005335 Unclassified 3507
12 Ga0070680_100012234 3300005336 Bacteria 6664
13 Ga0070680_100088551 3300005336 Bacteria 2561
14 Ga0068868_100049272 3300005338 Bacteria 3306
15 Ga0068868_100153368 3300005338 Bacteria 1899
16 Ga0070660_100032929 3300005339 Bacteria 3903
17 Ga0070689_100010408 3300005340 Bacteria 6628
18 Ga0070689_100049207 3300005340 Bacteria 3254
19 Ga0070691_10000385 3300005341 Bacteria 16036
20 Ga0070691_10018154 3300005341 Unclassified 3241
21 Ga0070687_100001756 3300005343 Bacteria 7814
22 Ga0070687_100014130 3300005343 Unclassified 3579
23 Ga0070661_100187392 3300005344 Unclassified 1577
24 Ga0070661_100684412 3300005344 Bacteria 835
25 Ga0070692_10049206 3300005345 Bacteria 2186
26 Ga0070692_10179869 3300005345 Unclassified 1225
27 Ga0070668_100045491 3300005347 Bacteria 3367
28 Ga0070668_100209783 3300005347 Bacteria 1602
29 Ga0070668_100299886 3300005347 Bacteria 1347
30 Ga0070669_100001828 3300005353 Bacteria 15335
31 Ga0070669_100009033 3300005353 Bacteria 7107
32 Ga0070669_100227678 3300005353 Bacteria 1476
33 Ga0070675_100011597 3300005354 Bacteria 6904
34 Ga0070675_100052600 3300005354 Bacteria 3349
35 Ga0070675_100093473 3300005354 Bacteria 2522
36 Ga0070671_100022447 3300005355 Bacteria 5153
37 Ga0070671_100048645 3300005355 Unclassified 3527
38 Ga0070671_100100618 3300005355 Bacteria 2425
39 Ga0070671_100497551 3300005355 Bacteria 1048
40 Ga0070674_100000374 3300005356 Bacteria 22476
41 Ga0070674_100045891 3300005356 Unclassified 2987
42 Ga0070674_100049503 3300005356 Unclassified 2889
43 Ga0070674_100104303 3300005356 Unclassified 2072
44 Ga0070674_100190376 3300005356 Bacteria 1578
45 Ga0070674_100364750 3300005356 Bacteria 1170
46 Ga0070673_100004472 3300005364 Bacteria 8844
47 Ga0070673_100054559 3300005364 Bacteria 3144
48 Ga0070688_100043543 3300005365 Bacteria 2766
49 Ga0070688_100260272 3300005365 Bacteria 1239
50 Ga0070667_100114541 3300005367 Bacteria 2341
51 Ga0070713_100326875 3300005436 Bacteria 1417
52 Ga0070701_10000198 3300005438 Bacteria 18633
53 Ga0070701_10019077 3300005438 Bacteria 3236
54 Ga0070701_10078097 3300005438 Bacteria 1785
55 Ga0070705_101050282 3300005440 Unclassified 664
56 Ga0070700_100081679 3300005441 Unclassified 2089
57 Ga0070694_100064206 3300005444 Bacteria 2513
58 Ga0070694_100147665 3300005444 Bacteria 1714
59 Ga0070694_100509518 3300005444 Unclassified 958
60 Ga0070678_100230009 3300005456 Bacteria 1545
61 Ga0070662_100012147 3300005457 Bacteria 5703
62 Ga0070662_100042343 3300005457 Bacteria 3253
63 Ga0070662_100610881 3300005457 Unclassified 918
64 Ga0070681_10002980 3300005458 Bacteria 15706
65 Ga0070681_10152485 3300005458 Unclassified 2237
66 Ga0068867_100001629 3300005459 Bacteria 15607
67 Ga0068867_100006072 3300005459 Bacteria 8562
68 Ga0068867_100545447 3300005459 Unclassified 1003
69 Ga0068867_100551201 3300005459 Unclassified 999
70 Ga0070707_100397828 3300005468 Bacteria 1337
71 Ga0070698_100149492 3300005471 Bacteria 2284
72 Ga0070699_100011169 3300005518 Bacteria 7762
73 Ga0070699_100013717 3300005518 Bacteria 6973
74 Ga0070699_100031991 3300005518 Bacteria 4543
75 Ga0070679_100041895 3300005530 Bacteria 4558
76 Ga0070684_100005546 3300005535 Bacteria 9684
77 Ga0070684_100032161 3300005535 Bacteria 4470
78 Ga0070697_100426625 3300005536 Bacteria 1153
79 Ga0070672_100026100 3300005543 Bacteria 4342
80 Ga0070672_100029530 3300005543 Bacteria 4113
81 Ga0070672_100058351 3300005543 Bacteria 3033
82 Ga0070672_100108233 3300005543 Bacteria 2263
83 Ga0070672_100361894 3300005543 Viruses 1238
84 Ga0070672_100475014 3300005543 Bacteria 1079
85 Ga0070672_100693653 3300005543 Bacteria 891
86 Ga0070686_100026449 3300005544 Bacteria 3503
87 Ga0070686_100100537 3300005544 Bacteria 1953
88 Ga0070686_100324426 3300005544 Bacteria 1149
89 Ga0070695_100026653 3300005545 Bacteria 3578
90 Ga0070695_100796199 3300005545 Unclassified 757
91 Ga0070696_100023517 3300005546 Unclassified 4189
92 Ga0070693_100107458 3300005547 Bacteria 1710
93 Ga0070693_100343976 3300005547 Bacteria 1019
94 Ga0070665_100458859 3300005548 Bacteria 1284
95 Ga0070704_100001014 3300005549 Bacteria 14398
96 Ga0070704_100012466 3300005549 Bacteria 5254
97 Ga0070704_100083991 3300005549 Bacteria 2352
98 Ga0068855_100004054 3300005563 Bacteria 17872
99 Ga0068855_100063587 3300005563 Unclassified 4306
100 Ga0070664_100447129 3300005564 Bacteria 1186
101 Ga0068857_100000927 3300005577 Bacteria 22223
102 Ga0068857_100005167 3300005577 Bacteria 11098
103 Ga0068857_100119578 3300005577 Bacteria 2371
104 Ga0068854_100129775 3300005578 Bacteria 1923
105 Ga0068854_100286742 3300005578 Bacteria 1327
106 Ga0068854_100732649 3300005578 Unclassified 856
107 Ga0068856_100049654 3300005614 Bacteria 4135
108 Ga0068856_100051255 3300005614 Bacteria 4069
109 Ga0068856_100146304 3300005614 Bacteria 2371
110 Ga0070702_100121590 3300005615 Bacteria 1635
111 Ga0068852_100030268 3300005616 Bacteria 4454
112 Ga0068852_100329718 3300005616 Bacteria 1485
113 Ga0068859_100006345 3300005617 Bacteria 11997
114 Ga0068859_100187766 3300005617 Bacteria 2151
115 Ga0068864_100051901 3300005618 Bacteria 3534
116 Ga0068864_100144211 3300005618 Bacteria 2151
117 Ga0068866_10118524 3300005718 Unclassified 1488
118 Ga0068861_100000772 3300005719 Bacteria 19216
119 Ga0068861_100255907 3300005719 Bacteria 1496
120 Ga0068861_100748341 3300005719 Unclassified 913
121 Ga0068870_10000236 3300005840 Bacteria 20421
122 Ga0068863_100094718 3300005841 Bacteria 2834
123 Ga0068863_100156565 3300005841 Bacteria 2181
124 Ga0068858_100043673 3300005842 Bacteria 4156
125 Ga0068858_100064735 3300005842 Bacteria 3384
126 Ga0068858_100141812 3300005842 Bacteria 2256
127 Ga0068858_100356878 3300005842 Unclassified 1401
128 Ga0068860_100050820 3300005843 Unclassified 3945
129 Ga0068860_100160465 3300005843 Bacteria 2168
130 Ga0068862_100001769 3300005844 Bacteria 19530
131 Ga0068862_100032213 3300005844 Bacteria 4428
132 Ga0068862_100122027 3300005844 Unclassified 2298
133 Ga0068862_100125040 3300005844 Bacteria 2270
134 Ga0068862_100706999 3300005844 Bacteria 977
135 Ga0081539_10000108 3300005985 Bacteria 195322
136 Ga0070715_10373056 3300006163 Bacteria 785
137 Ga0097621_100000963 3300006237 Bacteria 20188
138 Ga0097621_100014625 3300006237 Bacteria 5881
139 Ga0097621_100015169 3300006237 Bacteria 5789
140 Ga0097621_100038252 3300006237 Bacteria 3850
141 Ga0097621_100158088 3300006237 Unclassified 1947
142 Ga0097621_100304097 3300006237 Bacteria 1409
143 Ga0097621_100315855 3300006237 Bacteria 1383
144 Ga0097621_100320161 3300006237 Bacteria 1373
145 Ga0068871_100000913 3300006358 Bacteria 19682
146 Ga0068871_100020107 3300006358 Bacteria 5109
147 Ga0068871_100137526 3300006358 Unclassified 2075
148 Ga0068871_100206395 3300006358 Bacteria 1698
149 Ga0068871_100234251 3300006358 Unclassified 1594
150 Ga0068871_100479791 3300006358 Bacteria 1118
151 Ga0075428_100003438 3300006844 Bacteria 17327
152 Ga0075428_100211421 3300006844 Bacteria 2096
153 Ga0075428_100277957 3300006844 Bacteria 1802
154 Ga0075430_100010100 3300006846 Bacteria 7989
155 Ga0075430_100101436 3300006846 Bacteria 2403
156 Ga0075430_100381671 3300006846 Bacteria 1163
157 Ga0075431_100259725 3300006847 Bacteria 1763
158 Ga0075429_100013866 3300006880 Bacteria 6990
159 Ga0075429_100044062 3300006880 Bacteria 3881
160 Ga0068865_100011307 3300006881 Bacteria 5582
161 Ga0068865_100033510 3300006881 Bacteria 3439
162 Ga0097620_100006345 3300006931 Bacteria 11997
163 Ga0097620_100187767 3300006931 Bacteria 2151
164 Ga0075435_100004994 3300007076 Bacteria 9205
165 Ga0075435_100206887 3300007076 Bacteria 1664
166 Ga0105244_10213392 3300009036 Bacteria 907
167 Ga0105240_10006062 3300009093 Bacteria 17860
168 Ga0105240_10019012 3300009093 Bacteria 9197
169 Ga0111539_10021683 3300009094 Bacteria 7902
170 Ga0111539_10044893 3300009094 Bacteria 5292
171 Ga0111539_10279648 3300009094 Bacteria 1942
172 Ga0105245_10001859 3300009098 Bacteria 19220
173 Ga0105245_10297045 3300009098 Unclassified 1583
174 Ga0105247_10038784 3300009101 Bacteria 2909
175 Ga0114129_10113969 3300009147 Bacteria 3728
176 Ga0105243_10049172 3300009148 Bacteria 3325
177 Ga0105243_10162005 3300009148 Bacteria 1930
178 Ga0105241_10001552 3300009174 Bacteria 17594
179 Ga0105241_10003693 3300009174 Bacteria 11374
180 Ga0105241_10028673 3300009174 Bacteria 4148
181 Ga0105241_10149333 3300009174 Bacteria 1910
182 Ga0105242_10218408 3300009176 Bacteria 1702
183 Ga0105242_11181104 3300009176 Bacteria 783
184 Ga0105248_10010714 3300009177 Bacteria 10120
185 Ga0105248_10028811 3300009177 Bacteria 6189
186 Ga0105248_10052551 3300009177 Unclassified 4572
187 Ga0105248_10387488 3300009177 Bacteria 1573
188 Ga0105237_10003505 3300009545 Bacteria 18620
189 Ga0105238_10013123 3300009551 Bacteria 8361
190 Ga0105238_10273349 3300009551 Unclassified 1670
191 Ga0105238_10710195 3300009551 Bacteria 1018
192 Ga0105249_10166822 3300009553 Bacteria 2132
193 Ga0105249_10475964 3300009553 Bacteria 1291
194 Ga0105249_11324559 3300009553 Bacteria 792
195 Ga0105239_10010389 3300010375 Bacteria 10418
196 Ga0105239_10122173 3300010375 Unclassified 2893
197 Ga0105246_10729772 3300011119 Unclassified 871
198 Ga0105246_11111280 3300011119 Unclassified 722
199 Ga0157371_10434184 3300013102 Bacteria 964
200 Ga0157370_10184131 3300013104 Unclassified 1940
201 Ga0157369_10009513 3300013105 Bacteria 11111
202 Ga0157369_10071271 3300013105 Bacteria 3731
203 Ga0157374_10379339 3300013296 Unclassified 1408
204 Ga0157378_11153802 3300013297 Bacteria 813
205 Ga0163162_10120938 3300013306 Unclassified 2723
206 Ga0163162_10603972 3300013306 Bacteria 1223
207 Ga0157372_10023270 3300013307 Bacteria 6714
208 Ga0157372_10218627 3300013307 Bacteria 2208
209 Ga0157375_11556221 3300013308 Bacteria 781
210 Ga0157375_11880129 3300013308 Unclassified 710
211 Ga0163163_10738274 3300014325 Bacteria 1048
212 Ga0157380_10001973 3300014326 Bacteria 13672
213 Ga0157380_10036422 3300014326 Bacteria 3806
214 Ga0157380_10062443 3300014326 Bacteria 2984
215 Ga0157380_10138444 3300014326 Unclassified 2087
216 Ga0157380_10902967 3300014326 Bacteria 910
217 Ga0157380_11339767 3300014326 Bacteria 764
218 Ga0157379_10083660 3300014968 Bacteria 2860
219 Ga0157376_10337814 3300014969 Bacteria 1437
220 Ga0157376_10798387 3300014969 Unclassified 956
221 Ga0207682_10017252 3300025893 Bacteria 2819
222 Ga0207710_10164707 3300025900 Bacteria 1081
223 Ga0207688_10272333 3300025901 Bacteria 1030
224 Ga0207680_10018468 3300025903 Bacteria 3707
225 Ga0207680_10304121 3300025903 Bacteria 1112
226 Ga0207647_10064258 3300025904 Unclassified 2231
227 Ga0207645_10040152 3300025907 Unclassified 2997
228 Ga0207643_10000463 3300025908 Bacteria 26296
229 Ga0207684_10090435 3300025910 Bacteria 2608
230 Ga0207654_10001341 3300025911 Bacteria 13065
231 Ga0207654_10072643 3300025911 Unclassified 2049
232 Ga0207654_10088610 3300025911 Bacteria 1881
233 Ga0207654_10099446 3300025911 Bacteria 1789
234 Ga0207654_10133383 3300025911 Viruses 1575
235 Ga0207707_10002150 3300025912 Bacteria 17840
236 Ga0207695_10001935 3300025913 Bacteria 32167
237 Ga0207695_10007161 3300025913 Bacteria 14276
238 Ga0207671_10034969 3300025914 Bacteria 3731
239 Ga0207671_10199996 3300025914 Unclassified 1560
240 Ga0207660_10497750 3300025917 Bacteria 989
241 Ga0207662_10002573 3300025918 Bacteria 9139
242 Ga0207662_10089074 3300025918 Bacteria 1896
243 Ga0207657_10038183 3300025919 Bacteria 4279
244 Ga0207652_10001998 3300025921 Bacteria 17628
245 Ga0207646_10054710 3300025922 Bacteria 3569
246 Ga0207646_10068068 3300025922 Bacteria 3180
247 Ga0207681_10032260 3300025923 Bacteria 3428
248 Ga0207681_10033093 3300025923 Bacteria 3388
249 Ga0207681_10036015 3300025923 Bacteria 3263
250 Ga0207681_10161503 3300025923 Bacteria 1689
251 Ga0207694_10003481 3300025924 Bacteria 12518
252 Ga0207694_10056861 3300025924 Unclassified 3039
253 Ga0207694_10167362 3300025924 Unclassified 1778
254 Ga0207659_10069843 3300025926 Bacteria 2560
255 Ga0207659_10467756 3300025926 Unclassified 1064
256 Ga0207687_10004370 3300025927 Bacteria 9433
257 Ga0207687_10042107 3300025927 Unclassified 3139
258 Ga0207687_10043822 3300025927 Bacteria 3085
259 Ga0207687_10103815 3300025927 Unclassified 2097
260 Ga0207687_10258549 3300025927 Bacteria 1387
261 Ga0207644_10013675 3300025931 Bacteria 5417
262 Ga0207644_10276799 3300025931 Bacteria 1346
263 Ga0207644_10499477 3300025931 Unclassified 1003
264 Ga0207706_10013362 3300025933 Bacteria 7469
265 Ga0207706_10127099 3300025933 Unclassified 2241
266 Ga0207706_10168145 3300025933 Unclassified 1927
267 Ga0207706_10610116 3300025933 Unclassified 937
268 Ga0207686_10047962 3300025934 Unclassified 2643
269 Ga0207686_10167940 3300025934 Unclassified 1544
270 Ga0207670_10005253 3300025936 Bacteria 7090
271 Ga0207670_10014546 3300025936 Bacteria 4675
272 Ga0207669_10004095 3300025937 Bacteria 6389
273 Ga0207669_10083852 3300025937 Bacteria 2051
274 Ga0207669_10172116 3300025937 Bacteria 1542
275 Ga0207669_10191633 3300025937 Bacteria 1475
276 Ga0207704_10016481 3300025938 Bacteria 3799
277 Ga0207704_10034736 3300025938 Bacteria 2880
278 Ga0207691_10037245 3300025940 Bacteria 4506
279 Ga0207691_10049263 3300025940 Bacteria 3859
280 Ga0207691_10057698 3300025940 Bacteria 3532
281 Ga0207691_10339535 3300025940 Bacteria 1286
282 Ga0207711_10011094 3300025941 Bacteria 7490
283 Ga0207711_10083249 3300025941 Unclassified 2798
284 Ga0207711_10220632 3300025941 Bacteria 1734
285 Ga0207711_10655575 3300025941 Unclassified 979
286 Ga0207689_10032685 3300025942 Bacteria 4326
287 Ga0207689_10106713 3300025942 Bacteria 2301
288 Ga0207689_10121996 3300025942 Bacteria 2143
289 Ga0207689_10262453 3300025942 Bacteria 1429
290 Ga0207661_10002269 3300025944 Bacteria 13256
291 Ga0207679_10230690 3300025945 Unclassified 1563
292 Ga0207679_10674516 3300025945 Bacteria 936
293 Ga0207667_10002754 3300025949 Bacteria 21729
294 Ga0207667_10012906 3300025949 Bacteria 9597
295 Ga0207651_10094244 3300025960 Bacteria 2201
296 Ga0207651_10489251 3300025960 Bacteria 1062
297 Ga0207651_10546715 3300025960 Bacteria 1006
298 Ga0207712_10060659 3300025961 Bacteria 2682
299 Ga0207712_10866651 3300025961 Unclassified 797
300 Ga0207712_10873074 3300025961 Unclassified 794
301 Ga0207668_10249381 3300025972 Bacteria 1441
302 Ga0207640_10712017 3300025981 Unclassified 862
303 Ga0207658_10179076 3300025986 Bacteria 1753
304 Ga0207677_10109813 3300026023 Unclassified 2051
305 Ga0207677_10202018 3300026023 Bacteria 1580
306 Ga0207703_10041407 3300026035 Bacteria 3690
307 Ga0207703_10131785 3300026035 Bacteria 2160
308 Ga0207703_10197613 3300026035 Bacteria 1785
309 Ga0207703_10278336 3300026035 Unclassified 1519
310 Ga0207708_10015700 3300026075 Bacteria 5682
311 Ga0207708_10023973 3300026075 Bacteria 4614
312 Ga0207708_10079196 3300026075 Bacteria 2524
313 Ga0207708_10190481 3300026075 Bacteria 1632
314 Ga0207708_10287241 3300026075 Bacteria 1334
315 Ga0207708_10443716 3300026075 Unclassified 1080
316 Ga0207702_10060956 3300026078 Bacteria 3216
317 Ga0207702_10196756 3300026078 Bacteria 1866
318 Ga0207641_10168720 3300026088 Bacteria 1996
319 Ga0207641_10232586 3300026088 Bacteria 1714
320 Ga0207648_10000613 3300026089 Bacteria 40018
321 Ga0207648_10011590 3300026089 Bacteria 8301
322 Ga0207648_10087226 3300026089 Unclassified 2723
323 Ga0207648_10584233 3300026089 Bacteria 1028
324 Ga0207676_10228128 3300026095 Bacteria 1663
325 Ga0207676_10496606 3300026095 Bacteria 1158
326 Ga0207674_10000496 3300026116 Bacteria 51908
327 Ga0207674_10002293 3300026116 Bacteria 24259
328 Ga0207674_10021308 3300026116 Bacteria 6983
329 Ga0207674_10041525 3300026116 Bacteria 4756
330 Ga0207675_100001553 3300026118 Bacteria 22992
331 Ga0207675_100070687 3300026118 Bacteria 3262
332 Ga0207675_100635610 3300026118 Bacteria 1072
333 Ga0207675_100666069 3300026118 Unclassified 1048
334 Ga0207683_10062911 3300026121 Unclassified 3269
335 Ga0207683_10070328 3300026121 Bacteria 3092
336 Ga0207683_10209046 3300026121 Bacteria 1776
337 Ga0207698_10021908 3300026142 Bacteria 4429
338 Ga0207698_10054035 3300026142 Unclassified 3088
339 Ga0207698_10461585 3300026142 Unclassified 1228
340 Ga0207428_10004215 3300027907 Bacteria 13765
341 Ga0207428_10048648 3300027907 Bacteria 3400
342 Ga0207428_10320161 3300027907 Bacteria 1145
343 Ga0268265_10000451 3300028380 Bacteria 43515
344 Ga0268265_10037780 3300028380 Bacteria 3546
345 Ga0268265_10068647 3300028380 Unclassified 2750
346 Ga0268265_10536027 3300028380 Bacteria 1109
347 Ga0268264_10114774 3300028381 Bacteria 2365
348 Ga0268264_10194818 3300028381 Bacteria 1850
349 Ga0268264_10635198 3300028381 Bacteria 1055
350 Ga0265313_10007367 3300031595 Bacteria 7539
351 Ga0307405_10052657 3300031731 Bacteria 2532
352 Ga0307413_10425606 3300031824 Bacteria 1047
353 Ga0307409_100270834 3300031995 Bacteria 1564
354 Ga0307416_100112086 3300032002 Bacteria 2407
355 Ga0307416_100187714 3300032002 Bacteria 1945
356 Ga0373951_0047084 3300035091 Unclassified 1053
357 Ga0373924_0281371 3300035410 Bacteria 738
358 Ga0373931_0368083 3300035691 Bacteria 903
359 Ga0373933_0189364 3300035724 Unclassified 1314
360 Ga0436364_1332124 3300037853 Bacteria 10510
361 Ga0436365_0725268 3300039437 Bacteria 2450
362 Ga0451576_0126032 3300045051 Bacteria 2668
363 Ga0451576_0893911 3300045051 Unclassified 932
364 Ga0495651_0101760 3300046462 Bacteria 2138
365 Ga0495594_0006594 3300046499 Bacteria 5973
366 Ga0495628_0113581 3300046516 Unclassified 2082
367 Ga0495667_0325268 3300046559 Unclassified 973
368 Ga0495659_0041303 3300046664 Bacteria 1647
369 Ga0495599_0290649 3300046678 Bacteria 988
370 Ga0495636_0004291 3300047318 Bacteria 5597
371 Ga0496106_0424533 3300048909 Unclassified 1068
372 Ga0496107_0139539 3300048910 Bacteria 1792
373 Ga0496112_0933647 3300048915 Bacteria 789
374 Ga0496114_0099456 3300048917 Bacteria 2481
375 Ga0496115_0237709 3300048918 Unclassified 1502
376 Ga0501042_0114582 3300049578 Bacteria 1941
377 Ga0501046_0258805 3300049580 Bacteria 1279
378 Ga0501070_0343189 3300049586 Bacteria 1213
379 Ga0501076_0065018 3300049592 Bacteria 2908
380 Ga0501076_0112488 3300049592 Unclassified 2202
381 Ga0501076_0565725 3300049592 Bacteria 937
382 Ga0501076_0671654 3300049592 Bacteria 855
383 Ga0501035_0270592 3300049822 Bacteria 1438
384 Ga0501045_0098546 3300049824 Bacteria 2163
385 nmdc:mga05p37_221669_c1 3300050507 Bacteria 2282
386 nmdc:mga09592_176815_c1 3300050508 Bacteria 1846
387 nmdc:mga0qj67_344655_c1 3300050509 Bacteria 1205
388 nmdc:mga0qj67_3722_c1 3300050509 Bacteria 11003
389 nmdc:mga06r32_74606_c1 3300050510 Bacteria 3289
390 nmdc:mga08y16_238259_c1 3300050511 Bacteria 1881
391 nmdc:mga0rr50_30065_c1 3300050513 Unclassified 3841
392 Ga0495601_0299396 3300053077 Unclassified 1048
393 Ga0501084_0036368 3300054114 Bacteria 4113
394 Ga0501082_0072876 3300060353 Bacteria 2958
395 Ga0530510_0559943 3300061734 Bacteria 868
396 Ga0065715_10112388
397 MBSR1b_contig_5364888
398 JGI25406J46586_10028516
399 Ga0065707_10010353
400 Ga0070683_100515149
401 Ga0070690_100106325
402 Ga0070670_100182310
403 Ga0070670_100927622
404 Ga0070677_10001078
405 Ga0068869_100123766
406 Ga0070666_10031384
407 Ga0070680_100012234
408 Ga0070680_100088551
409 Ga0068868_100049272
410 Ga0068868_100153368
411 Ga0070660_100032929
412 Ga0070689_100010408
413 Ga0070689_100049207
414 Ga0070691_10000385
415 Ga0070691_10018154
416 Ga0070687_100001756
417 Ga0070687_100014130
418 Ga0070661_100187392
419 Ga0070661_100684412
420 Ga0070692_10049206
421 Ga0070692_10179869
422 Ga0070668_100045491
423 Ga0070668_100209783
424 Ga0070668_100299886
425 Ga0070669_100001828
426 Ga0070669_100009033
427 Ga0070669_100227678
428 Ga0070675_100011597
429 Ga0070675_100052600
430 Ga0070675_100093473
431 Ga0070671_100022447
432 Ga0070671_100048645
433 Ga0070671_100100618
434 Ga0070671_100497551
435 Ga0070674_100000374
436 Ga0070674_100045891
437 Ga0070674_100049503
438 Ga0070674_100104303
439 Ga0070674_100190376
440 Ga0070674_100364750
441 Ga0070673_100004472
442 Ga0070673_100054559
443 Ga0070688_100043543
444 Ga0070688_100260272
445 Ga0070667_100114541
446 Ga0070713_100326875
447 Ga0070701_10000198
448 Ga0070701_10019077
449 Ga0070701_10078097
450 Ga0070705_101050282
451 Ga0070700_100081679
452 Ga0070694_100064206
453 Ga0070694_100147665
454 Ga0070694_100509518
455 Ga0070678_100230009
456 Ga0070662_100012147
457 Ga0070662_100042343
458 Ga0070662_100610881
459 Ga0070681_10002980
460 Ga0070681_10152485
461 Ga0068867_100001629
462 Ga0068867_100006072
463 Ga0068867_100545447
464 Ga0068867_100551201
465 Ga0070707_100397828
466 Ga0070698_100149492
467 Ga0070699_100011169
468 Ga0070699_100013717
469 Ga0070699_100031991
470 Ga0070679_100041895
471 Ga0070684_100005546
472 Ga0070684_100032161
473 Ga0070697_100426625
474 Ga0070672_100026100
475 Ga0070672_100029530
476 Ga0070672_100058351
477 Ga0070672_100108233
478 Ga0070672_100361894
479 Ga0070672_100475014
480 Ga0070672_100693653
481 Ga0070686_100026449
482 Ga0070686_100100537
483 Ga0070686_100324426
484 Ga0070695_100026653
485 Ga0070695_100796199
486 Ga0070696_100023517
487 Ga0070693_100107458
488 Ga0070693_100343976
489 Ga0070665_100458859
490 Ga0070704_100001014
491 Ga0070704_100012466
492 Ga0070704_100083991
493 Ga0068855_100004054
494 Ga0068855_100063587
495 Ga0070664_100447129
496 Ga0068857_100000927
497 Ga0068857_100005167
498 Ga0068857_100119578
499 Ga0068854_100129775
500 Ga0068854_100286742
501 Ga0068854_100732649
502 Ga0068856_100049654
503 Ga0068856_100051255
504 Ga0068856_100146304
505 Ga0070702_100121590
506 Ga0068852_100030268
507 Ga0068852_100329718
508 Ga0068859_100006345
509 Ga0068859_100187766
510 Ga0068864_100051901
511 Ga0068864_100144211
512 Ga0068866_10118524
513 Ga0068861_100000772
514 Ga0068861_100255907
515 Ga0068861_100748341
516 Ga0068870_10000236
517 Ga0068863_100094718
518 Ga0068863_100156565
519 Ga0068858_100043673
520 Ga0068858_100064735
521 Ga0068858_100141812
522 Ga0068858_100356878
523 Ga0068860_100050820
524 Ga0068860_100160465
525 Ga0068862_100001769
526 Ga0068862_100032213
527 Ga0068862_100122027
528 Ga0068862_100125040
529 Ga0068862_100706999
530 Ga0081539_10000108
531 Ga0070715_10373056
532 Ga0097621_100000963
533 Ga0097621_100014625
534 Ga0097621_100015169
535 Ga0097621_100038252
536 Ga0097621_100158088
537 Ga0097621_100304097
538 Ga0097621_100315855
539 Ga0097621_100320161
540 Ga0068871_100000913
541 Ga0068871_100020107
542 Ga0068871_100137526
543 Ga0068871_100206395
544 Ga0068871_100234251
545 Ga0068871_100479791
546 Ga0075428_100003438
547 Ga0075428_100211421
548 Ga0075428_100277957
549 Ga0075430_100010100
550 Ga0075430_100101436
551 Ga0075430_100381671
552 Ga0075431_100259725
553 Ga0075429_100013866
554 Ga0075429_100044062
555 Ga0068865_100011307
556 Ga0068865_100033510
557 Ga0097620_100006345
558 Ga0097620_100187767
559 Ga0075435_100004994
560 Ga0075435_100206887
561 Ga0105244_10213392
562 Ga0105240_10006062
563 Ga0105240_10019012
564 Ga0111539_10021683
565 Ga0111539_10044893
566 Ga0111539_10279648
567 Ga0105245_10001859
568 Ga0105245_10297045
569 Ga0105247_10038784
570 Ga0114129_10113969
571 Ga0105243_10049172
572 Ga0105243_10162005
573 Ga0105241_10001552
574 Ga0105241_10003693
575 Ga0105241_10028673
576 Ga0105241_10149333
577 Ga0105242_10218408
578 Ga0105242_11181104
579 Ga0105248_10010714
580 Ga0105248_10028811
581 Ga0105248_10052551
582 Ga0105248_10387488
583 Ga0105237_10003505
584 Ga0105238_10013123
585 Ga0105238_10273349
586 Ga0105238_10710195
587 Ga0105249_10166822
588 Ga0105249_10475964
589 Ga0105249_11324559
590 Ga0105239_10010389
591 Ga0105239_10122173
592 Ga0105246_10729772
593 Ga0105246_11111280
594 Ga0157371_10434184
595 Ga0157370_10184131
596 Ga0157369_10009513
597 Ga0157369_10071271
598 Ga0157374_10379339
599 Ga0157378_11153802
600 Ga0163162_10120938
601 Ga0163162_10603972
602 Ga0157372_10023270
603 Ga0157372_10218627
604 Ga0157375_11556221
605 Ga0157375_11880129
606 Ga0163163_10738274
607 Ga0157380_10001973
608 Ga0157380_10036422
609 Ga0157380_10062443
610 Ga0157380_10138444
611 Ga0157380_10902967
612 Ga0157380_11339767
613 Ga0157379_10083660
614 Ga0157376_10337814
615 Ga0157376_10798387
616 Ga0207682_10017252
617 Ga0207710_10164707
618 Ga0207688_10272333
619 Ga0207680_10018468
620 Ga0207680_10304121
621 Ga0207647_10064258
622 Ga0207645_10040152
623 Ga0207643_10000463
624 Ga0207684_10090435
625 Ga0207654_10001341
626 Ga0207654_10072643
627 Ga0207654_10088610
628 Ga0207654_10099446
629 Ga0207654_10133383
630 Ga0207707_10002150
631 Ga0207695_10001935
632 Ga0207695_10007161
633 Ga0207671_10034969
634 Ga0207671_10199996
635 Ga0207660_10497750
636 Ga0207662_10002573
637 Ga0207662_10089074
638 Ga0207657_10038183
639 Ga0207652_10001998
640 Ga0207646_10054710
641 Ga0207646_10068068
642 Ga0207681_10032260
643 Ga0207681_10033093
644 Ga0207681_10036015
645 Ga0207681_10161503
646 Ga0207694_10003481
647 Ga0207694_10056861
648 Ga0207694_10167362
649 Ga0207659_10069843
650 Ga0207659_10467756
651 Ga0207687_10004370
652 Ga0207687_10042107
653 Ga0207687_10043822
654 Ga0207687_10103815
655 Ga0207687_10258549
656 Ga0207644_10013675
657 Ga0207644_10276799
658 Ga0207644_10499477
659 Ga0207706_10013362
660 Ga0207706_10127099
661 Ga0207706_10168145
662 Ga0207706_10610116
663 Ga0207686_10047962
664 Ga0207686_10167940
665 Ga0207670_10005253
666 Ga0207670_10014546
667 Ga0207669_10004095
668 Ga0207669_10083852
669 Ga0207669_10172116
670 Ga0207669_10191633
671 Ga0207704_10016481
672 Ga0207704_10034736
673 Ga0207691_10037245
674 Ga0207691_10049263
675 Ga0207691_10057698
676 Ga0207691_10339535
677 Ga0207711_10011094
678 Ga0207711_10083249
679 Ga0207711_10220632
680 Ga0207711_10655575
681 Ga0207689_10032685
682 Ga0207689_10106713
683 Ga0207689_10121996
684 Ga0207689_10262453
685 Ga0207661_10002269
686 Ga0207679_10230690
687 Ga0207679_10674516
688 Ga0207667_10002754
689 Ga0207667_10012906
690 Ga0207651_10094244
691 Ga0207651_10489251
692 Ga0207651_10546715
693 Ga0207712_10060659
694 Ga0207712_10866651
695 Ga0207712_10873074
696 Ga0207668_10249381
697 Ga0207640_10712017
698 Ga0207658_10179076
699 Ga0207677_10109813
700 Ga0207677_10202018
701 Ga0207703_10041407
702 Ga0207703_10131785
703 Ga0207703_10197613
704 Ga0207703_10278336
705 Ga0207708_10015700
706 Ga0207708_10023973
707 Ga0207708_10079196
708 Ga0207708_10190481
709 Ga0207708_10287241
710 Ga0207708_10443716
711 Ga0207702_10060956
712 Ga0207702_10196756
713 Ga0207641_10168720
714 Ga0207641_10232586
715 Ga0207648_10000613
716 Ga0207648_10011590
717 Ga0207648_10087226
718 Ga0207648_10584233
719 Ga0207676_10228128
720 Ga0207676_10496606
721 Ga0207674_10000496
722 Ga0207674_10002293
723 Ga0207674_10021308
724 Ga0207674_10041525
725 Ga0207675_100001553
726 Ga0207675_100070687
727 Ga0207675_100635610
728 Ga0207675_100666069
729 Ga0207683_10062911
730 Ga0207683_10070328
731 Ga0207683_10209046
732 Ga0207698_10021908
733 Ga0207698_10054035
734 Ga0207698_10461585
735 Ga0207428_10004215
736 Ga0207428_10048648
737 Ga0207428_10320161
738 Ga0268265_10000451
739 Ga0268265_10037780
740 Ga0268265_10068647
741 Ga0268265_10536027
742 Ga0268264_10114774
743 Ga0268264_10194818
744 Ga0268264_10635198
745 Ga0265313_10007367
746 Ga0307405_10052657
747 Ga0307413_10425606
748 Ga0307409_100270834
749 Ga0307416_100112086
750 Ga0307416_100187714
751 Ga0373951_0047084
752 Ga0373924_0281371
753 Ga0373931_0368083
754 Ga0373933_0189364
755 Ga0436364_1332124
756 Ga0436365_0725268
757 Ga0451576_0126032
758 Ga0451576_0893911
759 Ga0495651_0101760
760 Ga0495594_0006594
761 Ga0495628_0113581
762 Ga0495667_0325268
763 Ga0495659_0041303
764 Ga0495599_0290649
765 Ga0495636_0004291
766 Ga0496106_0424533
767 Ga0496107_0139539
768 Ga0496112_0933647
769 Ga0496114_0099456
770 Ga0496115_0237709
771 Ga0501042_0114582
772 Ga0501046_0258805
773 Ga0501070_0343189
774 Ga0501076_0065018
775 Ga0501076_0112488
776 Ga0501076_0565725
777 Ga0501076_0671654
778 Ga0501035_0270592
779 Ga0501045_0098546
780 nmdc:mga05p37_221669_c1
781 nmdc:mga09592_176815_c1
782 nmdc:mga0qj67_344655_c1
783 nmdc:mga0qj67_3722_c1
784 nmdc:mga06r32_74606_c1
785 nmdc:mga08y16_238259_c1
786 nmdc:mga0rr50_30065_c1
787 Ga0495601_0299396
788 Ga0501084_0036368
789 Ga0501082_0072876
790 Ga0530510_0559943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

12

167

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h4e-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8662 11 196
1hjj-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.863 11 196
1e5k-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein moba (protein fa) from escherichia coli at near atomic resolution 0.8622 11 196
1hjl-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8618 11 196
1h4c-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8616 11 196
ID Description Score Start End Superfamily
af_Q59057_8_204_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.915 15 195 3.90.550.10
af_P9WJQ9_9_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9016 11 195 3.90.550.10
1frwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8814 9 196 3.90.550.10
af_P9WJQ9_9_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8742 11 195 3.90.550.10
af_Q2FVY4_1_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.866 12 198 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7Y4U6W5-F1-model_v4 Molybdenum cofactor guanylyltransferase 0.9945 24 203 GO:0005525
GO:0006777
GO:0016779
AF-A0A7Y5WUW1-F1-model_v4 Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9919 11 203 GO:0005525
GO:0005737
GO:0006777
GO:0046872
GO:0070568
AF-A0A3L7MPT6-F1-model_v4 Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9775 11 202 GO:0005525
GO:0005737
GO:0006777
GO:0046872
GO:0061603
AF-A0A831WXB5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobA 0.9772 24 202 GO:0005525
GO:0016779
AF-A0A7C4Y8S1-F1-model_v4 Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9763 11 203 GO:0005525
GO:0005737
GO:0006777
GO:0046872
GO:0061603

Map