F432987

General Info

Members Datasets Scaffolds Average Seq Length
394 185 349 206

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_010937|Ga0495617_010937_1292_2017
Length 241
Sequence LKTNSNKIYLFFLTHKLLLERDDAKRGVLSAGMGSAMTLNIFVAFWAVSILFVITPGADWAYAISAGLRGRVVIPAVGGLLSGHLLATVIVAGGVGTLVANHPVALSALTIAGSGYMLWLGINMLARPATPHADDIQASGSWKRWAIKGLCVSGLNPKVFLLFLALLPQFTDAAAAWPVPMQMIALGLIHTVSCGVIYLLVGFGSQVVLQARPAAALFVSRFSGASMIIIAIVLFTERMFG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231008 Pseudomonas sp. GM21 Isolate Nodule
3 2511231014 Pseudomonas sp. GM48 Isolate Nodule
4 2511231015 Pseudomonas sp. GM49 Isolate Nodule
5 2511231017 Pseudomonas sp. GM55 Isolate Nodule
6 2511231018 Pseudomonas sp. GM60 Isolate Nodule
7 2511231019 Pseudomonas sp. GM67 Isolate Nodule
8 2511231020 Pseudomonas sp. GM74 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2511231023 Pseudomonas sp. GM80 Isolate Nodule
11 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
12 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
13 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
14 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
15 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
16 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
17 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
18 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
19 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
20 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
21 2765235841 Pseudomonas putida AA7 Isolate Unclassified
22 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
23 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
24 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
25 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
26 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
27 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
28 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
29 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
30 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
31 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
32 2937967321 Serratia sp. YC16 Isolate Unclassified
33 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
34 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
35 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
36 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
37 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
38 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
39 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
77 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
80 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
81 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
82 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
83 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
84 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
85 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
86 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
87 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
88 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
89 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
179 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
180 8004592986 Serratia sp. S119 Isolate Unclassified
181 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
182 8052494512 Pseudomonas putida LD6 Isolate Unclassified
183 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
184 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
185 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.58
Metatranscriptomes 0
Isolates 11.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 3.55
Rhizoplane 2.28
Rhizosphere 79.95
Stem 0
Stem Tuber 0
Unclassified 11.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2188596 2162886007 Bacteria 1496
2 Ga0065703_1019059 3300005272 Bacteria 4162
3 Ga0065714_10003342 3300005288 Bacteria 7781
4 Ga0065714_10064479 3300005288 Bacteria 55183
5 Ga0065704_10013398 3300005289 Bacteria 1501
6 Ga0065704_10078036 3300005289 Bacteria 4539
7 Ga0065704_10245767 3300005289 Bacteria 994
8 Ga0070665_100069650 3300005548 Bacteria 3526
9 Ga0070665_100086661 3300005548 Bacteria 3137
10 Ga0075364_10004177 3300006051 Bacteria 8288
11 Ga0075364_10194931 3300006051 Bacteria 1372
12 Ga0075432_10003320 3300006058 Bacteria 5437
13 Ga0075432_10021503 3300006058 Bacteria 2205
14 Ga0075432_10040173 3300006058 Bacteria 1632
15 Ga0075432_10076768 3300006058 Bacteria 1206
16 Ga0075362_10020609 3300006177 Bacteria 2757
17 Ga0075436_100049782 3300006914 Bacteria 2891
18 Ga0075436_100117397 3300006914 Bacteria 1860
19 Ga0099823_1000013 3300006944 Bacteria 90711
20 Ga0079104_1001449 3300006946 Bacteria 15856
21 Ga0105251_10000187 3300009011 Bacteria 62831
22 Ga0105251_10000200 3300009011 Bacteria 60751
23 Ga0105251_10000525 3300009011 Bacteria 36170
24 Ga0105251_10038513 3300009011 Bacteria 2342
25 Ga0105251_10083799 3300009011 Bacteria 1471
26 Ga0105251_10122002 3300009011 Bacteria 1183
27 Ga0105251_10209587 3300009011 Bacteria 877
28 Ga0105244_10000091 3300009036 Bacteria 96351
29 Ga0105244_10001676 3300009036 Bacteria 17509
30 Ga0105244_10008990 3300009036 Bacteria 6182
31 Ga0105244_10016814 3300009036 Bacteria 4155
32 Ga0105244_10057800 3300009036 Bacteria 1959
33 Ga0105244_10137387 3300009036 Bacteria 1177
34 Ga0105244_10137970 3300009036 Bacteria 1174
35 Ga0105244_10163898 3300009036 Bacteria 1060
36 Ga0105250_10000027 3300009092 Bacteria 212624
37 Ga0105250_10000248 3300009092 Bacteria 44678
38 Ga0105250_10032702 3300009092 Bacteria 2089
39 Ga0105250_10211708 3300009092 Bacteria 819
40 Ga0105240_10170728 3300009093 Bacteria 2576
41 Ga0105243_10000005 3300009148 Bacteria 576265
42 Ga0105243_10001286 3300009148 Bacteria 22512
43 Ga0105243_10083068 3300009148 Bacteria 2620
44 Ga0105246_10000002 3300011119 Bacteria 103711
45 Ga0105246_10100351 3300011119 Bacteria 2106
46 Ga0105246_10179804 3300011119 Bacteria 1628
47 Ga0157373_10006828 3300013100 Bacteria 8498
48 Ga0157371_10075715 3300013102 Bacteria 2383
49 Ga0157371_10106592 3300013102 Bacteria 1989
50 Ga0157370_10011547 3300013104 Bacteria 9222
51 Ga0157370_10109063 3300013104 Bacteria 2588
52 Ga0157370_10325925 3300013104 Bacteria 1416
53 Ga0157370_10543220 3300013104 Bacteria 1065
54 Ga0163162_10059343 3300013306 Bacteria 3857
55 Ga0163162_10089918 3300013306 Bacteria 3152
56 Ga0157375_10133822 3300013308 Bacteria 2601
57 Ga0182008_10082149 3300014497 Bacteria 1586
58 Ga0182005_1023452 3300015265 Bacteria 1686
59 Ga0163161_10007141 3300017792 Bacteria 7721
60 Ga0163161_10036404 3300017792 Bacteria 3524
61 Ga0163161_10422188 3300017792 Bacteria 1073
62 Ga0207696_1000008 3300025711 Bacteria 568181
63 Ga0207696_1000012 3300025711 Bacteria 527363
64 Ga0207696_1000368 3300025711 Bacteria 44687
65 Ga0207696_1006157 3300025711 Bacteria 4876
66 Ga0207696_1023416 3300025711 Bacteria 1948
67 Ga0207696_1023641 3300025711 Bacteria 1936
68 Ga0207655_1000020 3300025728 Bacteria 524503
69 Ga0207655_1000044 3300025728 Bacteria 327511
70 Ga0207655_1000469 3300025728 Bacteria 52077
71 Ga0207655_1000641 3300025728 Bacteria 41843
72 Ga0207655_1001465 3300025728 Bacteria 21798
73 Ga0207655_1006034 3300025728 Bacteria 8099
74 Ga0207655_1014575 3300025728 Bacteria 4433
75 Ga0207655_1025250 3300025728 Bacteria 2889
76 Ga0207655_1042995 3300025728 Bacteria 1917
77 Ga0207713_1000025 3300025735 Bacteria 322749
78 Ga0207713_1000082 3300025735 Bacteria 164992
79 Ga0207713_1000208 3300025735 Bacteria 79660
80 Ga0207713_1020983 3300025735 Bacteria 3143
81 Ga0207713_1036914 3300025735 Bacteria 2090
82 Ga0207713_1076782 3300025735 Bacteria 1215
83 Ga0207695_10293633 3300025913 Bacteria 1517
84 Ga0207709_10000001 3300025935 Bacteria 2228154
85 Ga0207709_10001093 3300025935 Bacteria 19872
86 Ga0209281_1000025 3300027111 Bacteria 488275
87 Ga0209281_1001348 3300027111 Bacteria 15231
88 Ga0209371_1000006 3300027312 Bacteria 1055642
89 Ga0207428_10033377 3300027907 Bacteria 4227
90 Ga0207428_10138355 3300027907 Bacteria 1861
91 Ga0268256_1000007 3300030500 Bacteria 1055326
92 Ga0307511_10081325 3300030521 Bacteria 2275
93 Ga0395898_0047921 3300037466 Bacteria 4191
94 Ga0395905_0139174 3300037471 Bacteria 2284
95 Ga0395901_0494564 3300038443 Bacteria 1246
96 Ga0439438_000246 3300041405 Bacteria 24083
97 Ga0439447_001198 3300041407 Bacteria 9448
98 Ga0439466_0001567 3300041411 Bacteria 8933
99 Ga0439466_0004384 3300041411 Bacteria 5440
100 Ga0439466_0020034 3300041411 Bacteria 2389
101 Ga0451837_0198712 3300041494 Bacteria 995
102 Ga0439432_002296 3300042006 Bacteria 7212
103 Ga0439451_000786 3300042009 Bacteria 6047
104 Ga0439451_003953 3300042009 Bacteria 3013
105 Ga0439456_000462 3300042013 Bacteria 8887
106 Ga0450900_007305 3300042136 Bacteria 1358
107 Ga0450904_000689 3300042139 Bacteria 5998
108 Ga0450905_004706 3300042142 Bacteria 1814
109 Ga0450906_001898 3300042145 Bacteria 4575
110 Ga0450907_002319 3300042146 Bacteria 3680
111 Ga0450910_000542 3300042147 Bacteria 4481
112 Ga0495617_001957 3300046452 Bacteria 8622
113 Ga0495617_002672 3300046452 Bacteria 6937
114 Ga0495617_010937 3300046452 Bacteria 3103
115 Ga0495603_0075493 3300046455 Bacteria 1978
116 Ga0495590_0005689 3300046457 Bacteria 4901
117 Ga0495590_0025850 3300046457 Bacteria 2062
118 Ga0495591_000012 3300046458 Bacteria 274403
119 Ga0495591_000257 3300046458 Bacteria 50572
120 Ga0495591_001044 3300046458 Bacteria 18656
121 Ga0495591_006729 3300046458 Bacteria 5011
122 Ga0495591_007737 3300046458 Bacteria 4509
123 Ga0495638_0000544 3300046460 Bacteria 43338
124 Ga0495638_0010782 3300046460 Bacteria 6323
125 Ga0495638_0022936 3300046460 Bacteria 4091
126 Ga0495638_0030992 3300046460 Bacteria 3438
127 Ga0495638_0057352 3300046460 Bacteria 2415
128 Ga0495650_0000872 3300046471 Bacteria 35863
129 Ga0495650_0000902 3300046471 Bacteria 34966
130 Ga0495650_0029184 3300046471 Bacteria 2518
131 Ga0495605_0003388 3300046474 Bacteria 9508
132 Ga0495605_0009504 3300046474 Bacteria 5460
133 Ga0495605_0011820 3300046474 Bacteria 4858
134 Ga0495605_0014032 3300046474 Bacteria 4396
135 Ga0495605_0033082 3300046474 Bacteria 2627
136 Ga0495639_0051683 3300046475 Bacteria 1869
137 Ga0495584_0000394 3300046491 Bacteria 30116
138 Ga0495584_0015057 3300046491 Bacteria 3941
139 Ga0495584_0052812 3300046491 Bacteria 2045
140 Ga0495584_0057743 3300046491 Bacteria 1952
141 Ga0495585_0000276 3300046492 Bacteria 51355
142 Ga0495585_0000307 3300046492 Bacteria 48876
143 Ga0495585_0006179 3300046492 Bacteria 7468
144 Ga0495585_0009457 3300046492 Bacteria 5845
145 Ga0495585_0075570 3300046492 Bacteria 1831
146 Ga0495594_0075635 3300046499 Bacteria 1877
147 Ga0495607_0004245 3300046501 Bacteria 10622
148 Ga0495607_0013029 3300046501 Bacteria 5467
149 Ga0495607_0026558 3300046501 Bacteria 3592
150 Ga0495607_0028056 3300046501 Bacteria 3476
151 Ga0495607_0032211 3300046501 Bacteria 3202
152 Ga0495607_0153312 3300046501 Bacteria 1177
153 Ga0495583_0000538 3300046506 Bacteria 53381
154 Ga0495583_0040490 3300046506 Bacteria 2189
155 Ga0495606_0000182 3300046507 Bacteria 111236
156 Ga0495606_0073205 3300046507 Bacteria 2150
157 Ga0495606_0284456 3300046507 Unclassified 902
158 Ga0495610_0000159 3300046512 Bacteria 75002
159 Ga0495610_0000174 3300046512 Bacteria 72225
160 Ga0495616_0009550 3300046513 Bacteria 5663
161 Ga0495620_0000385 3300046515 Bacteria 29925
162 Ga0495620_0058263 3300046515 Bacteria 1617
163 Ga0495630_0002280 3300046517 Bacteria 13349
164 Ga0495630_0057697 3300046517 Bacteria 2910
165 Ga0495631_0005333 3300046518 Bacteria 6747
166 Ga0495632_0000261 3300046519 Bacteria 52560
167 Ga0495632_0000275 3300046519 Bacteria 50568
168 Ga0495632_0000295 3300046519 Bacteria 48203
169 Ga0495632_0006937 3300046519 Bacteria 7190
170 Ga0495632_0008171 3300046519 Bacteria 6464
171 Ga0495637_0000962 3300046520 Bacteria 18369
172 Ga0495637_0001080 3300046520 Bacteria 16933
173 Ga0495637_0001343 3300046520 Bacteria 14758
174 Ga0495637_0001440 3300046520 Bacteria 14028
175 Ga0495643_0026731 3300046522 Bacteria 3251
176 Ga0495643_0109139 3300046522 Bacteria 1408
177 Ga0495644_0059253 3300046523 Bacteria 1439
178 Ga0495648_0000237 3300046524 Bacteria 63132
179 Ga0495648_0000758 3300046524 Bacteria 34444
180 Ga0495648_0003976 3300046524 Bacteria 12791
181 Ga0495648_0028954 3300046524 Bacteria 3681
182 Ga0495648_0038565 3300046524 Bacteria 3053
183 Ga0495663_0000238 3300046525 Bacteria 21921
184 Ga0495663_0001239 3300046525 Bacteria 8144
185 Ga0495642_0000049 3300046528 Bacteria 72362
186 Ga0495642_0000198 3300046528 Bacteria 35398
187 Ga0495654_0000188 3300046530 Bacteria 60499
188 Ga0495654_0007335 3300046530 Bacteria 6173
189 Ga0495654_0017203 3300046530 Bacteria 3805
190 Ga0495654_0053838 3300046530 Bacteria 1954
191 Ga0495654_0107576 3300046530 Bacteria 1275
192 Ga0495654_0184137 3300046530 Bacteria 902
193 Ga0495609_0000310 3300046538 Bacteria 43799
194 Ga0495609_0000720 3300046538 Bacteria 25213
195 Ga0495609_0003737 3300046538 Bacteria 8596
196 Ga0495609_0004906 3300046538 Bacteria 7184
197 Ga0495609_0028940 3300046538 Bacteria 2525
198 Ga0495597_0010943 3300046542 Bacteria 4412
199 Ga0495597_0019838 3300046542 Bacteria 3140
200 Ga0495597_0141129 3300046542 Bacteria 993
201 Ga0495622_0004620 3300046557 Bacteria 6378
202 Ga0495633_0055756 3300046558 Bacteria 1857
203 Ga0495656_0037976 3300046615 Bacteria 1992
204 Ga0495656_0150281 3300046615 Bacteria 1124
205 Ga0495668_0082849 3300046616 Bacteria 1759
206 Ga0495611_0001526 3300046648 Bacteria 11394
207 Ga0495611_0012117 3300046648 Bacteria 3664
208 Ga0495611_0063826 3300046648 Bacteria 1677
209 Ga0495625_0000004 3300046660 Bacteria 611314
210 Ga0495625_0000718 3300046660 Bacteria 46602
211 Ga0495625_0013644 3300046660 Bacteria 6518
212 Ga0495625_0077246 3300046660 Bacteria 2327
213 Ga0495659_0019857 3300046664 Bacteria 2251
214 Ga0495661_0000328 3300046665 Bacteria 51600
215 Ga0495661_0005239 3300046665 Bacteria 9226
216 Ga0495661_0032926 3300046665 Bacteria 3273
217 Ga0495661_0092297 3300046665 Bacteria 1720
218 Ga0495670_0008118 3300046691 Bacteria 5159
219 Ga0495671_0000104 3300046692 Bacteria 77691
220 Ga0495671_0000961 3300046692 Bacteria 20223
221 Ga0495671_0002084 3300046692 Bacteria 12808
222 Ga0495671_0013051 3300046692 Bacteria 4517
223 Ga0495671_0019095 3300046692 Bacteria 3627
224 Ga0495671_0020168 3300046692 Bacteria 3514
225 Ga0495671_0024498 3300046692 Bacteria 3142
226 Ga0495671_0072978 3300046692 Bacteria 1684
227 Ga0495671_0107108 3300046692 Bacteria 1365
228 Ga0495649_0000086 3300046694 Bacteria 80528
229 Ga0495649_0000566 3300046694 Bacteria 31267
230 Ga0495649_0003258 3300046694 Bacteria 11068
231 Ga0495649_0004622 3300046694 Bacteria 8951
232 Ga0495649_0019813 3300046694 Bacteria 3777
233 Ga0495649_0070217 3300046694 Bacteria 1878
234 Ga0495589_0002317 3300046794 Bacteria 10701
235 Ga0495589_0017782 3300046794 Bacteria 3647
236 Ga0495660_0000072 3300046810 Bacteria 109692
237 Ga0495660_0001881 3300046810 Bacteria 13798
238 Ga0495660_0043588 3300046810 Bacteria 2473
239 Ga0495660_0096841 3300046810 Bacteria 1524
240 Ga0495636_0005865 3300047318 Bacteria 4818
241 Ga0495636_0030393 3300047318 Bacteria 2208
242 Ga0495672_0000034 3300047320 Bacteria 290832
243 Ga0495672_0000746 3300047320 Bacteria 35662
244 Ga0495672_0007913 3300047320 Bacteria 7927
245 Ga0495672_0011885 3300047320 Bacteria 6110
246 Ga0495672_0029140 3300047320 Bacteria 3481
247 Ga0495672_0031083 3300047320 Bacteria 3337
248 Ga0495672_0034182 3300047320 Bacteria 3143
249 Ga0495676_0000004 3300047321 Bacteria 313696
250 Ga0495680_0001986 3300047322 Bacteria 21492
251 Ga0495683_0013393 3300047323 Bacteria 4289
252 Ga0495683_0073858 3300047323 Bacteria 1672
253 Ga0495687_000050 3300047443 Bacteria 200856
254 Ga0495687_000792 3300047443 Bacteria 33996
255 Ga0495677_0001668 3300047445 Bacteria 8929
256 Ga0495679_000294 3300047446 Bacteria 40762
257 Ga0495679_004297 3300047446 Bacteria 6610
258 Ga0495679_009308 3300047446 Bacteria 3941
259 Ga0495685_010903 3300047447 Bacteria 3055
260 Ga0495673_0000124 3300047469 Bacteria 142007
261 Ga0495673_0000138 3300047469 Bacteria 130703
262 Ga0495673_0000190 3300047469 Bacteria 97539
263 Ga0495673_0000315 3300047469 Bacteria 62914
264 Ga0495673_0002565 3300047469 Bacteria 12646
265 Ga0495673_0003069 3300047469 Bacteria 11231
266 Ga0495673_0033597 3300047469 Bacteria 2378
267 Ga0495673_0046143 3300047469 Bacteria 1933
268 Ga0495673_0144757 3300047469 Bacteria 923
269 Ga0495681_0000009 3300047470 Bacteria 205224
270 Ga0495681_0002326 3300047470 Bacteria 13665
271 Ga0495681_0009644 3300047470 Bacteria 5928
272 Ga0495681_0026621 3300047470 Bacteria 3006
273 Ga0495681_0062197 3300047470 Bacteria 1717
274 Ga0495681_0087827 3300047470 Bacteria 1378
275 Ga0495686_0008595 3300047472 Bacteria 7473
276 Ga0495614_0060025 3300048089 Bacteria 1634
277 Ga0495626_0000472 3300048091 Bacteria 40984
278 Ga0495626_0000490 3300048091 Bacteria 39851
279 Ga0495626_0001795 3300048091 Bacteria 16213
280 Ga0495626_0004248 3300048091 Bacteria 8854
281 Ga0495626_0004926 3300048091 Bacteria 8012
282 Ga0495626_0047874 3300048091 Bacteria 1986
283 Ga0496100_0006497 3300048903 Bacteria 6377
284 Ga0496102_0441396 3300048905 Bacteria 1221
285 Ga0496104_0266729 3300048907 Bacteria 1625
286 Ga0496104_0418730 3300048907 Bacteria 1252
287 Ga0496105_0819740 3300048908 Bacteria 706
288 Ga0496106_0017076 3300048909 Bacteria 5371
289 Ga0496107_0008382 3300048910 Bacteria 7151
290 Ga0496110_0172528 3300048913 Bacteria 1962
291 Ga0496114_0436149 3300048917 Bacteria 1160
292 Ga0496116_0003885 3300048919 Bacteria 14561
293 Ga0496118_0049964 3300048921 Bacteria 3215
294 Ga0496118_0110768 3300048921 Bacteria 1822
295 Ga0496119_0003678 3300048922 Bacteria 15728
296 Ga0496119_0006146 3300048922 Bacteria 11240
297 Ga0496119_0027796 3300048922 Bacteria 3876
298 Ga0496120_0001048 3300048923 Bacteria 36748
299 Ga0496120_0001051 3300048923 Bacteria 36572
300 Ga0496120_0218717 3300048923 Bacteria 911
301 Ga0496120_0225938 3300048923 Bacteria 891
302 Ga0496121_0007978 3300048924 Bacteria 12642
303 Ga0496122_0000016 3300048925 Bacteria 443353
304 Ga0496123_0000017 3300048926 Bacteria 415261
305 Ga0496124_0000026 3300048927 Bacteria 385387
306 Ga0496124_0000049 3300048927 Bacteria 269753
307 Ga0496124_0006141 3300048927 Bacteria 13179
308 Ga0496124_0011048 3300048927 Bacteria 9064
309 Ga0496124_0011406 3300048927 Bacteria 8885
310 Ga0496124_0011482 3300048927 Bacteria 8850
311 Ga0496124_0032079 3300048927 Bacteria 4645
312 Ga0496124_0038152 3300048927 Bacteria 4172
313 Ga0496124_0051421 3300048927 Bacteria 3506
314 Ga0496125_0000009 3300048928 Bacteria 677678
315 Ga0496125_0025460 3300048928 Bacteria 5417
316 Ga0496125_0032960 3300048928 Bacteria 4592
317 Ga0496125_0033989 3300048928 Bacteria 4502
318 Ga0496125_0058090 3300048928 Bacteria 3127
319 Ga0496126_0047668 3300048929 Bacteria 3922
320 Ga0495678_000437 3300049459 Bacteria 41568
321 Ga0495678_010025 3300049459 Bacteria 4631
322 Ga0495678_034810 3300049459 Bacteria 2069
323 Ga0495678_045803 3300049459 Bacteria 1723
324 Ga0495678_077614 3300049459 Bacteria 1200
325 Ga0495682_0000001 3300049460 Bacteria 1559116
326 Ga0495682_0001271 3300049460 Bacteria 14154
327 Ga0495682_0001806 3300049460 Bacteria 10789
328 Ga0495682_0002042 3300049460 Bacteria 9898
329 Ga0495682_0011114 3300049460 Bacteria 3468
330 Ga0495682_0019028 3300049460 Bacteria 2584
331 Ga0501034_0000334 3300049571 Bacteria 82414
332 Ga0501034_0016025 3300049571 Bacteria 7692
333 Ga0501036_0042538 3300049572 Bacteria 3846
334 Ga0501037_0005113 3300049573 Bacteria 9539
335 Ga0501038_0032462 3300049574 Bacteria 4606
336 Ga0501039_0564308 3300049575 Bacteria 893
337 Ga0501042_0001445 3300049578 Bacteria 13978
338 Ga0501043_0007416 3300049579 Bacteria 8704
339 Ga0501047_0013474 3300049581 Bacteria 7749
340 Ga0501048_0008639 3300049582 Bacteria 7686
341 Ga0501074_0056787 3300049590 Bacteria 2821
342 nmdc:mga03683_33866_c1 3300050489 Bacteria 2065
343 nmdc:mga00v17_55295_c1 3300050491 Bacteria 2424
344 nmdc:mga00v17_573326_c1 3300050491 Bacteria 729
345 nmdc:mga00v17_809_c1 3300050491 Bacteria 17023
346 nmdc:mga08x19_67136_c1 3300050514 Bacteria 2332
347 nmdc:mga08x19_93082_c1 3300050514 Bacteria 1992
348 Ga0500659_0019559 3300053135 Bacteria 3691
349 Ga0500586_009900 3300053145 Bacteria 2667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042139 Ga0450904_000689 Ga0450904_000689_1008_1625 181
2 3300046538 Ga0495609_0000310 Ga0495609_0000310_11127_11744 184
3 3300046692 Ga0495671_0107108 Ga0495671_0107108_335_952 184
4 3300047469 Ga0495673_0046143 Ga0495673_0046143_786_1403 184
5 3300048908 Ga0496105_0819740 Ga0496105_0819740_129_689 186
6 3300048923 Ga0496120_0218717 Ga0496120_0218717_325_885 186
7 3300046460 Ga0495638_0057352 Ga0495638_0057352_1496_2173 187
8 3300006944 Ga0099823_1000013 Ga0099823_10000138 191
9 3300009036 Ga0105244_10000091 Ga0105244_1000009156 191
10 3300009036 Ga0105244_10008990 Ga0105244_100089908 191
11 3300013104 Ga0157370_10543220 Ga0157370_105432202 191
12 3300025728 Ga0207655_1000044 Ga0207655_100004455 191
13 3300046491 Ga0495584_0052812 Ga0495584_0052812_266_901 191
14 3300046501 Ga0495607_0013029 Ga0495607_0013029_1250_1867 191
15 3300046530 Ga0495654_0000188 Ga0495654_0000188_53229_53864 191
16 3300046692 Ga0495671_0013051 Ga0495671_0013051_349_966 191
17 3300046692 Ga0495671_0020168 Ga0495671_0020168_1912_2547 191
18 3300046694 Ga0495649_0019813 Ga0495649_0019813_563_1198 191
19 3300047320 Ga0495672_0000746 Ga0495672_0000746_1033_1668 191
20 3300047469 Ga0495673_0000315 Ga0495673_0000315_49686_50321 191
21 3300048091 Ga0495626_0000472 Ga0495626_0000472_6515_7150 191
22 3300009011 Ga0105251_10038513 Ga0105251_100385132 192
23 3300042006 Ga0439432_002296 Ga0439432_002296_1232_1846 192
24 3300042136 Ga0450900_007305 Ga0450900_007305_164_778 192
25 3300042142 Ga0450905_004706 Ga0450905_004706_244_858 192
26 3300046507 Ga0495606_0284456 Ga0495606_0284456_308_892 192
27 3300046530 Ga0495654_0184137 Ga0495654_0184137_308_892 192
28 3300048913 Ga0496110_0172528 Ga0496110_0172528_26_640 192
29 3300048927 Ga0496124_0011482 Ga0496124_0011482_7597_8211 192
30 3300048928 Ga0496125_0058090 Ga0496125_0058090_1174_1788 192
31 3300048929 Ga0496126_0047668 Ga0496126_0047668_210_824 192
32 3300049571 Ga0501034_0000334 Ga0501034_0000334_9762_10376 192
33 3300053135 Ga0500659_0019559 Ga0500659_0019559_1215_1829 192
34 iso_pu_bacteria 2643221690 2644505976 193
35 3300005289 Ga0065704_10013398 Ga0065704_100133981 194
36 3300013102 Ga0157371_10106592 Ga0157371_101065922 194
37 3300013104 Ga0157370_10011547 Ga0157370_100115476 194
38 3300048927 Ga0496124_0006141 Ga0496124_0006141_6487_7158 194
39 3300048928 Ga0496125_0032960 Ga0496125_0032960_3068_3739 194
40 3300009011 Ga0105251_10000200 Ga0105251_1000020038 195
41 3300009092 Ga0105250_10000027 Ga0105250_10000027129 195
42 3300009148 Ga0105243_10001286 Ga0105243_1000128614 195
43 3300013104 Ga0157370_10109063 Ga0157370_101090633 195
44 3300013306 Ga0163162_10089918 Ga0163162_100899183 195
45 3300025711 Ga0207696_1000008 Ga0207696_1000008326 195
46 3300025711 Ga0207696_1000012 Ga0207696_1000012212 195
47 3300025735 Ga0207713_1000025 Ga0207713_1000025234 195
48 3300025935 Ga0207709_10001093 Ga0207709_1000109317 195
49 3300046455 Ga0495603_0075493 Ga0495603_0075493_328_951 195
50 3300046475 Ga0495639_0051683 Ga0495639_0051683_1002_1625 195
51 3300046499 Ga0495594_0075635 Ga0495594_0075635_412_1035 195
52 3300046692 Ga0495671_0024498 Ga0495671_0024498_1536_2159 195
53 3300047320 Ga0495672_0029140 Ga0495672_0029140_1605_2216 195
54 3300048091 Ga0495626_0047874 Ga0495626_0047874_1256_1867 195
55 3300048927 Ga0496124_0011048 Ga0496124_0011048_6493_7104 195
56 3300011119 Ga0105246_10179804 Ga0105246_101798042 196
57 3300046517 Ga0495630_0057697 Ga0495630_0057697_15_686 196
58 3300046810 Ga0495660_0096841 Ga0495660_0096841_748_1371 196
59 3300048923 Ga0496120_0225938 Ga0496120_0225938_212_823 196
60 3300048928 Ga0496125_0033989 Ga0496125_0033989_757_1380 196
61 3300009011 Ga0105251_10000187 Ga0105251_1000018730 198
62 3300025735 Ga0207713_1000208 Ga0207713_100020843 198
63 3300046458 Ga0495591_001044 Ga0495591_001044_7428_8063 198
64 3300046517 Ga0495630_0002280 Ga0495630_0002280_11090_11707 198
65 3300046519 Ga0495632_0000275 Ga0495632_0000275_42336_42971 198
66 3300046665 Ga0495661_0000328 Ga0495661_0000328_40419_41054 198
67 3300047322 Ga0495680_0001986 Ga0495680_0001986_11919_12536 198
68 3300047470 Ga0495681_0009644 Ga0495681_0009644_2635_3270 198
69 3300048927 Ga0496124_0032079 Ga0496124_0032079_1452_2054 198
70 iso_pu_bacteria 2511231025 2511381293 198
71 iso_pu_bacteria 2639762793 2640733907 198
72 iso_pu_bacteria 2773857761 2774388561 198
73 iso_pu_bacteria 2773857770 2774438781 198
74 iso_pu_bacteria 2908669403 2908673914 198
75 iso_pu_bacteria 2919182534 2919183803 198
76 iso_pu_bacteria 3000376612 3000377646 198
77 iso_pu_bacteria 8056137416 8056140761 198
78 3300046458 Ga0495591_006729 Ga0495591_006729_3131_3736 199
79 3300046460 Ga0495638_0000544 Ga0495638_0000544_31971_32576 199
80 3300046471 Ga0495650_0029184 Ga0495650_0029184_1785_2390 199
81 3300046492 Ga0495585_0000307 Ga0495585_0000307_10760_11365 199
82 3300046501 Ga0495607_0026558 Ga0495607_0026558_854_1459 199
83 3300046524 Ga0495648_0000237 Ga0495648_0000237_33797_34402 199
84 3300046692 Ga0495671_0000961 Ga0495671_0000961_8418_9023 199
85 3300046794 Ga0495589_0002317 Ga0495589_0002317_113_718 199
86 3300047323 Ga0495683_0013393 Ga0495683_0013393_1290_1895 199
87 3300047469 Ga0495673_0144757 Ga0495673_0144757_229_834 199
88 3300047470 Ga0495681_0062197 Ga0495681_0062197_485_1090 199
89 3300048091 Ga0495626_0001795 Ga0495626_0001795_1834_2439 199
90 iso_pu_bacteria 2511231008 2511279998 199
91 iso_pu_bacteria 2511231014 2511313837 199
92 iso_pu_bacteria 2511231015 2511323328 199
93 iso_pu_bacteria 2511231017 2511329848 199
94 iso_pu_bacteria 2511231017 2511331098 199
95 iso_pu_bacteria 2511231018 2511341567 199
96 iso_pu_bacteria 2511231019 2511343026 199
97 iso_pu_bacteria 2511231020 2511352662 199
98 iso_pu_bacteria 2511231021 2511358204 199
99 iso_pu_bacteria 2511231023 2511371156 199
100 iso_pu_bacteria 2511231025 2511379699 199
101 iso_pu_bacteria 2511231035 2511433627 199
102 iso_pu_bacteria 2554235231 2555247864 199
103 iso_pu_bacteria 2554235234 2555258569 199
104 iso_pu_bacteria 2643221565 2643843676 199
105 iso_pu_bacteria 2643221722 2644667659 199
106 iso_pu_bacteria 2738543015 2739258123 199
107 iso_pu_bacteria 2740892503 2743737149 199
108 iso_pu_bacteria 2765235841 2765583350 199
109 iso_pu_bacteria 2772190666 2772440234 199
110 iso_pu_bacteria 2808606445 2809215303 199
111 iso_pu_bacteria 2884086401 2884087320 199
112 iso_pu_bacteria 2888366609 2888370326 199
113 iso_pu_bacteria 2919108558 2919110430 199
114 iso_pu_bacteria 2923153595 2923156182 199
115 iso_pu_bacteria 2937967321 2937972030 199
116 iso_pu_bacteria 2939568625 2939571187 199
117 iso_pu_bacteria 2939636861 2939641455 199
118 iso_pu_bacteria 2939642701 2939645290 199
119 iso_pu_bacteria 2974302888 2974306782 199
120 iso_pu_bacteria 3007803356 3007806659 199
121 iso_pu_bacteria 8004592986 8004594525 199
122 iso_pu_bacteria 8015394850 8015395769 199
123 iso_pu_bacteria 8052494512 8052497898 199
124 iso_pu_bacteria 8054929484 8054933391 199
125 3300037466 Ga0395898_0047921 Ga0395898_0047921_2996_3640 201
126 3300037471 Ga0395905_0139174 Ga0395905_0139174_545_1189 201
127 3300038443 Ga0395901_0494564 Ga0395901_0494564_12_656 201
128 3300048917 Ga0496114_0436149 Ga0496114_0436149_484_1101 201
129 3300048928 Ga0496125_0000009 Ga0496125_0000009_133563_134171 201
130 3300005272 Ga0065703_1019059 Ga0065703_10190593 202
131 3300005548 Ga0070665_100069650 Ga0070665_1000696503 202
132 3300009011 Ga0105251_10122002 Ga0105251_101220022 202
133 3300009011 Ga0105251_10209587 Ga0105251_102095871 202
134 3300009036 Ga0105244_10057800 Ga0105244_100578002 202
135 3300009036 Ga0105244_10137387 Ga0105244_101373872 202
136 3300009036 Ga0105244_10137970 Ga0105244_101379702 202
137 3300009036 Ga0105244_10163898 Ga0105244_101638981 202
138 3300009092 Ga0105250_10211708 Ga0105250_102117081 202
139 3300009093 Ga0105240_10170728 Ga0105240_101707282 202
140 3300009148 Ga0105243_10000005 Ga0105243_100000054 202
141 3300013104 Ga0157370_10325925 Ga0157370_103259253 202
142 3300017792 Ga0163161_10036404 Ga0163161_100364042 202
143 3300025711 Ga0207696_1023416 Ga0207696_10234161 202
144 3300025728 Ga0207655_1000469 Ga0207655_100046911 202
145 3300025728 Ga0207655_1000641 Ga0207655_10006414 202
146 3300025728 Ga0207655_1025250 Ga0207655_10252501 202
147 3300025735 Ga0207713_1076782 Ga0207713_10767822 202
148 3300025913 Ga0207695_10293633 Ga0207695_102936332 202
149 3300025935 Ga0207709_10000001 Ga0207709_100000011421 202
150 3300027312 Ga0209371_1000006 Ga0209371_1000006570 202
151 3300030500 Ga0268256_1000007 Ga0268256_1000007570 202
152 3300041411 Ga0439466_0001567 Ga0439466_0001567_8133_8744 202
153 3300046460 Ga0495638_0010782 Ga0495638_0010782_36_647 202
154 3300046501 Ga0495607_0004245 Ga0495607_0004245_9840_10451 202
155 3300046501 Ga0495607_0032211 Ga0495607_0032211_512_1123 202
156 3300046519 Ga0495632_0006937 Ga0495632_0006937_1386_1997 202
157 3300046522 Ga0495643_0109139 Ga0495643_0109139_31_642 202
158 3300046525 Ga0495663_0000238 Ga0495663_0000238_11864_12475 202
159 3300046525 Ga0495663_0001239 Ga0495663_0001239_7485_8096 202
160 3300046665 Ga0495661_0005239 Ga0495661_0005239_20_631 202
161 3300046694 Ga0495649_0004622 Ga0495649_0004622_892_1503 202
162 3300049460 Ga0495682_0001806 Ga0495682_0001806_8014_8625 202
163 3300005288 Ga0065714_10003342 Ga0065714_100033425 203
164 3300005288 Ga0065714_10064479 Ga0065714_1006447952 203
165 3300005289 Ga0065704_10078036 Ga0065704_100780361 203
166 3300005289 Ga0065704_10245767 Ga0065704_102457672 203
167 3300005548 Ga0070665_100086661 Ga0070665_1000866612 203
168 3300006051 Ga0075364_10004177 Ga0075364_100041775 203
169 3300006051 Ga0075364_10194931 Ga0075364_101949312 203
170 3300006058 Ga0075432_10003320 Ga0075432_100033204 203
171 3300006058 Ga0075432_10021503 Ga0075432_100215033 203
172 3300006058 Ga0075432_10040173 Ga0075432_100401732 203
173 3300006058 Ga0075432_10076768 Ga0075432_100767682 203
174 3300006177 Ga0075362_10020609 Ga0075362_100206092 203
175 3300006914 Ga0075436_100049782 Ga0075436_1000497824 203
176 3300006914 Ga0075436_100117397 Ga0075436_1001173972 203
177 3300006946 Ga0079104_1001449 Ga0079104_100144916 203
178 3300009011 Ga0105251_10000525 Ga0105251_1000052531 203
179 3300009011 Ga0105251_10083799 Ga0105251_100837994 203
180 3300009036 Ga0105244_10001676 Ga0105244_100016763 203
181 3300009036 Ga0105244_10016814 Ga0105244_100168147 203
182 3300009092 Ga0105250_10000248 Ga0105250_1000024828 203
183 3300009148 Ga0105243_10083068 Ga0105243_100830683 203
184 3300011119 Ga0105246_10100351 Ga0105246_101003512 203
185 3300013100 Ga0157373_10006828 Ga0157373_100068285 203
186 3300014497 Ga0182008_10082149 Ga0182008_100821492 203
187 3300017792 Ga0163161_10007141 Ga0163161_100071414 203
188 3300017792 Ga0163161_10422188 Ga0163161_104221882 203
189 3300025711 Ga0207696_1000368 Ga0207696_100036824 203
190 3300025711 Ga0207696_1006157 Ga0207696_10061571 203
191 3300025711 Ga0207696_1023641 Ga0207696_10236411 203
192 3300025728 Ga0207655_1000020 Ga0207655_1000020198 203
193 3300025728 Ga0207655_1001465 Ga0207655_100146515 203
194 3300025728 Ga0207655_1006034 Ga0207655_10060344 203
195 3300025728 Ga0207655_1014575 Ga0207655_10145753 203
196 3300025728 Ga0207655_1042995 Ga0207655_10429953 203
197 3300025735 Ga0207713_1000082 Ga0207713_1000082155 203
198 3300025735 Ga0207713_1020983 Ga0207713_10209833 203
199 3300025735 Ga0207713_1036914 Ga0207713_10369143 203
200 3300027111 Ga0209281_1000025 Ga0209281_1000025381 203
201 3300027111 Ga0209281_1001348 Ga0209281_10013482 203
202 3300027907 Ga0207428_10033377 Ga0207428_100333775 203
203 3300027907 Ga0207428_10138355 Ga0207428_101383552 203
204 3300030521 Ga0307511_10081325 Ga0307511_100813253 203
205 3300041405 Ga0439438_000246 Ga0439438_000246_6959_7576 203
206 3300041407 Ga0439447_001198 Ga0439447_001198_4324_4941 203
207 3300041411 Ga0439466_0004384 Ga0439466_0004384_3501_4118 203
208 3300041494 Ga0451837_0198712 Ga0451837_0198712_176_793 203
209 3300042009 Ga0439451_003953 Ga0439451_003953_2093_2710 203
210 3300042145 Ga0450906_001898 Ga0450906_001898_644_1261 203
211 3300042146 Ga0450907_002319 Ga0450907_002319_674_1291 203
212 3300042147 Ga0450910_000542 Ga0450910_000542_420_1037 203
213 3300046452 Ga0495617_001957 Ga0495617_001957_5487_6104 203
214 3300046452 Ga0495617_002672 Ga0495617_002672_799_1416 203
215 3300046457 Ga0495590_0005689 Ga0495590_0005689_1740_2414 203
216 3300046458 Ga0495591_000012 Ga0495591_000012_188090_188704 203
217 3300046458 Ga0495591_000257 Ga0495591_000257_39052_39663 203
218 3300046460 Ga0495638_0022936 Ga0495638_0022936_1159_1776 203
219 3300046471 Ga0495650_0000872 Ga0495650_0000872_34939_35556 203
220 3300046474 Ga0495605_0003388 Ga0495605_0003388_696_1313 203
221 3300046474 Ga0495605_0009504 Ga0495605_0009504_2700_3314 203
222 3300046474 Ga0495605_0011820 Ga0495605_0011820_1575_2249 203
223 3300046474 Ga0495605_0014032 Ga0495605_0014032_3366_3980 203
224 3300046491 Ga0495584_0000394 Ga0495584_0000394_2606_3280 203
225 3300046491 Ga0495584_0057743 Ga0495584_0057743_104_721 203
226 3300046492 Ga0495585_0000276 Ga0495585_0000276_10142_10759 203
227 3300046492 Ga0495585_0009457 Ga0495585_0009457_4094_4711 203
228 3300046492 Ga0495585_0075570 Ga0495585_0075570_698_1315 203
229 3300046501 Ga0495607_0028056 Ga0495607_0028056_365_982 203
230 3300046501 Ga0495607_0153312 Ga0495607_0153312_319_936 203
231 3300046506 Ga0495583_0040490 Ga0495583_0040490_1340_1957 203
232 3300046507 Ga0495606_0000182 Ga0495606_0000182_40929_41546 203
233 3300046507 Ga0495606_0073205 Ga0495606_0073205_414_1031 203
234 3300046512 Ga0495610_0000159 Ga0495610_0000159_19193_19810 203
235 3300046512 Ga0495610_0000174 Ga0495610_0000174_45898_46515 203
236 3300046515 Ga0495620_0000385 Ga0495620_0000385_16403_17026 203
237 3300046515 Ga0495620_0058263 Ga0495620_0058263_721_1338 203
238 3300046519 Ga0495632_0000261 Ga0495632_0000261_2610_3284 203
239 3300046519 Ga0495632_0008171 Ga0495632_0008171_382_999 203
240 3300046520 Ga0495637_0000962 Ga0495637_0000962_9541_10158 203
241 3300046520 Ga0495637_0001080 Ga0495637_0001080_8616_9233 203
242 3300046520 Ga0495637_0001343 Ga0495637_0001343_12317_12991 203
243 3300046522 Ga0495643_0026731 Ga0495643_0026731_1028_1702 203
244 3300046524 Ga0495648_0000758 Ga0495648_0000758_27625_28242 203
245 3300046524 Ga0495648_0003976 Ga0495648_0003976_5653_6267 203
246 3300046524 Ga0495648_0028954 Ga0495648_0028954_269_886 203
247 3300046524 Ga0495648_0038565 Ga0495648_0038565_870_1487 203
248 3300046528 Ga0495642_0000049 Ga0495642_0000049_66114_66788 203
249 3300046530 Ga0495654_0007335 Ga0495654_0007335_4798_5415 203
250 3300046530 Ga0495654_0017203 Ga0495654_0017203_11_622 203
251 3300046530 Ga0495654_0053838 Ga0495654_0053838_136_810 203
252 3300046538 Ga0495609_0003737 Ga0495609_0003737_5925_6599 203
253 3300046538 Ga0495609_0004906 Ga0495609_0004906_5630_6247 203
254 3300046538 Ga0495609_0028940 Ga0495609_0028940_823_1440 203
255 3300046542 Ga0495597_0010943 Ga0495597_0010943_2733_3407 203
256 3300046542 Ga0495597_0019838 Ga0495597_0019838_899_1516 203
257 3300046557 Ga0495622_0004620 Ga0495622_0004620_4798_5415 203
258 3300046558 Ga0495633_0055756 Ga0495633_0055756_604_1221 203
259 3300046648 Ga0495611_0001526 Ga0495611_0001526_2620_3237 203
260 3300046648 Ga0495611_0012117 Ga0495611_0012117_1131_1748 203
261 3300046660 Ga0495625_0000004 Ga0495625_0000004_377525_378142 203
262 3300046660 Ga0495625_0000718 Ga0495625_0000718_27610_28227 203
263 3300046660 Ga0495625_0013644 Ga0495625_0013644_4054_4671 203
264 3300046660 Ga0495625_0077246 Ga0495625_0077246_620_1237 203
265 3300046664 Ga0495659_0019857 Ga0495659_0019857_1285_1959 203
266 3300046665 Ga0495661_0032926 Ga0495661_0032926_1633_2250 203
267 3300046691 Ga0495670_0008118 Ga0495670_0008118_2511_3128 203
268 3300046692 Ga0495671_0000104 Ga0495671_0000104_19730_20347 203
269 3300046692 Ga0495671_0002084 Ga0495671_0002084_9606_10223 203
270 3300046692 Ga0495671_0019095 Ga0495671_0019095_2750_3367 203
271 3300046694 Ga0495649_0000086 Ga0495649_0000086_28232_28906 203
272 3300046694 Ga0495649_0000566 Ga0495649_0000566_25254_25871 203
273 3300046694 Ga0495649_0003258 Ga0495649_0003258_7883_8500 203
274 3300046794 Ga0495589_0017782 Ga0495589_0017782_1420_2094 203
275 3300046810 Ga0495660_0000072 Ga0495660_0000072_57947_58561 203
276 3300046810 Ga0495660_0001881 Ga0495660_0001881_2168_2788 203
277 3300046810 Ga0495660_0043588 Ga0495660_0043588_1553_2170 203
278 3300047318 Ga0495636_0005865 Ga0495636_0005865_2593_3267 203
279 3300047320 Ga0495672_0000034 Ga0495672_0000034_42358_42972 203
280 3300047320 Ga0495672_0007913 Ga0495672_0007913_5679_6353 203
281 3300047320 Ga0495672_0011885 Ga0495672_0011885_3789_4406 203
282 3300047320 Ga0495672_0031083 Ga0495672_0031083_195_812 203
283 3300047321 Ga0495676_0000004 Ga0495676_0000004_147378_147995 203
284 3300047323 Ga0495683_0073858 Ga0495683_0073858_109_732 203
285 3300047443 Ga0495687_000050 Ga0495687_000050_127968_128585 203
286 3300047443 Ga0495687_000792 Ga0495687_000792_27302_27976 203
287 3300047446 Ga0495679_000294 Ga0495679_000294_28487_29104 203
288 3300047446 Ga0495679_009308 Ga0495679_009308_3065_3682 203
289 3300047469 Ga0495673_0000124 Ga0495673_0000124_85579_86190 203
290 3300047469 Ga0495673_0000138 Ga0495673_0000138_126174_126791 203
291 3300047469 Ga0495673_0000190 Ga0495673_0000190_31567_32184 203
292 3300047469 Ga0495673_0002565 Ga0495673_0002565_8165_8782 203
293 3300047469 Ga0495673_0003069 Ga0495673_0003069_8945_9562 203
294 3300047470 Ga0495681_0000009 Ga0495681_0000009_18947_19564 203
295 3300047470 Ga0495681_0002326 Ga0495681_0002326_11785_12402 203
296 3300047470 Ga0495681_0087827 Ga0495681_0087827_124_741 203
297 3300047472 Ga0495686_0008595 Ga0495686_0008595_4627_5244 203
298 3300048089 Ga0495614_0060025 Ga0495614_0060025_195_812 203
299 3300048091 Ga0495626_0000490 Ga0495626_0000490_13509_14183 203
300 3300048091 Ga0495626_0004926 Ga0495626_0004926_3845_4462 203
301 3300048903 Ga0496100_0006497 Ga0496100_0006497_1520_2134 203
302 3300048905 Ga0496102_0441396 Ga0496102_0441396_355_972 203
303 3300048907 Ga0496104_0266729 Ga0496104_0266729_334_945 203
304 3300048907 Ga0496104_0418730 Ga0496104_0418730_230_847 203
305 3300048909 Ga0496106_0017076 Ga0496106_0017076_795_1412 203
306 3300048910 Ga0496107_0008382 Ga0496107_0008382_5313_5930 203
307 3300048922 Ga0496119_0003678 Ga0496119_0003678_9649_10266 203
308 3300048922 Ga0496119_0006146 Ga0496119_0006146_1928_2545 203
309 3300048922 Ga0496119_0027796 Ga0496119_0027796_2441_3052 203
310 3300048923 Ga0496120_0001048 Ga0496120_0001048_27421_28038 203
311 3300048923 Ga0496120_0001051 Ga0496120_0001051_27836_28453 203
312 3300048924 Ga0496121_0007978 Ga0496121_0007978_768_1379 203
313 3300048927 Ga0496124_0000026 Ga0496124_0000026_134893_135507 203
314 3300048927 Ga0496124_0000049 Ga0496124_0000049_27863_28480 203
315 3300048927 Ga0496124_0011406 Ga0496124_0011406_3726_4340 203
316 3300048927 Ga0496124_0051421 Ga0496124_0051421_488_1105 203
317 3300049459 Ga0495678_000437 Ga0495678_000437_27410_28084 203
318 3300049459 Ga0495678_010025 Ga0495678_010025_2461_3078 203
319 3300049459 Ga0495678_034810 Ga0495678_034810_508_1125 203
320 3300049459 Ga0495678_045803 Ga0495678_045803_1080_1697 203
321 3300049460 Ga0495682_0000001 Ga0495682_0000001_316271_316885 203
322 3300049460 Ga0495682_0001271 Ga0495682_0001271_745_1362 203
323 3300049460 Ga0495682_0002042 Ga0495682_0002042_6481_7104 203
324 3300049460 Ga0495682_0011114 Ga0495682_0011114_1889_2563 203
325 3300049571 Ga0501034_0016025 Ga0501034_0016025_790_1407 203
326 3300049572 Ga0501036_0042538 Ga0501036_0042538_3186_3803 203
327 3300049573 Ga0501037_0005113 Ga0501037_0005113_816_1433 203
328 3300049574 Ga0501038_0032462 Ga0501038_0032462_3215_3832 203
329 3300049575 Ga0501039_0564308 Ga0501039_0564308_232_864 203
330 3300049578 Ga0501042_0001445 Ga0501042_0001445_4807_5424 203
331 3300049579 Ga0501043_0007416 Ga0501043_0007416_770_1387 203
332 3300049581 Ga0501047_0013474 Ga0501047_0013474_4510_5127 203
333 3300049582 Ga0501048_0008639 Ga0501048_0008639_1183_1800 203
334 3300049590 Ga0501074_0056787 Ga0501074_0056787_1833_2450 203
335 3300050489 nmdc:mga03683_33866_c1 nmdc:mga03683_33866_c1_1425_2042 203
336 3300050491 nmdc:mga00v17_55295_c1 nmdc:mga00v17_55295_c1_958_1575 203
337 3300050491 nmdc:mga00v17_573326_c1 nmdc:mga00v17_573326_c1_68_685 203
338 3300050491 nmdc:mga00v17_809_c1 nmdc:mga00v17_809_c1_10610_11221 203
339 3300050514 nmdc:mga08x19_67136_c1 nmdc:mga08x19_67136_c1_202_819 203
340 3300050514 nmdc:mga08x19_93082_c1 nmdc:mga08x19_93082_c1_713_1330 203
341 3300013102 Ga0157371_10075715 Ga0157371_100757153 207
342 3300013306 Ga0163162_10059343 Ga0163162_100593434 207
343 3300041411 Ga0439466_0020034 Ga0439466_0020034_1026_1655 207
344 3300042009 Ga0439451_000786 Ga0439451_000786_2715_3344 207
345 3300042013 Ga0439456_000462 Ga0439456_000462_4085_4714 207
346 3300046457 Ga0495590_0025850 Ga0495590_0025850_1387_2016 207
347 3300047446 Ga0495679_004297 Ga0495679_004297_4645_5274 207
348 3300015265 Ga0182005_1023452 Ga0182005_10234522 210
349 2162886007 SwRhRL2b_contig_2188596 SwRhRL2b_0911.00005900 212
350 3300009092 Ga0105250_10032702 Ga0105250_100327021 212
351 3300011119 Ga0105246_10000002 Ga0105246_1000000237 212
352 3300013308 Ga0157375_10133822 Ga0157375_101338223 212
353 3300046452 Ga0495617_010937 Ga0495617_010937_1292_2017 212
354 3300046458 Ga0495591_007737 Ga0495591_007737_1480_2205 212
355 3300046460 Ga0495638_0030992 Ga0495638_0030992_1308_2033 212
356 3300046471 Ga0495650_0000902 Ga0495650_0000902_30084_30809 212
357 3300046474 Ga0495605_0033082 Ga0495605_0033082_1736_2461 212
358 3300046491 Ga0495584_0015057 Ga0495584_0015057_2426_3151 212
359 3300046492 Ga0495585_0006179 Ga0495585_0006179_1039_1764 212
360 3300046506 Ga0495583_0000538 Ga0495583_0000538_41935_42660 212
361 3300046513 Ga0495616_0009550 Ga0495616_0009550_618_1343 212
362 3300046518 Ga0495631_0005333 Ga0495631_0005333_3450_4175 212
363 3300046519 Ga0495632_0000295 Ga0495632_0000295_6910_7635 212
364 3300046520 Ga0495637_0001440 Ga0495637_0001440_8898_9623 212
365 3300046523 Ga0495644_0059253 Ga0495644_0059253_638_1363 212
366 3300046528 Ga0495642_0000198 Ga0495642_0000198_5007_5732 212
367 3300046530 Ga0495654_0107576 Ga0495654_0107576_256_981 212
368 3300046538 Ga0495609_0000720 Ga0495609_0000720_995_1720 212
369 3300046542 Ga0495597_0141129 Ga0495597_0141129_139_864 212
370 3300046615 Ga0495656_0037976 Ga0495656_0037976_206_931 212
371 3300046615 Ga0495656_0150281 Ga0495656_0150281_231_875 212
372 3300046616 Ga0495668_0082849 Ga0495668_0082849_336_1061 212
373 3300046648 Ga0495611_0063826 Ga0495611_0063826_175_825 212
374 3300046665 Ga0495661_0092297 Ga0495661_0092297_178_903 212
375 3300046692 Ga0495671_0072978 Ga0495671_0072978_882_1607 212
376 3300046694 Ga0495649_0070217 Ga0495649_0070217_1084_1809 212
377 3300047318 Ga0495636_0030393 Ga0495636_0030393_1291_2016 212
378 3300047320 Ga0495672_0034182 Ga0495672_0034182_1466_2191 212
379 3300047445 Ga0495677_0001668 Ga0495677_0001668_3638_4363 212
380 3300047447 Ga0495685_010903 Ga0495685_010903_1212_1937 212
381 3300047469 Ga0495673_0033597 Ga0495673_0033597_1036_1761 212
382 3300047470 Ga0495681_0026621 Ga0495681_0026621_1203_1928 212
383 3300048091 Ga0495626_0004248 Ga0495626_0004248_2426_3151 212
384 3300048919 Ga0496116_0003885 Ga0496116_0003885_12305_12943 212
385 3300048921 Ga0496118_0049964 Ga0496118_0049964_918_1574 212
386 3300048921 Ga0496118_0110768 Ga0496118_0110768_435_1073 212
387 3300048925 Ga0496122_0000016 Ga0496122_0000016_89736_90374 212
388 3300048926 Ga0496123_0000017 Ga0496123_0000017_399104_399742 212
389 3300048927 Ga0496124_0038152 Ga0496124_0038152_1512_2150 212
390 3300048928 Ga0496125_0025460 Ga0496125_0025460_1507_2145 212
391 3300049459 Ga0495678_077614 Ga0495678_077614_244_969 212
392 3300049460 Ga0495682_0019028 Ga0495682_0019028_953_1678 212
393 3300053145 Ga0500586_009900 Ga0500586_009900_71_796 212
394 iso_pu_bacteria 8055878733 8055882790 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

50

238

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4181 14 211
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.4115 20 206
8thr-assembly1.cif.gz_A structure of the human vesicular monoamine transporter 2 (vmat2) bound to tetrabenazine in an occluded conformation 0.4094 22 212
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4087 10 211
7mjs-assembly1.cif.gz_X single-particle cryo-em structure of major facilitator superfamily domain containing 2a in complex with lpc-18:3 0.4082 27 210
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6535 15 208 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6035 15 208 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5725 13 202 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5386 13 202 1.20.1250.20
af_P0AD99_6_430_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5343 11 210 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A0J6M456-F1-model_v4 LysE family translocator 0.9799 10 211 GO:0005886
GO:0015171
AF-A0A5P2AIF9-F1-model_v4 Lysine transporter LysE 0.9648 10 211 GO:0005886
GO:0015171
AF-A0A2N8TKV5-F1-model_v4 Lysine transporter LysE 0.9626 10 211 GO:0005886
GO:0015171
AF-A0A0J6M456-F1-model_v4 LysE family translocator 0.9611 10 211 GO:0005886
GO:0015171
AF-A0A6G9YAS8-F1-model_v4 LysE family translocator 0.9557 11 212 GO:0005886
GO:0015171

Feature Viewer

pLDDT pTM Quality
87.12 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map