F433012

General Info

Members Datasets Scaffolds Average Seq Length
394 199 354 375

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0106454|Ga0495676_0106454_328_1581
Length 417
Sequence MTADALIVGAGIVGAACAAELAALGMRVEVLDAQGIGGGATAAGMGHIVVMNDSPAEFALSRYSRDLWLELAPQLRPRDAFARCGTLWVAADDEEWQAARAMHAAFAAQGVAAQLLDAPALRACEPALAASMTGGLRIEHDSIVYAPTVAEWLLTRSPCAANIRVRLGTTVTTVGASGVTLADGERVGAAHVIVANGLSAQQLVPSLPLQPKKGHLLITDRYPGLIRHQLLELGYIKSAHHAAGTSVAFNAQPRPTGQLLIGSSRQFGTTDPTVEMPVLAQMLQRAAHYLPVLPTLNGIRAWTGFRAASPDGLPLIGPAGEFAPGVWVATGHEGLGVTIDGHRIDVEAGTTVAAALVLAGVHGTRLSVSGQPRAALCGMGVCQECRVTIDGRAHALACQTLCREGQNVHTQDGAGTR

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
3 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
7 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
8 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
9 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
10 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
11 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
12 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
13 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
14 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
15 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
16 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
17 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
18 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
19 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
20 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
21 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
22 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
23 2818991450 Burkholderia sp. 604 Isolate Unclassified
24 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
25 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
26 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
27 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
28 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
29 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
30 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
31 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
32 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
33 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
34 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
35 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
196 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
197 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
198 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
199 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.09
Metatranscriptomes 0.76
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 3.3
Rhizoplane 6.85
Rhizosphere 72.08
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018237 3300001979 Bacteria 2495
2 JGI24739J22299_10039999 3300001989 Bacteria 1567
3 JGI24735J21928_10002617 3300002067 Bacteria 6223
4 JGI24735J21928_10013402 3300002067 Bacteria 2579
5 JGI24735J21928_10016727 3300002067 Bacteria 2272
6 JGI25156J39149_1002119 3300002705 Bacteria 7501
7 rootH1_10023200 3300003316 Bacteria 6420
8 rootH2_10176782 3300003320 Bacteria 1603
9 rootH2_10209170 3300003320 Bacteria 1541
10 rootL2_10064024 3300003322 Bacteria 4609
11 rootH1_10172559 3300003323 Bacteria 2138
12 rootH1_10325670 3300003323 Bacteria 1572
13 JGI25160J50197_1000173 3300003354 Bacteria 55182
14 Ga0055533_1006265 3300003756 Bacteria 1778
15 Ga0065165_1000564 3300005262 Bacteria 55220
16 Ga0070658_10007626 3300005327 Bacteria 8725
17 Ga0070658_10122004 3300005327 Bacteria 2166
18 Ga0070660_100073133 3300005339 Bacteria 2680
19 Ga0070663_100136002 3300005455 Bacteria 1871
20 Ga0070663_100202677 3300005455 Bacteria 1549
21 Ga0068855_100042791 3300005563 Bacteria 5366
22 Ga0068855_100236284 3300005563 Bacteria 2044
23 Ga0105251_10000313 3300009011 Bacteria 48586
24 Ga0105251_10000639 3300009011 Bacteria 32163
25 Ga0105240_10006786 3300009093 Bacteria 16744
26 Ga0105248_10055263 3300009177 Bacteria 4452
27 Ga0105248_10296310 3300009177 Bacteria 1821
28 Ga0105239_10063222 3300010375 Bacteria 4063
29 Ga0157373_10231183 3300013100 Bacteria 1306
30 Ga0157370_10002733 3300013104 Bacteria 21108
31 Ga0157370_10037943 3300013104 Bacteria 4664
32 Ga0157369_10000084 3300013105 Bacteria 130587
33 Ga0157369_10000093 3300013105 Bacteria 122566
34 Ga0157369_10120627 3300013105 Bacteria 2783
35 Ga0157369_10150808 3300013105 Bacteria 2456
36 Ga0157374_10000034 3300013296 Bacteria 180660
37 Ga0163162_10027226 3300013306 Bacteria 5653
38 Ga0157372_10001753 3300013307 Bacteria 23524
39 Ga0157375_10010562 3300013308 Bacteria 8129
40 Ga0182007_10006351 3300015262 Bacteria 5082
41 Ga0183361_10003 3300016635 Bacteria 577277
42 Ga0206356_10376753 3300020070 Bacteria 1315
43 Ga0206354_11028250 3300020081 Bacteria 2683
44 Ga0206353_10436355 3300020082 Bacteria 3495
45 Ga0209674_100029 3300025226 Bacteria 466683
46 Ga0209672_100484 3300025228 Bacteria 22186
47 Ga0209759_1000008 3300025256 Bacteria 461395
48 Ga0209759_1000764 3300025256 Bacteria 27400
49 Ga0209759_1009268 3300025256 Bacteria 2988
50 Ga0209759_1010606 3300025256 Bacteria 2688
51 Ga0209564_1008859 3300025295 Bacteria 4895
52 Ga0207426_1000056 3300025302 Bacteria 373596
53 Ga0207713_1000401 3300025735 Bacteria 46363
54 Ga0207713_1050362 3300025735 Bacteria 1663
55 Ga0207647_10002184 3300025904 Bacteria 14920
56 Ga0207647_10030499 3300025904 Bacteria 3476
57 Ga0207705_10005040 3300025909 Bacteria 9903
58 Ga0207695_10045383 3300025913 Bacteria 4665
59 Ga0207657_10039058 3300025919 Bacteria 4220
60 Ga0207690_10038792 3300025932 Bacteria 3103
61 Ga0207711_10028643 3300025941 Bacteria 4689
62 Ga0207711_10114865 3300025941 Bacteria 2398
63 Ga0207667_10003399 3300025949 Bacteria 19646
64 Ga0207667_10003873 3300025949 Bacteria 18408
65 Ga0207678_10060039 3300026067 Bacteria 3271
66 Ga0207678_10065709 3300026067 Bacteria 3114
67 Ga0207678_10162820 3300026067 Bacteria 1905
68 Ga0207702_10265618 3300026078 Bacteria 1617
69 Ga0268256_1008542 3300030500 Bacteria 3494
70 Ga0307412_10000082 3300031911 Bacteria 93313
71 Ga0395899_0000023 3300037312 Bacteria 367159
72 Ga0395899_0023602 3300037312 Bacteria 4655
73 Ga0395899_0028262 3300037312 Bacteria 4223
74 Ga0395899_0124021 3300037312 Bacteria 1848
75 Ga0395899_0175370 3300037312 Bacteria 1508
76 Ga0395900_0000019 3300037418 Bacteria 357240
77 Ga0395900_0011434 3300037418 Bacteria 9086
78 Ga0395898_0000016 3300037466 Bacteria 435585
79 Ga0395898_0000617 3300037466 Bacteria 65254
80 Ga0395898_0007779 3300037466 Bacteria 11379
81 Ga0395898_0100324 3300037466 Bacteria 2780
82 Ga0395905_0000331 3300037471 Bacteria 67755
83 Ga0395905_0045015 3300037471 Bacteria 4140
84 Ga0395901_0000004 3300038443 Bacteria 657361
85 Ga0395901_0000040 3300038443 Bacteria 204677
86 Ga0395901_0000326 3300038443 Bacteria 58686
87 Ga0395901_0015087 3300038443 Bacteria 7857
88 Ga0395901_0047408 3300038443 Bacteria 4461
89 Ga0466969_0000202 3300044656 Bacteria 32524
90 Ga0466969_0028840 3300044656 Bacteria 2836
91 Ga0466972_0042780 3300044658 Bacteria 2201
92 Ga0466973_0030273 3300044659 Bacteria 5179
93 Ga0466965_0004567 3300044683 Bacteria 6163
94 Ga0466966_0000418 3300044684 Bacteria 27377
95 Ga0466966_0014596 3300044684 Bacteria 5200
96 Ga0466966_0049696 3300044684 Bacteria 2670
97 Ga0466961_0000169 3300044693 Bacteria 44408
98 Ga0466961_0000210 3300044693 Bacteria 39137
99 Ga0466961_0003084 3300044693 Bacteria 10357
100 Ga0466961_0039299 3300044693 Bacteria 3033
101 Ga0466961_0107068 3300044693 Bacteria 1760
102 Ga0466963_0004064 3300044694 Bacteria 8467
103 Ga0466963_0011401 3300044694 Bacteria 5413
104 Ga0466963_0031519 3300044694 Bacteria 3428
105 Ga0466964_0004659 3300044706 Bacteria 5069
106 Ga0466971_0005749 3300044719 Bacteria 5393
107 Ga0466971_0006875 3300044719 Bacteria 4947
108 Ga0466970_0066813 3300044765 Bacteria 1930
109 Ga0466957_0002962 3300044842 Bacteria 9207
110 Ga0466957_0003406 3300044842 Bacteria 8729
111 Ga0466959_0007791 3300045049 Bacteria 7535
112 Ga0466959_0010638 3300045049 Bacteria 6588
113 Ga0466959_0045894 3300045049 Bacteria 3216
114 Ga0466958_0003943 3300045836 Bacteria 7784
115 Ga0466958_0035845 3300045836 Bacteria 2965
116 Ga0466958_0055145 3300045836 Bacteria 2411
117 Ga0466967_0114384 3300045976 Bacteria 2484
118 Ga0495592_0006453 3300046454 Bacteria 8731
119 Ga0495592_0048016 3300046454 Bacteria 3177
120 Ga0495590_0008252 3300046457 Bacteria 3981
121 Ga0495591_007336 3300046458 Bacteria 4705
122 Ga0495629_0000058 3300046459 Bacteria 103431
123 Ga0495629_0000184 3300046459 Bacteria 56265
124 Ga0495629_0009918 3300046459 Bacteria 6950
125 Ga0495629_0012532 3300046459 Bacteria 6139
126 Ga0495629_0014453 3300046459 Bacteria 5678
127 Ga0495638_0002893 3300046460 Bacteria 13726
128 Ga0495641_0026166 3300046461 Bacteria 2851
129 Ga0495651_0002805 3300046462 Bacteria 13515
130 Ga0495651_0023690 3300046462 Bacteria 4773
131 Ga0495651_0072638 3300046462 Bacteria 2613
132 Ga0495653_0000360 3300046463 Bacteria 36850
133 Ga0495653_0003508 3300046463 Bacteria 12624
134 Ga0495653_0023733 3300046463 Bacteria 4950
135 Ga0495653_0045661 3300046463 Bacteria 3396
136 Ga0495650_0000155 3300046471 Bacteria 155947
137 Ga0495650_0006518 3300046471 Bacteria 7254
138 Ga0495650_0007556 3300046471 Bacteria 6510
139 Ga0495650_0029700 3300046471 Bacteria 2488
140 Ga0495580_0000476 3300046472 Bacteria 33380
141 Ga0495580_0004330 3300046472 Bacteria 11915
142 Ga0495580_0004737 3300046472 Bacteria 11389
143 Ga0495580_0013679 3300046472 Bacteria 6184
144 Ga0495580_0025028 3300046472 Bacteria 4364
145 Ga0495580_0176025 3300046472 Bacteria 1478
146 Ga0495582_0014366 3300046473 Bacteria 4353
147 Ga0495582_0055938 3300046473 Bacteria 2174
148 Ga0495582_0067399 3300046473 Bacteria 1978
149 Ga0495605_0002678 3300046474 Bacteria 10910
150 Ga0495605_0008022 3300046474 Bacteria 5977
151 Ga0495639_0064622 3300046475 Bacteria 1682
152 Ga0495662_0009925 3300046476 Bacteria 4677
153 Ga0495662_0037276 3300046476 Bacteria 2348
154 Ga0495664_0041764 3300046477 Bacteria 2714
155 Ga0495664_0081175 3300046477 Bacteria 1944
156 Ga0495664_0093553 3300046477 Bacteria 1808
157 Ga0495664_0179107 3300046477 Bacteria 1285
158 Ga0495596_0001141 3300046500 Bacteria 15617
159 Ga0495607_0000154 3300046501 Bacteria 71955
160 Ga0495607_0055277 3300046501 Bacteria 2284
161 Ga0495583_0003033 3300046506 Bacteria 13382
162 Ga0495606_0007205 3300046507 Bacteria 10026
163 Ga0495606_0106618 3300046507 Bacteria 1696
164 Ga0495608_0007599 3300046511 Bacteria 7643
165 Ga0495608_0008158 3300046511 Bacteria 7355
166 Ga0495608_0125301 3300046511 Bacteria 1646
167 Ga0495608_0157411 3300046511 Bacteria 1445
168 Ga0495610_0002232 3300046512 Bacteria 16388
169 Ga0495618_0003826 3300046514 Bacteria 9312
170 Ga0495618_0005081 3300046514 Bacteria 8039
171 Ga0495618_0006441 3300046514 Bacteria 7127
172 Ga0495628_0006142 3300046516 Bacteria 10504
173 Ga0495628_0006775 3300046516 Bacteria 9967
174 Ga0495628_0013255 3300046516 Bacteria 6933
175 Ga0495628_0074293 3300046516 Bacteria 2648
176 Ga0495630_0003746 3300046517 Bacteria 10609
177 Ga0495630_0016956 3300046517 Bacteria 5330
178 Ga0495648_0008193 3300046524 Bacteria 8247
179 Ga0495648_0036190 3300046524 Bacteria 3189
180 Ga0495648_0057311 3300046524 Bacteria 2338
181 Ga0495648_0064581 3300046524 Bacteria 2155
182 Ga0495648_0085786 3300046524 Bacteria 1777
183 Ga0495666_0007075 3300046526 Bacteria 5639
184 Ga0495666_0027654 3300046526 Bacteria 2791
185 Ga0495642_0007167 3300046528 Bacteria 4280
186 Ga0495642_0007702 3300046528 Bacteria 4126
187 Ga0495652_0010119 3300046529 Bacteria 8553
188 Ga0495652_0064170 3300046529 Bacteria 3089
189 Ga0495652_0112110 3300046529 Bacteria 2192
190 Ga0495652_0143686 3300046529 Bacteria 1873
191 Ga0495665_0018526 3300046531 Bacteria 3740
192 Ga0495665_0033800 3300046531 Bacteria 2734
193 Ga0495640_0023127 3300046533 Bacteria 4536
194 Ga0495640_0036364 3300046533 Bacteria 3479
195 Ga0495586_0037485 3300046535 Bacteria 2603
196 Ga0495587_0012097 3300046536 Bacteria 5448
197 Ga0495597_0003789 3300046542 Bacteria 8606
198 Ga0495597_0034313 3300046542 Bacteria 2293
199 Ga0495645_0000045 3300046543 Bacteria 89793
200 Ga0495645_0049074 3300046543 Bacteria 3074
201 Ga0495645_0104345 3300046543 Bacteria 2013
202 Ga0495634_0004626 3300046642 Bacteria 10738
203 Ga0495634_0030673 3300046642 Bacteria 3710
204 Ga0495635_0010767 3300046663 Bacteria 6408
205 Ga0495635_0024434 3300046663 Bacteria 4211
206 Ga0495635_0025158 3300046663 Bacteria 4147
207 Ga0495661_0013506 3300046665 Bacteria 5483
208 Ga0495599_0001112 3300046678 Bacteria 15150
209 Ga0495599_0011516 3300046678 Bacteria 5435
210 Ga0495599_0033046 3300046678 Bacteria 3250
211 Ga0495599_0063161 3300046678 Bacteria 2313
212 Ga0495623_0010841 3300046679 Bacteria 5900
213 Ga0495623_0050304 3300046679 Bacteria 2639
214 Ga0495623_0052810 3300046679 Bacteria 2567
215 Ga0495646_0006942 3300046680 Bacteria 7186
216 Ga0495646_0021161 3300046680 Bacteria 4112
217 Ga0495646_0031959 3300046680 Bacteria 3277
218 Ga0495646_0042488 3300046680 Bacteria 2789
219 Ga0495669_0007922 3300046684 Bacteria 4460
220 Ga0495613_0003313 3300046689 Bacteria 12059
221 Ga0495613_0026199 3300046689 Bacteria 4344
222 Ga0495613_0026383 3300046689 Bacteria 4328
223 Ga0495624_0000673 3300046690 Bacteria 26743
224 Ga0495624_0004103 3300046690 Bacteria 10715
225 Ga0495624_0008928 3300046690 Bacteria 6968
226 Ga0495624_0024072 3300046690 Bacteria 4008
227 Ga0495624_0055549 3300046690 Bacteria 2493
228 Ga0495624_0064651 3300046690 Bacteria 2286
229 Ga0495670_0012639 3300046691 Bacteria 4152
230 Ga0495671_0025339 3300046692 Bacteria 3084
231 Ga0495649_0004741 3300046694 Bacteria 8820
232 Ga0495649_0028091 3300046694 Bacteria 3118
233 Ga0495649_0040783 3300046694 Bacteria 2540
234 Ga0495649_0108092 3300046694 Bacteria 1476
235 Ga0495589_0015508 3300046794 Bacteria 3919
236 Ga0495589_0052757 3300046794 Bacteria 2008
237 Ga0495581_0006893 3300047315 Bacteria 6586
238 Ga0495581_0007469 3300047315 Bacteria 6324
239 Ga0495581_0033468 3300047315 Bacteria 2975
240 Ga0495604_0003785 3300047317 Bacteria 12037
241 Ga0495604_0012443 3300047317 Bacteria 6767
242 Ga0495604_0012758 3300047317 Bacteria 6689
243 Ga0495604_0016075 3300047317 Bacteria 5977
244 Ga0495604_0062085 3300047317 Bacteria 2856
245 Ga0495674_0009262 3300047319 Bacteria 9357
246 Ga0495674_0011977 3300047319 Bacteria 8179
247 Ga0495674_0018283 3300047319 Bacteria 6527
248 Ga0495674_0048434 3300047319 Bacteria 3761
249 Ga0495674_0093774 3300047319 Bacteria 2561
250 Ga0495674_0105925 3300047319 Bacteria 2388
251 Ga0495672_0031279 3300047320 Bacteria 3324
252 Ga0495672_0052521 3300047320 Bacteria 2393
253 Ga0495676_0012813 3300047321 Bacteria 7541
254 Ga0495676_0014303 3300047321 Bacteria 7102
255 Ga0495676_0106454 3300047321 Bacteria 2066
256 Ga0495680_0026644 3300047322 Bacteria 4761
257 Ga0495680_0032357 3300047322 Bacteria 4246
258 Ga0495680_0046391 3300047322 Bacteria 3426
259 Ga0495683_0004181 3300047323 Bacteria 8247
260 Ga0495683_0010427 3300047323 Bacteria 4912
261 Ga0495683_0017705 3300047323 Bacteria 3690
262 Ga0495683_0019211 3300047323 Bacteria 3527
263 Ga0495683_0021159 3300047323 Bacteria 3352
264 Ga0495683_0078929 3300047323 Bacteria 1608
265 Ga0495687_020218 3300047443 Bacteria 3249
266 Ga0495687_030833 3300047443 Bacteria 2466
267 Ga0495675_0022987 3300047444 Bacteria 3974
268 Ga0495675_0035104 3300047444 Bacteria 3203
269 Ga0495675_0087708 3300047444 Bacteria 1955
270 Ga0495679_000009 3300047446 Bacteria 343637
271 Ga0495679_002026 3300047446 Bacteria 10709
272 Ga0495679_032626 3300047446 Bacteria 1668
273 Ga0495673_0006280 3300047469 Bacteria 7004
274 Ga0495673_0018831 3300047469 Bacteria 3472
275 Ga0495684_0030642 3300047471 Bacteria 4131
276 Ga0495593_0001591 3300047673 Bacteria 13401
277 Ga0495593_0042139 3300047673 Bacteria 2451
278 Ga0495593_0079260 3300047673 Bacteria 1700
279 Ga0495593_0091246 3300047673 Bacteria 1568
280 Ga0495602_0003155 3300048088 Bacteria 16976
281 Ga0495602_0022236 3300048088 Bacteria 6213
282 Ga0495602_0061721 3300048088 Bacteria 3256
283 Ga0495602_0177135 3300048088 Bacteria 1648
284 Ga0495614_0004740 3300048089 Bacteria 6133
285 Ga0495614_0012268 3300048089 Bacteria 3764
286 Ga0495614_0014285 3300048089 Bacteria 3478
287 Ga0495626_0030663 3300048091 Bacteria 2593
288 Ga0495626_0053392 3300048091 Bacteria 1860
289 Ga0496100_0001176 3300048903 Bacteria 12734
290 Ga0496101_0000200 3300048904 Bacteria 46034
291 Ga0496101_0000677 3300048904 Bacteria 20578
292 Ga0496101_0172940 3300048904 Bacteria 1660
293 Ga0496102_0004439 3300048905 Bacteria 11846
294 Ga0496102_0263524 3300048905 Bacteria 1625
295 Ga0496102_0316165 3300048905 Bacteria 1471
296 Ga0496103_0003825 3300048906 Bacteria 9159
297 Ga0496103_0040291 3300048906 Bacteria 2870
298 Ga0496104_0043456 3300048907 Bacteria 4221
299 Ga0496105_0036914 3300048908 Bacteria 4026
300 Ga0496105_0091143 3300048908 Bacteria 2517
301 Ga0496106_0000010 3300048909 Bacteria 232347
302 Ga0496106_0003014 3300048909 Bacteria 12547
303 Ga0496107_0009288 3300048910 Bacteria 6817
304 Ga0496108_0177751 3300048911 Bacteria 1843
305 Ga0496109_0029058 3300048912 Bacteria 4949
306 Ga0496110_0012939 3300048913 Bacteria 6880
307 Ga0496110_0118021 3300048913 Bacteria 2389
308 Ga0496111_0055564 3300048914 Bacteria 2863
309 Ga0496112_0014038 3300048915 Bacteria 7415
310 Ga0496112_0052828 3300048915 Bacteria 3989
311 Ga0496113_0005388 3300048916 Bacteria 7977
312 Ga0496114_0115238 3300048917 Bacteria 2305
313 Ga0496115_0009283 3300048918 Bacteria 7311
314 Ga0496115_0242855 3300048918 Bacteria 1484
315 Ga0496116_0004713 3300048919 Bacteria 12881
316 Ga0496116_0025357 3300048919 Bacteria 4361
317 Ga0496116_0040383 3300048919 Bacteria 3213
318 Ga0496116_0136228 3300048919 Bacteria 1390
319 Ga0496117_0001088 3300048920 Bacteria 41044
320 Ga0496117_0001308 3300048920 Bacteria 36661
321 Ga0496117_0004989 3300048920 Bacteria 14240
322 Ga0496117_0013992 3300048920 Bacteria 6948
323 Ga0496117_0030769 3300048920 Bacteria 4111
324 Ga0496118_0000835 3300048921 Bacteria 48972
325 Ga0496118_0001165 3300048921 Bacteria 40521
326 Ga0496118_0001597 3300048921 Bacteria 33524
327 Ga0496118_0004091 3300048921 Bacteria 17681
328 Ga0496118_0010605 3300048921 Bacteria 9101
329 Ga0496118_0044736 3300048921 Bacteria 3463
330 Ga0496118_0099393 3300048921 Bacteria 1972
331 Ga0496121_0000932 3300048924 Bacteria 52908
332 Ga0496121_0001064 3300048924 Bacteria 48569
333 Ga0496121_0008037 3300048924 Bacteria 12575
334 Ga0496121_0010875 3300048924 Bacteria 10173
335 Ga0496121_0013090 3300048924 Bacteria 8954
336 Ga0496121_0019575 3300048924 Bacteria 6759
337 Ga0496121_0049715 3300048924 Bacteria 3551
338 Ga0496122_0113506 3300048925 Bacteria 1770
339 Ga0496123_0031015 3300048926 Bacteria 3899
340 Ga0496124_0029820 3300048927 Bacteria 4853
341 Ga0496124_0063865 3300048927 Bacteria 3075
342 Ga0496125_0006221 3300048928 Bacteria 12997
343 Ga0496126_0000315 3300048929 Bacteria 102933
344 Ga0496126_0000319 3300048929 Bacteria 102596
345 Ga0496126_0000328 3300048929 Bacteria 101511
346 Ga0496126_0003228 3300048929 Bacteria 20863
347 Ga0496126_0158391 3300048929 Bacteria 1936
348 Ga0495678_024969 3300049459 Bacteria 2573
349 Ga0495678_053771 3300049459 Bacteria 1544
350 Ga0495682_0009025 3300049460 Bacteria 3912
351 Ga0495682_0029664 3300049460 Bacteria 2026
352 Ga0500618_018950 3300053125 Unclassified 1698
353 Ga0466962_0006618 3300061719 Bacteria 5563
354 Ga0466962_0018794 3300061719 Bacteria 3321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0106618 Ga0495606_0106618_660_1667 327
2 3300026067 Ga0207678_10162820 Ga0207678_101628201 344
3 3300048906 Ga0496103_0040291 Ga0496103_0040291_1791_2855 346
4 3300048911 Ga0496108_0177751 Ga0496108_0177751_39_1103 346
5 3300048914 Ga0496111_0055564 Ga0496111_0055564_10_1074 346
6 3300013100 Ga0157373_10231183 Ga0157373_102311832 350
7 3300044765 Ga0466970_0066813 Ga0466970_0066813_20_1075 350
8 3300045976 Ga0466967_0114384 Ga0466967_0114384_565_1692 354
9 3300046794 Ga0495589_0015508 Ga0495589_0015508_34_1101 355
10 3300005327 Ga0070658_10007626 Ga0070658_100076268 358
11 3300005339 Ga0070660_100073133 Ga0070660_1000731332 358
12 3300013104 Ga0157370_10002733 Ga0157370_100027339 358
13 3300025909 Ga0207705_10005040 Ga0207705_100050402 358
14 3300025932 Ga0207690_10038792 Ga0207690_100387924 358
15 3300025949 Ga0207667_10003873 Ga0207667_100038738 358
16 3300005455 Ga0070663_100136002 Ga0070663_1001360023 361
17 3300013306 Ga0163162_10027226 Ga0163162_100272265 361
18 3300013308 Ga0157375_10010562 Ga0157375_100105623 361
19 3300025941 Ga0207711_10114865 Ga0207711_101148652 361
20 3300026067 Ga0207678_10060039 Ga0207678_100600392 361
21 3300046460 Ga0495638_0002893 Ga0495638_0002893_7548_8699 361
22 3300046471 Ga0495650_0029700 Ga0495650_0029700_1261_2412 361
23 3300046474 Ga0495605_0002678 Ga0495605_0002678_6207_7358 361
24 3300046501 Ga0495607_0055277 Ga0495607_0055277_122_1273 361
25 3300046691 Ga0495670_0012639 Ga0495670_0012639_1238_2389 361
26 3300046524 Ga0495648_0008193 Ga0495648_0008193_6132_7229 363
27 3300009177 Ga0105248_10055263 Ga0105248_100552633 364
28 3300003323 rootH1_10325670 rootH1_103256701 365
29 3300053125 Ga0500618_018950 Ga0500618_018950_451_1659 368
30 3300003316 rootH1_10023200 rootH1_100232002 369
31 3300044656 Ga0466969_0000202 Ga0466969_0000202_1117_2247 369
32 3300044659 Ga0466973_0030273 Ga0466973_0030273_2197_3327 369
33 3300044683 Ga0466965_0004567 Ga0466965_0004567_1545_2675 369
34 3300044693 Ga0466961_0000210 Ga0466961_0000210_31368_32498 369
35 3300044694 Ga0466963_0031519 Ga0466963_0031519_707_1837 369
36 3300044719 Ga0466971_0006875 Ga0466971_0006875_2006_3136 369
37 3300044842 Ga0466957_0002962 Ga0466957_0002962_3041_4171 369
38 3300045049 Ga0466959_0007791 Ga0466959_0007791_2847_3977 369
39 3300061719 Ga0466962_0018794 Ga0466962_0018794_519_1649 369
40 iso_pu_bacteria 2791355137 2792837677 369
41 iso_pu_bacteria 2904615490 2904621747 369
42 3300002067 JGI24735J21928_10002617 JGI24735J21928_100026175 371
43 3300009011 Ga0105251_10000639 Ga0105251_1000063923 371
44 3300013105 Ga0157369_10120627 Ga0157369_101206273 371
45 3300025256 Ga0209759_1010606 Ga0209759_10106062 371
46 3300025735 Ga0207713_1050362 Ga0207713_10503622 371
47 3300026067 Ga0207678_10065709 Ga0207678_100657093 371
48 3300046457 Ga0495590_0008252 Ga0495590_0008252_57_1196 371
49 3300046459 Ga0495629_0014453 Ga0495629_0014453_2796_3935 371
50 3300046463 Ga0495653_0023733 Ga0495653_0023733_3418_4557 371
51 3300046473 Ga0495582_0067399 Ga0495582_0067399_141_1280 371
52 3300046516 Ga0495628_0013255 Ga0495628_0013255_5062_6201 371
53 3300046529 Ga0495652_0010119 Ga0495652_0010119_7102_8241 371
54 3300046531 Ga0495665_0018526 Ga0495665_0018526_294_1433 371
55 3300046542 Ga0495597_0003789 Ga0495597_0003789_3551_4690 371
56 3300046543 Ga0495645_0104345 Ga0495645_0104345_802_1941 371
57 3300046663 Ga0495635_0025158 Ga0495635_0025158_2054_3193 371
58 3300046679 Ga0495623_0050304 Ga0495623_0050304_631_1770 371
59 3300046680 Ga0495646_0042488 Ga0495646_0042488_858_1997 371
60 3300046684 Ga0495669_0007922 Ga0495669_0007922_695_1834 371
61 3300046690 Ga0495624_0064651 Ga0495624_0064651_546_1685 371
62 3300047317 Ga0495604_0003785 Ga0495604_0003785_6568_7707 371
63 3300047319 Ga0495674_0093774 Ga0495674_0093774_261_1400 371
64 3300047323 Ga0495683_0017705 Ga0495683_0017705_1083_2222 371
65 3300047323 Ga0495683_0078929 Ga0495683_0078929_288_1427 371
66 3300047444 Ga0495675_0087708 Ga0495675_0087708_14_1153 371
67 3300047673 Ga0495593_0042139 Ga0495593_0042139_743_1882 371
68 3300047673 Ga0495593_0079260 Ga0495593_0079260_464_1603 371
69 3300048088 Ga0495602_0003155 Ga0495602_0003155_8958_10097 371
70 3300048904 Ga0496101_0000677 Ga0496101_0000677_4326_5465 371
71 3300048905 Ga0496102_0004439 Ga0496102_0004439_5913_7052 371
72 3300048909 Ga0496106_0003014 Ga0496106_0003014_4621_5760 371
73 3300048910 Ga0496107_0009288 Ga0496107_0009288_3971_5110 371
74 3300048912 Ga0496109_0029058 Ga0496109_0029058_2846_3985 371
75 3300048913 Ga0496110_0012939 Ga0496110_0012939_5469_6608 371
76 3300048913 Ga0496110_0118021 Ga0496110_0118021_752_1870 371
77 3300048915 Ga0496112_0052828 Ga0496112_0052828_2598_3737 371
78 3300048919 Ga0496116_0040383 Ga0496116_0040383_402_1541 371
79 3300048921 Ga0496118_0010605 Ga0496118_0010605_6036_7175 371
80 3300048924 Ga0496121_0013090 Ga0496121_0013090_3993_5132 371
81 3300048926 Ga0496123_0031015 Ga0496123_0031015_2483_3622 371
82 3300048927 Ga0496124_0029820 Ga0496124_0029820_1791_2930 371
83 3300048928 Ga0496125_0006221 Ga0496125_0006221_9778_10917 371
84 3300048929 Ga0496126_0158391 Ga0496126_0158391_427_1566 371
85 iso_pu_bacteria 2508501125 2509132547 371
86 iso_pu_bacteria 2512047030 2512348988 371
87 iso_pu_bacteria 2513237151 2513958504 371
88 iso_pu_bacteria 2515154122 2515680367 371
89 iso_pu_bacteria 2515154123 2515687756 371
90 iso_pu_bacteria 2526164713 2527077446 371
91 iso_pu_bacteria 2562617112 2563061309 371
92 iso_pu_bacteria 2711768613 2713476271 371
93 iso_pu_bacteria 2738541296 2738822554 371
94 iso_pu_bacteria 2738541298 2738834761 371
95 iso_pu_bacteria 2738541306 2738876240 371
96 iso_pu_bacteria 2738543002 2739188184 371
97 iso_pu_bacteria 2738543008 2739222837 371
98 iso_pu_bacteria 2744054900 2746085112 371
99 iso_pu_bacteria 2744054901 2746095017 371
100 iso_pu_bacteria 2751185846 2753571750 371
101 iso_pu_bacteria 2808606384 2808974596 371
102 iso_pu_bacteria 2808606390 2809009426 371
103 iso_pu_bacteria 2808606391 2809016574 371
104 iso_pu_bacteria 2818991450 2819618963 371
105 iso_pu_bacteria 2885270888 2885278009 371
106 iso_pu_bacteria 2928108538 2928114002 371
107 iso_pu_bacteria 2928135762 2928141378 371
108 iso_pu_bacteria 2928503688 2928509488 371
109 iso_pu_bacteria 2990703756 2990707267 371
110 iso_pu_bacteria 641736151 642427052 371
111 iso_pu_bacteria 642555113 642615651 371
112 3300016635 Ga0183361_10003 Ga0183361_10003232 373
113 3300046680 Ga0495646_0021161 Ga0495646_0021161_1081_2205 373
114 3300038443 Ga0395901_0000004 Ga0395901_0000004_561260_562387 374
115 3300046459 Ga0495629_0000184 Ga0495629_0000184_50222_51349 374
116 3300046462 Ga0495651_0072638 Ga0495651_0072638_975_2102 374
117 3300046463 Ga0495653_0045661 Ga0495653_0045661_1559_2686 374
118 3300046471 Ga0495650_0000155 Ga0495650_0000155_80063_81190 374
119 3300046472 Ga0495580_0013679 Ga0495580_0013679_4640_5767 374
120 3300046475 Ga0495639_0064622 Ga0495639_0064622_194_1321 374
121 3300046477 Ga0495664_0179107 Ga0495664_0179107_50_1177 374
122 3300046501 Ga0495607_0000154 Ga0495607_0000154_38646_39782 374
123 3300046507 Ga0495606_0007205 Ga0495606_0007205_3666_4793 374
124 3300046511 Ga0495608_0157411 Ga0495608_0157411_117_1244 374
125 3300046528 Ga0495642_0007702 Ga0495642_0007702_2888_4015 374
126 3300046535 Ga0495586_0037485 Ga0495586_0037485_269_1396 374
127 3300046543 Ga0495645_0000045 Ga0495645_0000045_79701_80828 374
128 3300046694 Ga0495649_0028091 Ga0495649_0028091_1221_2348 374
129 3300047315 Ga0495581_0007469 Ga0495581_0007469_4427_5554 374
130 3300047321 Ga0495676_0106454 Ga0495676_0106454_328_1581 374
131 3300047323 Ga0495683_0010427 Ga0495683_0010427_3480_4607 374
132 3300048089 Ga0495614_0004740 Ga0495614_0004740_3069_4196 374
133 3300048091 Ga0495626_0030663 Ga0495626_0030663_924_2060 374
134 3300048908 Ga0496105_0036914 Ga0496105_0036914_1585_2712 374
135 3300048917 Ga0496114_0115238 Ga0496114_0115238_552_1679 374
136 3300048918 Ga0496115_0009283 Ga0496115_0009283_4454_5581 374
137 3300048920 Ga0496117_0001088 Ga0496117_0001088_34047_35174 374
138 3300048921 Ga0496118_0004091 Ga0496118_0004091_13390_14517 374
139 3300048929 Ga0496126_0000328 Ga0496126_0000328_33769_34896 374
140 3300001979 JGI24740J21852_10018237 JGI24740J21852_100182372 375
141 3300001989 JGI24739J22299_10039999 JGI24739J22299_100399992 375
142 3300002067 JGI24735J21928_10013402 JGI24735J21928_100134022 375
143 3300002067 JGI24735J21928_10016727 JGI24735J21928_100167272 375
144 3300002705 JGI25156J39149_1002119 JGI25156J39149_10021192 375
145 3300003320 rootH2_10176782 rootH2_101767822 375
146 3300003320 rootH2_10209170 rootH2_102091702 375
147 3300003322 rootL2_10064024 rootL2_100640242 375
148 3300003323 rootH1_10172559 rootH1_101725593 375
149 3300003354 JGI25160J50197_1000173 JGI25160J50197_100017363 375
150 3300003756 Ga0055533_1006265 Ga0055533_10062651 375
151 3300005262 Ga0065165_1000564 Ga0065165_100056462 375
152 3300005327 Ga0070658_10122004 Ga0070658_101220042 375
153 3300005455 Ga0070663_100202677 Ga0070663_1002026771 375
154 3300005563 Ga0068855_100042791 Ga0068855_1000427914 375
155 3300005563 Ga0068855_100236284 Ga0068855_1002362842 375
156 3300009011 Ga0105251_10000313 Ga0105251_100003138 375
157 3300009093 Ga0105240_10006786 Ga0105240_100067862 375
158 3300009177 Ga0105248_10296310 Ga0105248_102963102 375
159 3300010375 Ga0105239_10063222 Ga0105239_100632223 375
160 3300013104 Ga0157370_10037943 Ga0157370_100379434 375
161 3300013105 Ga0157369_10000084 Ga0157369_100000845 375
162 3300013105 Ga0157369_10000093 Ga0157369_1000009358 375
163 3300013105 Ga0157369_10150808 Ga0157369_101508082 375
164 3300013296 Ga0157374_10000034 Ga0157374_1000003416 375
165 3300013307 Ga0157372_10001753 Ga0157372_1000175316 375
166 3300015262 Ga0182007_10006351 Ga0182007_100063513 375
167 3300020070 Ga0206356_10376753 Ga0206356_103767531 375
168 3300020081 Ga0206354_11028250 Ga0206354_110282503 375
169 3300020082 Ga0206353_10436355 Ga0206353_104363553 375
170 3300025226 Ga0209674_100029 Ga0209674_10002981 375
171 3300025228 Ga0209672_100484 Ga0209672_10048411 375
172 3300025256 Ga0209759_1000008 Ga0209759_1000008242 375
173 3300025256 Ga0209759_1000764 Ga0209759_100076428 375
174 3300025256 Ga0209759_1009268 Ga0209759_10092683 375
175 3300025295 Ga0209564_1008859 Ga0209564_10088597 375
176 3300025302 Ga0207426_1000056 Ga0207426_100005641 375
177 3300025735 Ga0207713_1000401 Ga0207713_100040136 375
178 3300025904 Ga0207647_10002184 Ga0207647_1000218416 375
179 3300025904 Ga0207647_10030499 Ga0207647_100304993 375
180 3300025913 Ga0207695_10045383 Ga0207695_100453832 375
181 3300025919 Ga0207657_10039058 Ga0207657_100390584 375
182 3300025941 Ga0207711_10028643 Ga0207711_100286432 375
183 3300025949 Ga0207667_10003399 Ga0207667_1000339918 375
184 3300026078 Ga0207702_10265618 Ga0207702_102656182 375
185 3300030500 Ga0268256_1008542 Ga0268256_10085423 375
186 3300031911 Ga0307412_10000082 Ga0307412_100000824 375
187 3300037312 Ga0395899_0000023 Ga0395899_0000023_109761_110891 375
188 3300037312 Ga0395899_0023602 Ga0395899_0023602_3133_4263 375
189 3300037312 Ga0395899_0028262 Ga0395899_0028262_1596_2726 375
190 3300037312 Ga0395899_0124021 Ga0395899_0124021_641_1771 375
191 3300037312 Ga0395899_0175370 Ga0395899_0175370_93_1223 375
192 3300037418 Ga0395900_0000019 Ga0395900_0000019_256269_257399 375
193 3300037418 Ga0395900_0011434 Ga0395900_0011434_5745_6875 375
194 3300037466 Ga0395898_0000016 Ga0395898_0000016_251418_252548 375
195 3300037466 Ga0395898_0000617 Ga0395898_0000617_4022_5152 375
196 3300037466 Ga0395898_0007779 Ga0395898_0007779_6013_7143 375
197 3300037466 Ga0395898_0100324 Ga0395898_0100324_339_1469 375
198 3300037471 Ga0395905_0000331 Ga0395905_0000331_3902_5041 375
199 3300037471 Ga0395905_0045015 Ga0395905_0045015_684_1811 375
200 3300038443 Ga0395901_0000040 Ga0395901_0000040_63456_64586 375
201 3300038443 Ga0395901_0000326 Ga0395901_0000326_24427_25557 375
202 3300038443 Ga0395901_0015087 Ga0395901_0015087_2183_3313 375
203 3300038443 Ga0395901_0047408 Ga0395901_0047408_2183_3313 375
204 3300044656 Ga0466969_0028840 Ga0466969_0028840_274_1404 375
205 3300044658 Ga0466972_0042780 Ga0466972_0042780_236_1366 375
206 3300044684 Ga0466966_0000418 Ga0466966_0000418_13934_15064 375
207 3300044684 Ga0466966_0014596 Ga0466966_0014596_428_1558 375
208 3300044684 Ga0466966_0049696 Ga0466966_0049696_348_1478 375
209 3300044693 Ga0466961_0000169 Ga0466961_0000169_41351_42481 375
210 3300044693 Ga0466961_0003084 Ga0466961_0003084_7123_8256 375
211 3300044693 Ga0466961_0039299 Ga0466961_0039299_1779_2909 375
212 3300044693 Ga0466961_0107068 Ga0466961_0107068_392_1522 375
213 3300044694 Ga0466963_0004064 Ga0466963_0004064_1648_2778 375
214 3300044694 Ga0466963_0011401 Ga0466963_0011401_2172_3302 375
215 3300044706 Ga0466964_0004659 Ga0466964_0004659_3048_4178 375
216 3300044719 Ga0466971_0005749 Ga0466971_0005749_3012_4142 375
217 3300044842 Ga0466957_0003406 Ga0466957_0003406_3417_4547 375
218 3300045049 Ga0466959_0010638 Ga0466959_0010638_3669_4799 375
219 3300045049 Ga0466959_0045894 Ga0466959_0045894_982_2115 375
220 3300045836 Ga0466958_0003943 Ga0466958_0003943_1341_2471 375
221 3300045836 Ga0466958_0035845 Ga0466958_0035845_698_1828 375
222 3300045836 Ga0466958_0055145 Ga0466958_0055145_244_1374 375
223 3300046454 Ga0495592_0006453 Ga0495592_0006453_6057_7184 375
224 3300046454 Ga0495592_0048016 Ga0495592_0048016_406_1539 375
225 3300046458 Ga0495591_007336 Ga0495591_007336_3033_4160 375
226 3300046459 Ga0495629_0000058 Ga0495629_0000058_14058_15185 375
227 3300046459 Ga0495629_0009918 Ga0495629_0009918_3455_4582 375
228 3300046459 Ga0495629_0012532 Ga0495629_0012532_274_1407 375
229 3300046461 Ga0495641_0026166 Ga0495641_0026166_315_1448 375
230 3300046462 Ga0495651_0002805 Ga0495651_0002805_4242_5369 375
231 3300046462 Ga0495651_0023690 Ga0495651_0023690_2212_3342 375
232 3300046463 Ga0495653_0000360 Ga0495653_0000360_26454_27581 375
233 3300046463 Ga0495653_0003508 Ga0495653_0003508_10341_11477 375
234 3300046471 Ga0495650_0006518 Ga0495650_0006518_3658_4785 375
235 3300046471 Ga0495650_0007556 Ga0495650_0007556_4485_5618 375
236 3300046472 Ga0495580_0000476 Ga0495580_0000476_22326_23456 375
237 3300046472 Ga0495580_0004330 Ga0495580_0004330_9807_10943 375
238 3300046472 Ga0495580_0004737 Ga0495580_0004737_3373_4500 375
239 3300046472 Ga0495580_0025028 Ga0495580_0025028_641_1768 375
240 3300046472 Ga0495580_0176025 Ga0495580_0176025_209_1342 375
241 3300046473 Ga0495582_0014366 Ga0495582_0014366_2811_3938 375
242 3300046473 Ga0495582_0055938 Ga0495582_0055938_995_2131 375
243 3300046474 Ga0495605_0008022 Ga0495605_0008022_2460_3587 375
244 3300046476 Ga0495662_0009925 Ga0495662_0009925_244_1380 375
245 3300046476 Ga0495662_0037276 Ga0495662_0037276_391_1524 375
246 3300046477 Ga0495664_0041764 Ga0495664_0041764_1186_2319 375
247 3300046477 Ga0495664_0081175 Ga0495664_0081175_696_1829 375
248 3300046477 Ga0495664_0093553 Ga0495664_0093553_36_1172 375
249 3300046500 Ga0495596_0001141 Ga0495596_0001141_11290_12417 375
250 3300046506 Ga0495583_0003033 Ga0495583_0003033_1588_2715 375
251 3300046511 Ga0495608_0007599 Ga0495608_0007599_721_1854 375
252 3300046511 Ga0495608_0008158 Ga0495608_0008158_5166_6293 375
253 3300046511 Ga0495608_0125301 Ga0495608_0125301_360_1496 375
254 3300046512 Ga0495610_0002232 Ga0495610_0002232_10280_11407 375
255 3300046514 Ga0495618_0003826 Ga0495618_0003826_4329_5462 375
256 3300046514 Ga0495618_0005081 Ga0495618_0005081_5880_7016 375
257 3300046514 Ga0495618_0006441 Ga0495618_0006441_3597_4724 375
258 3300046516 Ga0495628_0006142 Ga0495628_0006142_2990_4117 375
259 3300046516 Ga0495628_0006775 Ga0495628_0006775_7217_8353 375
260 3300046516 Ga0495628_0074293 Ga0495628_0074293_644_1774 375
261 3300046517 Ga0495630_0003746 Ga0495630_0003746_4273_5400 375
262 3300046517 Ga0495630_0016956 Ga0495630_0016956_2458_3585 375
263 3300046524 Ga0495648_0036190 Ga0495648_0036190_130_1257 375
264 3300046524 Ga0495648_0057311 Ga0495648_0057311_593_1720 375
265 3300046524 Ga0495648_0064581 Ga0495648_0064581_102_1229 375
266 3300046524 Ga0495648_0085786 Ga0495648_0085786_234_1361 375
267 3300046526 Ga0495666_0007075 Ga0495666_0007075_2865_3992 375
268 3300046526 Ga0495666_0027654 Ga0495666_0027654_713_1849 375
269 3300046528 Ga0495642_0007167 Ga0495642_0007167_412_1539 375
270 3300046529 Ga0495652_0064170 Ga0495652_0064170_1036_2163 375
271 3300046529 Ga0495652_0112110 Ga0495652_0112110_195_1325 375
272 3300046529 Ga0495652_0143686 Ga0495652_0143686_712_1845 375
273 3300046531 Ga0495665_0033800 Ga0495665_0033800_451_1587 375
274 3300046533 Ga0495640_0023127 Ga0495640_0023127_2926_4059 375
275 3300046533 Ga0495640_0036364 Ga0495640_0036364_90_1217 375
276 3300046536 Ga0495587_0012097 Ga0495587_0012097_2755_3882 375
277 3300046542 Ga0495597_0034313 Ga0495597_0034313_1006_2139 375
278 3300046543 Ga0495645_0049074 Ga0495645_0049074_1615_2751 375
279 3300046642 Ga0495634_0004626 Ga0495634_0004626_8966_10102 375
280 3300046642 Ga0495634_0030673 Ga0495634_0030673_1036_2163 375
281 3300046663 Ga0495635_0010767 Ga0495635_0010767_3003_4130 375
282 3300046663 Ga0495635_0024434 Ga0495635_0024434_1781_2917 375
283 3300046665 Ga0495661_0013506 Ga0495661_0013506_662_1789 375
284 3300046678 Ga0495599_0001112 Ga0495599_0001112_3208_4344 375
285 3300046678 Ga0495599_0011516 Ga0495599_0011516_2528_3655 375
286 3300046678 Ga0495599_0033046 Ga0495599_0033046_101_1228 375
287 3300046678 Ga0495599_0063161 Ga0495599_0063161_1009_2139 375
288 3300046679 Ga0495623_0010841 Ga0495623_0010841_2406_3533 375
289 3300046679 Ga0495623_0052810 Ga0495623_0052810_1171_2304 375
290 3300046680 Ga0495646_0006942 Ga0495646_0006942_2172_3299 375
291 3300046680 Ga0495646_0031959 Ga0495646_0031959_1224_2351 375
292 3300046689 Ga0495613_0003313 Ga0495613_0003313_8645_9781 375
293 3300046689 Ga0495613_0026199 Ga0495613_0026199_1055_2182 375
294 3300046689 Ga0495613_0026383 Ga0495613_0026383_2483_3610 375
295 3300046690 Ga0495624_0000673 Ga0495624_0000673_1352_2479 375
296 3300046690 Ga0495624_0004103 Ga0495624_0004103_5110_6240 375
297 3300046690 Ga0495624_0008928 Ga0495624_0008928_5701_6828 375
298 3300046690 Ga0495624_0024072 Ga0495624_0024072_846_1973 375
299 3300046690 Ga0495624_0055549 Ga0495624_0055549_324_1460 375
300 3300046692 Ga0495671_0025339 Ga0495671_0025339_843_1970 375
301 3300046694 Ga0495649_0004741 Ga0495649_0004741_2875_4008 375
302 3300046694 Ga0495649_0040783 Ga0495649_0040783_119_1246 375
303 3300046694 Ga0495649_0108092 Ga0495649_0108092_63_1190 375
304 3300046794 Ga0495589_0052757 Ga0495589_0052757_766_1893 375
305 3300047315 Ga0495581_0006893 Ga0495581_0006893_1528_2661 375
306 3300047315 Ga0495581_0033468 Ga0495581_0033468_1157_2284 375
307 3300047317 Ga0495604_0012443 Ga0495604_0012443_2819_3946 375
308 3300047317 Ga0495604_0012758 Ga0495604_0012758_3749_4885 375
309 3300047317 Ga0495604_0016075 Ga0495604_0016075_2030_3157 375
310 3300047317 Ga0495604_0062085 Ga0495604_0062085_376_1506 375
311 3300047319 Ga0495674_0009262 Ga0495674_0009262_6879_8006 375
312 3300047319 Ga0495674_0011977 Ga0495674_0011977_1351_2478 375
313 3300047319 Ga0495674_0018283 Ga0495674_0018283_2732_3859 375
314 3300047319 Ga0495674_0048434 Ga0495674_0048434_1919_3049 375
315 3300047319 Ga0495674_0105925 Ga0495674_0105925_1172_2299 375
316 3300047320 Ga0495672_0031279 Ga0495672_0031279_1949_3076 375
317 3300047320 Ga0495672_0052521 Ga0495672_0052521_234_1361 375
318 3300047321 Ga0495676_0012813 Ga0495676_0012813_5594_6730 375
319 3300047321 Ga0495676_0014303 Ga0495676_0014303_643_1770 375
320 3300047322 Ga0495680_0026644 Ga0495680_0026644_2140_3273 375
321 3300047322 Ga0495680_0032357 Ga0495680_0032357_1492_2622 375
322 3300047322 Ga0495680_0046391 Ga0495680_0046391_1654_2790 375
323 3300047323 Ga0495683_0004181 Ga0495683_0004181_1547_2674 375
324 3300047323 Ga0495683_0019211 Ga0495683_0019211_507_1640 375
325 3300047323 Ga0495683_0021159 Ga0495683_0021159_704_1837 375
326 3300047443 Ga0495687_020218 Ga0495687_020218_2041_3174 375
327 3300047443 Ga0495687_030833 Ga0495687_030833_145_1272 375
328 3300047444 Ga0495675_0022987 Ga0495675_0022987_2159_3295 375
329 3300047444 Ga0495675_0035104 Ga0495675_0035104_1567_2694 375
330 3300047446 Ga0495679_000009 Ga0495679_000009_57792_58919 375
331 3300047446 Ga0495679_002026 Ga0495679_002026_3150_4277 375
332 3300047446 Ga0495679_032626 Ga0495679_032626_81_1217 375
333 3300047469 Ga0495673_0006280 Ga0495673_0006280_3455_4582 375
334 3300047469 Ga0495673_0018831 Ga0495673_0018831_185_1312 375
335 3300047471 Ga0495684_0030642 Ga0495684_0030642_2404_3540 375
336 3300047673 Ga0495593_0001591 Ga0495593_0001591_10084_11211 375
337 3300047673 Ga0495593_0091246 Ga0495593_0091246_406_1539 375
338 3300048088 Ga0495602_0022236 Ga0495602_0022236_2949_4076 375
339 3300048088 Ga0495602_0061721 Ga0495602_0061721_1097_2224 375
340 3300048088 Ga0495602_0177135 Ga0495602_0177135_324_1460 375
341 3300048089 Ga0495614_0012268 Ga0495614_0012268_1931_3064 375
342 3300048089 Ga0495614_0014285 Ga0495614_0014285_89_1216 375
343 3300048091 Ga0495626_0053392 Ga0495626_0053392_448_1581 375
344 3300048903 Ga0496100_0001176 Ga0496100_0001176_3556_4683 375
345 3300048904 Ga0496101_0000200 Ga0496101_0000200_35989_37116 375
346 3300048904 Ga0496101_0172940 Ga0496101_0172940_222_1349 375
347 3300048905 Ga0496102_0263524 Ga0496102_0263524_183_1313 375
348 3300048905 Ga0496102_0316165 Ga0496102_0316165_281_1408 375
349 3300048906 Ga0496103_0003825 Ga0496103_0003825_3718_4845 375
350 3300048907 Ga0496104_0043456 Ga0496104_0043456_593_1720 375
351 3300048908 Ga0496105_0091143 Ga0496105_0091143_862_1989 375
352 3300048909 Ga0496106_0000010 Ga0496106_0000010_115690_116847 375
353 3300048915 Ga0496112_0014038 Ga0496112_0014038_2793_3920 375
354 3300048916 Ga0496113_0005388 Ga0496113_0005388_1322_2449 375
355 3300048918 Ga0496115_0242855 Ga0496115_0242855_14_1141 375
356 3300048919 Ga0496116_0004713 Ga0496116_0004713_4048_5178 375
357 3300048919 Ga0496116_0025357 Ga0496116_0025357_2045_3184 375
358 3300048919 Ga0496116_0136228 Ga0496116_0136228_165_1292 375
359 3300048920 Ga0496117_0001308 Ga0496117_0001308_8329_9456 375
360 3300048920 Ga0496117_0004989 Ga0496117_0004989_4196_5323 375
361 3300048920 Ga0496117_0013992 Ga0496117_0013992_3708_4850 375
362 3300048920 Ga0496117_0030769 Ga0496117_0030769_715_1842 375
363 3300048921 Ga0496118_0000835 Ga0496118_0000835_38918_40045 375
364 3300048921 Ga0496118_0001165 Ga0496118_0001165_22086_23216 375
365 3300048921 Ga0496118_0001597 Ga0496118_0001597_23329_24456 375
366 3300048921 Ga0496118_0044736 Ga0496118_0044736_1409_2536 375
367 3300048921 Ga0496118_0099393 Ga0496118_0099393_693_1835 375
368 3300048924 Ga0496121_0000932 Ga0496121_0000932_49885_51012 375
369 3300048924 Ga0496121_0001064 Ga0496121_0001064_36443_37582 375
370 3300048924 Ga0496121_0008037 Ga0496121_0008037_7149_8276 375
371 3300048924 Ga0496121_0010875 Ga0496121_0010875_1897_3024 375
372 3300048924 Ga0496121_0019575 Ga0496121_0019575_4462_5619 375
373 3300048924 Ga0496121_0049715 Ga0496121_0049715_955_2094 375
374 3300048925 Ga0496122_0113506 Ga0496122_0113506_284_1411 375
375 3300048927 Ga0496124_0063865 Ga0496124_0063865_68_1225 375
376 3300048929 Ga0496126_0000315 Ga0496126_0000315_6022_7164 375
377 3300048929 Ga0496126_0000319 Ga0496126_0000319_76757_77887 375
378 3300048929 Ga0496126_0003228 Ga0496126_0003228_18795_19934 375
379 3300049459 Ga0495678_024969 Ga0495678_024969_131_1258 375
380 3300049459 Ga0495678_053771 Ga0495678_053771_302_1435 375
381 3300049460 Ga0495682_0009025 Ga0495682_0009025_2132_3259 375
382 3300049460 Ga0495682_0029664 Ga0495682_0029664_217_1344 375
383 3300061719 Ga0466962_0006618 Ga0466962_0006618_2817_3947 375
384 iso_pu_bacteria 2513237166 2514052400 375
385 iso_pu_bacteria 2600255067 2600814885 375
386 iso_pu_bacteria 2842324504 2842329603 375
387 iso_pu_bacteria 2842348783 2842354298 375
388 iso_pu_bacteria 2842454564 2842456189 375
389 iso_pu_bacteria 2900634093 2900638364 375
390 iso_pu_bacteria 2902682994 2902687888 375
391 iso_pu_bacteria 2945934425 2945940145 375
392 iso_pu_bacteria 642555112 642596417 375
393 iso_pu_bacteria 8055266321 8055269268 375
394 iso_pu_bacteria 8055301274 8055303586 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13510

Fer2_4

2Fe-2S iron-sulfur cluster binding domain

333

413

0.97

PF01266

DAO

FAD dependent oxidoreductase

4

339

0.86

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

7

70

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.9786 5 34
5jfc-assembly1.cif.gz_L nadh-dependent ferredoxin:nadp oxidoreductase (nfni) from pyrococcus furiosus 0.9726 3 34
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.9552 4 32
8bk1-assembly1.cif.gz_A mutant imine reductase ir007-143 from amycolatopsis azurea, e120a, m197w, m206s, a213p, d238g, i240l 0.9527 5 32
8bj5-assembly2.cif.gz_C imine reductase ir007 from amycolatopsis azurea 0.9488 5 32
ID Description Score Start End Superfamily
3llvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9906 3 32 3.40.50.720
2vq3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9764 5 30 3.40.50.720
af_P0A6S7_1_191_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9745 2 31 3.40.50.720
af_Q2G041_6_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9702 4 31 3.50.50.60
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 4 32 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A399X104-F1-model_v4 D-amino-acid oxidase 0.9428 2 371 GO:0005737
AF-A0A399X104-F1-model_v4 D-amino-acid oxidase 0.933 2 371 GO:0005737
AF-A0A2V9P3C1-F1-model_v4 D-amino-acid oxidase 0.9327 2 351 GO:0005737
AF-A0A430HND6-F1-model_v4 FAD-binding oxidoreductase 0.9324 3 369 GO:0005737
AF-A0A7Z1SJC6-F1-model_v4 deleted 0.9254 2 373

Feature Viewer

pLDDT pTM Quality
87.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map