F432872

General Info

Members Datasets Scaffolds Average Seq Length
394 185 788 279

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100040075|Ga0075431_1000400753
Length 318
Sequence MWKNTWSGVSNRRLLRSCGIDPSSEARPPGPEPRAPKKVHRLRTYASFVRFSHSVFALPFALTGALLALHQQGTWSADFIFWRLVWIVVAMVAARSAAMGFNRLVDAGYDALNPRTASRELPRGAMTRLEAALFVAVSVIVFVFAADKLGPVCFALSPVALVIVFWYSLAKRVTNYTQFFLGLAMAVAPVGGWLAAGGRGGWEPWLLALAIGTWVGGFDVLYACQDLDFDLQHGLRSIPVRFGLRRALVISRVLHIVTWVTDLGWIYLCGVGGVAALLAWEQSMVSEHDLSQVKRAFDLNGYVGILYLATTAVAVYLR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
120 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
121 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
122 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
123 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
124 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
125 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0
Rhizoplane 4.31
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 11.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100040075 3300006847 Bacteria 4827
2 Ga0065712_10091981 3300005290 Viruses 2343
3 Ga0065712_10102744 3300005290 Bacteria 1959
4 Ga0065712_10144867 3300005290 Unclassified 1417
5 Ga0065715_10031263 3300005293 Bacteria 2819
6 Ga0065715_10120275 3300005293 Bacteria 2262
7 Ga0065715_10184799 3300005293 Bacteria 1452
8 Ga0065715_10188944 3300005293 Bacteria 1427
9 Ga0065715_10235585 3300005293 Viruses 1203
10 Ga0070683_100009233 3300005329 Bacteria 8424
11 Ga0070683_100046792 3300005329 Bacteria 3997
12 Ga0070683_100080911 3300005329 Bacteria 3040
13 Ga0070683_100198721 3300005329 Bacteria 1904
14 Ga0070690_100071811 3300005330 Unclassified 2249
15 Ga0070670_100006839 3300005331 Bacteria 9662
16 Ga0070670_100018916 3300005331 Bacteria 5907
17 Ga0070670_100029588 3300005331 Bacteria 4715
18 Ga0070670_100032392 3300005331 Bacteria 4502
19 Ga0070670_100055327 3300005331 Bacteria 3406
20 Ga0070670_100093231 3300005331 Bacteria 2590
21 Ga0070670_100593481 3300005331 Bacteria 991
22 Ga0068869_100013680 3300005334 Bacteria 5405
23 Ga0070666_10008944 3300005335 Bacteria 6236
24 Ga0070666_10202676 3300005335 Bacteria 1396
25 Ga0070689_100039871 3300005340 Bacteria 3598
26 Ga0070689_100050114 3300005340 Bacteria 3225
27 Ga0070687_100173556 3300005343 Bacteria 1285
28 Ga0070661_100019334 3300005344 Bacteria 4855
29 Ga0070661_100419480 3300005344 Bacteria 1061
30 Ga0070669_100013978 3300005353 Bacteria 5708
31 Ga0070669_100057055 3300005353 Bacteria 2864
32 Ga0070669_100062054 3300005353 Unclassified 2747
33 Ga0070675_100017204 3300005354 Bacteria 5745
34 Ga0070675_100179936 3300005354 Bacteria 1828
35 Ga0070674_100016757 3300005356 Bacteria 4596
36 Ga0070674_100077932 3300005356 Bacteria 2361
37 Ga0070674_100290620 3300005356 Bacteria 1299
38 Ga0070673_100030356 3300005364 Bacteria 4043
39 Ga0070667_100279236 3300005367 Bacteria 1499
40 Ga0070663_100011303 3300005455 Bacteria 5598
41 Ga0070663_100139351 3300005455 Bacteria 1850
42 Ga0070662_100424762 3300005457 Bacteria 1100
43 Ga0070681_10460322 3300005458 Bacteria 1184
44 Ga0068867_100074594 3300005459 Unclassified 2543
45 Ga0070685_10003293 3300005466 Bacteria 8205
46 Ga0070685_10045393 3300005466 Bacteria 2520
47 Ga0070685_10190616 3300005466 Unclassified 1326
48 Ga0070698_100314384 3300005471 Unclassified 1497
49 Ga0070684_100179808 3300005535 Bacteria 1923
50 Ga0070697_100339989 3300005536 Bacteria 1295
51 Ga0070672_100017844 3300005543 Bacteria 5116
52 Ga0070672_100556023 3300005543 Bacteria 997
53 Ga0070665_100046463 3300005548 Bacteria 4362
54 Ga0070704_100053281 3300005549 Bacteria 2859
55 Ga0070664_100002901 3300005564 Bacteria 13874
56 Ga0070664_100008083 3300005564 Bacteria 8502
57 Ga0070664_100184898 3300005564 Bacteria 1854
58 Ga0068854_100035734 3300005578 Bacteria 3480
59 Ga0070702_100020742 3300005615 Bacteria 3447
60 Ga0070702_100166698 3300005615 Bacteria 1429
61 Ga0068852_100479803 3300005616 Unclassified 1235
62 Ga0068864_100031471 3300005618 Bacteria 4502
63 Ga0068864_100118517 3300005618 Bacteria 2364
64 Ga0068863_100010801 3300005841 Bacteria 8856
65 Ga0068863_100049221 3300005841 Bacteria 3996
66 Ga0075365_10011187 3300006038 Bacteria 5267
67 Ga0075368_10058929 3300006042 Bacteria 1535
68 Ga0075364_10004297 3300006051 Bacteria 8181
69 Ga0075364_10351650 3300006051 Bacteria 1004
70 Ga0075366_10077562 3300006195 Unclassified 1983
71 Ga0068871_100041804 3300006358 Bacteria 3677
72 Ga0075428_100005950 3300006844 Bacteria 13556
73 Ga0075428_100006210 3300006844 Bacteria 13292
74 Ga0075428_100039614 3300006844 Bacteria 5186
75 Ga0075428_100108179 3300006844 Bacteria 3030
76 Ga0075428_100120829 3300006844 Bacteria 2852
77 Ga0075430_100002319 3300006846 Bacteria 15813
78 Ga0075430_100017232 3300006846 Bacteria 6152
79 Ga0075430_100028894 3300006846 Bacteria 4708
80 Ga0075430_100288055 3300006846 Bacteria 1359
81 Ga0075431_100004102 3300006847 Bacteria 14228
82 Ga0075431_100011761 3300006847 Bacteria 8830
83 Ga0075431_100018285 3300006847 Bacteria 7131
84 Ga0075431_100025951 3300006847 Bacteria 6006
85 Ga0075431_100029812 3300006847 Bacteria 5618
86 Ga0075431_100097608 3300006847 Bacteria 3034
87 Ga0075431_100122701 3300006847 Bacteria 2681
88 Ga0075431_100197222 3300006847 Bacteria 2061
89 Ga0075431_100412725 3300006847 Bacteria 1350
90 Ga0075433_10027410 3300006852 Bacteria 4832
91 Ga0075433_10050721 3300006852 Bacteria 3613
92 Ga0075433_10369263 3300006852 Bacteria 1267
93 Ga0075434_100001079 3300006871 Bacteria 22322
94 Ga0075429_100002617 3300006880 Bacteria 15180
95 Ga0075429_100012495 3300006880 Bacteria 7365
96 Ga0075429_100142167 3300006880 Bacteria 2101
97 Ga0075429_100207909 3300006880 Unclassified 1715
98 Ga0068865_100110806 3300006881 Bacteria 2025
99 Ga0097620_100128383 3300006931 Bacteria 2606
100 Ga0075435_100004639 3300007076 Bacteria 9468
101 Ga0105240_10209184 3300009093 Bacteria 2281
102 Ga0111539_10003731 3300009094 Bacteria 20043
103 Ga0111539_10026508 3300009094 Bacteria 7085
104 Ga0111539_10076506 3300009094 Bacteria 3940
105 Ga0111539_10143885 3300009094 Bacteria 2791
106 Ga0111539_10162575 3300009094 Bacteria 2611
107 Ga0111539_10204733 3300009094 Bacteria 2300
108 Ga0114129_10000006 3300009147 Bacteria 157531
109 Ga0114129_10000086 3300009147 Bacteria 86772
110 Ga0114129_10002028 3300009147 Bacteria 27757
111 Ga0114129_10016405 3300009147 Bacteria 10541
112 Ga0114129_10023419 3300009147 Bacteria 8755
113 Ga0114129_10029872 3300009147 Bacteria 7718
114 Ga0114129_10031981 3300009147 Bacteria 7438
115 Ga0114129_10166185 3300009147 Bacteria 3011
116 Ga0114129_10175533 3300009147 Bacteria 2918
117 Ga0114129_10250839 3300009147 Bacteria 2376
118 Ga0114129_10380376 3300009147 Bacteria 1864
119 Ga0114129_10708688 3300009147 Bacteria 1293
120 Ga0105241_10085733 3300009174 Bacteria 2476
121 Ga0105242_10095720 3300009176 Bacteria 2507
122 Ga0105242_10183918 3300009176 Bacteria 1845
123 Ga0105248_10031464 3300009177 Bacteria 5931
124 Ga0105248_10044075 3300009177 Bacteria 5003
125 Ga0105248_10598488 3300009177 Unclassified 1244
126 Ga0105238_10412062 3300009551 Bacteria 1345
127 Ga0105249_10001775 3300009553 Bacteria 18798
128 Ga0105249_10691916 3300009553 Bacteria 1079
129 Ga0157370_10436469 3300013104 Bacteria 1204
130 Ga0157378_10028962 3300013297 Bacteria 4888
131 Ga0157372_10447527 3300013307 Bacteria 1505
132 Ga0157375_10208983 3300013308 Bacteria 2109
133 Ga0163163_10019551 3300014325 Bacteria 6362
134 Ga0163163_10132602 3300014325 Unclassified 2532
135 Ga0163163_10146753 3300014325 Bacteria 2403
136 Ga0163163_10156123 3300014325 Bacteria 2326
137 Ga0157380_10007449 3300014326 Bacteria 7771
138 Ga0157380_10227120 3300014326 Bacteria 1674
139 Ga0157377_10306055 3300014745 Bacteria 1051
140 Ga0157379_10444246 3300014968 Bacteria 1196
141 Ga0157376_10135067 3300014969 Bacteria 2206
142 Ga0157376_10203649 3300014969 Bacteria 1823
143 Ga0207697_10000983 3300025315 Bacteria 15969
144 Ga0207697_10076545 3300025315 Bacteria 1406
145 Ga0207688_10148119 3300025901 Bacteria 1385
146 Ga0207680_10137752 3300025903 Bacteria 1615
147 Ga0207645_10026612 3300025907 Bacteria 3737
148 Ga0207707_10379749 3300025912 Bacteria 1215
149 Ga0207662_10003979 3300025918 Bacteria 7699
150 Ga0207662_10277739 3300025918 Unclassified 1107
151 Ga0207649_10021903 3300025920 Bacteria 3688
152 Ga0207681_10064446 3300025923 Bacteria 2530
153 Ga0207681_10066610 3300025923 Bacteria 2494
154 Ga0207681_10171284 3300025923 Bacteria 1646
155 Ga0207681_10263353 3300025923 Bacteria 1351
156 Ga0207694_10149992 3300025924 Bacteria 1878
157 Ga0207650_10014068 3300025925 Bacteria 5556
158 Ga0207650_10029034 3300025925 Bacteria 3971
159 Ga0207650_10035626 3300025925 Bacteria 3616
160 Ga0207650_10053082 3300025925 Bacteria 3004
161 Ga0207650_10057529 3300025925 Bacteria 2892
162 Ga0207650_10166295 3300025925 Unclassified 1750
163 Ga0207659_10080112 3300025926 Bacteria 2412
164 Ga0207659_10104330 3300025926 Viruses 2144
165 Ga0207659_10120877 3300025926 Bacteria 2007
166 Ga0207659_10259969 3300025926 Bacteria 1412
167 Ga0207644_10019590 3300025931 Bacteria 4592
168 Ga0207644_10280111 3300025931 Bacteria 1339
169 Ga0207690_10134202 3300025932 Bacteria 1816
170 Ga0207706_10167728 3300025933 Bacteria 1929
171 Ga0207706_10451703 3300025933 Bacteria 1111
172 Ga0207670_10046371 3300025936 Bacteria 2887
173 Ga0207669_10150873 3300025937 Bacteria 1628
174 Ga0207669_10247630 3300025937 Bacteria 1325
175 Ga0207704_10249259 3300025938 Bacteria 1332
176 Ga0207704_10484292 3300025938 Unclassified 994
177 Ga0207691_10016772 3300025940 Bacteria 6950
178 Ga0207691_10019770 3300025940 Bacteria 6369
179 Ga0207691_10025808 3300025940 Bacteria 5514
180 Ga0207711_10051800 3300025941 Bacteria 3517
181 Ga0207711_10243359 3300025941 Viruses 1650
182 Ga0207711_10405012 3300025941 Bacteria 1268
183 Ga0207689_10034918 3300025942 Bacteria 4177
184 Ga0207689_10038954 3300025942 Bacteria 3935
185 Ga0207689_10284877 3300025942 Bacteria 1368
186 Ga0207661_10003180 3300025944 Bacteria 11387
187 Ga0207661_10042139 3300025944 Bacteria 3598
188 Ga0207661_10123082 3300025944 Bacteria 2211
189 Ga0207679_10001534 3300025945 Bacteria 14424
190 Ga0207679_10003831 3300025945 Bacteria 9324
191 Ga0207679_10088217 3300025945 Bacteria 2391
192 Ga0207679_10213346 3300025945 Viruses 1620
193 Ga0207651_10010533 3300025960 Bacteria 5130
194 Ga0207651_10111802 3300025960 Bacteria 2052
195 Ga0207712_10236347 3300025961 Bacteria 1470
196 Ga0207668_10164947 3300025972 Bacteria 1731
197 Ga0207668_10304269 3300025972 Bacteria 1317
198 Ga0207640_10104128 3300025981 Bacteria 1997
199 Ga0207640_10227469 3300025981 Unclassified 1432
200 Ga0207677_10045010 3300026023 Bacteria 2945
201 Ga0207677_10218687 3300026023 Unclassified 1526
202 Ga0207678_10034334 3300026067 Bacteria 4418
203 Ga0207678_10058108 3300026067 Bacteria 3328
204 Ga0207678_10171416 3300026067 Bacteria 1853
205 Ga0207708_10002942 3300026075 Bacteria 12562
206 Ga0207708_10195287 3300026075 Bacteria 1613
207 Ga0207641_10043445 3300026088 Bacteria 3775
208 Ga0207641_10786104 3300026088 Bacteria 941
209 Ga0207648_10207478 3300026089 Unclassified 1739
210 Ga0207676_10094394 3300026095 Bacteria 2465
211 Ga0207674_10285563 3300026116 Unclassified 1598
212 Ga0207683_10029100 3300026121 Bacteria 4781
213 Ga0207683_10036707 3300026121 Bacteria 4268
214 Ga0207683_10169690 3300026121 Bacteria 1976
215 Ga0207698_10420974 3300026142 Unclassified 1282
216 Ga0209971_1034139 3300027682 Unclassified 1223
217 Ga0207428_10001565 3300027907 Bacteria 23885
218 Ga0207428_10066354 3300027907 Bacteria 2844
219 Ga0268266_10033444 3300028379 Bacteria 4371
220 Ga0268265_10186293 3300028380 Unclassified 1788
221 Ga0268264_10452885 3300028381 Bacteria 1244
222 Ga0307408_100032108 3300031548 Bacteria 3660
223 Ga0307408_100105722 3300031548 Bacteria 2152
224 Ga0307408_100296155 3300031548 Bacteria 1353
225 Ga0307405_10030931 3300031731 Bacteria 3145
226 Ga0307405_10058717 3300031731 Unclassified 2422
227 Ga0307405_10202075 3300031731 Unclassified 1444
228 Ga0307413_10076283 3300031824 Bacteria 2130
229 Ga0307413_10100120 3300031824 Bacteria 1913
230 Ga0307410_10068698 3300031852 Bacteria 2448
231 Ga0307406_10009340 3300031901 Bacteria 5497
232 Ga0307406_10021732 3300031901 Bacteria 3799
233 Ga0307406_10459666 3300031901 Bacteria 1023
234 Ga0307407_10017672 3300031903 Bacteria 3586
235 Ga0307412_10020109 3300031911 Bacteria 4057
236 Ga0307412_10040938 3300031911 Bacteria 3000
237 Ga0307412_10160569 3300031911 Unclassified 1669
238 Ga0307412_10526153 3300031911 Bacteria 989
239 Ga0307409_100032142 3300031995 Unclassified 3800
240 Ga0307409_100070830 3300031995 Unclassified 2769
241 Ga0307416_100039356 3300032002 Bacteria 3659
242 Ga0307416_100081280 3300032002 Unclassified 2739
243 Ga0307416_100184012 3300032002 Unclassified 1961
244 Ga0307416_100668417 3300032002 Bacteria 1125
245 Ga0307411_10042835 3300032005 Bacteria 2892
246 Ga0307411_10067842 3300032005 Unclassified 2402
247 Ga0307411_10083093 3300032005 Unclassified 2211
248 Ga0307411_10116426 3300032005 Bacteria 1924
249 Ga0307415_100080326 3300032126 Unclassified 2326
250 Ga0307415_100165847 3300032126 Unclassified 1717
251 Ga0307415_100197498 3300032126 Bacteria 1593
252 Ga0307415_100238313 3300032126 Bacteria 1470
253 Ga0307415_100293317 3300032126 Bacteria 1344
254 Ga0373933_0156675 3300035724 Bacteria 1445
255 Ga0373947_0014749 3300035725 Bacteria 4483
256 Ga0373937_0028403 3300036401 Bacteria 5062
257 Ga0373925_0044665 3300037068 Bacteria 3290
258 Ga0439461_0043312 3300041410 Bacteria 979
259 Ga0439433_0018065 3300041999 Bacteria 1568
260 Ga0450920_001999 3300042122 Bacteria 3442
261 Ga0450923_000426 3300042125 Bacteria 4544
262 Ga0450895_002143 3300042132 Bacteria 1444
263 Ga0450896_012644 3300042133 Bacteria 1195
264 Ga0450908_016898 3300042184 Bacteria 1298
265 Ga0439435_0001171 3300042436 Bacteria 4713
266 Ga0439435_0095966 3300042436 Bacteria 906
267 Ga0439464_0002574 3300042439 Bacteria 4482
268 Ga0439460_0043962 3300042461 Unclassified 1321
269 Ga0450918_003473 3300042531 Bacteria 2925
270 Ga0451577_0434182 3300042876 Bacteria 1192
271 Ga0451576_0039290 3300045051 Bacteria 5008
272 Ga0495603_0067575 3300046455 Bacteria 2104
273 Ga0495629_0330296 3300046459 Bacteria 1042
274 Ga0495651_0431243 3300046462 Bacteria 855
275 Ga0495630_0161054 3300046517 Bacteria 1708
276 Ga0495644_0215506 3300046523 Unclassified 742
277 Ga0495640_0099570 3300046533 Bacteria 1909
278 Ga0495647_0036121 3300046681 Bacteria 1859
279 Ga0495658_0189853 3300046683 Bacteria 1277
280 Ga0496104_0003935 3300048907 Bacteria 12850
281 Ga0496108_0001909 3300048911 Bacteria 16668
282 Ga0496108_0018917 3300048911 Bacteria 5649
283 Ga0496109_0008025 3300048912 Bacteria 8949
284 Ga0496109_0011886 3300048912 Bacteria 7494
285 Ga0496109_0082810 3300048912 Bacteria 2958
286 Ga0496109_0535342 3300048912 Unclassified 1105
287 Ga0496110_0032847 3300048913 Bacteria 4486
288 Ga0496111_0079239 3300048914 Unclassified 2396
289 Ga0496112_0001272 3300048915 Bacteria 19131
290 Ga0496112_0001309 3300048915 Bacteria 18920
291 Ga0496112_0076181 3300048915 Bacteria 3318
292 Ga0496112_0183842 3300048915 Bacteria 2054
293 Ga0496112_0277778 3300048915 Bacteria 1623
294 Ga0496113_0133420 3300048916 Bacteria 1950
295 Ga0496113_0135692 3300048916 Unclassified 1933
296 Ga0496113_0218307 3300048916 Bacteria 1519
297 Ga0501033_0365062 3300049570 Unclassified 1010
298 Ga0501034_0281363 3300049571 Bacteria 1603
299 Ga0501038_0237897 3300049574 Bacteria 1447
300 Ga0501039_0010716 3300049575 Bacteria 6985
301 Ga0501039_0182275 3300049575 Bacteria 1651
302 Ga0501040_0034330 3300049576 Bacteria 3437
303 Ga0501041_0007550 3300049577 Bacteria 6383
304 Ga0501041_0040009 3300049577 Bacteria 2845
305 Ga0501042_0059210 3300049578 Bacteria 2735
306 Ga0501046_0080555 3300049580 Bacteria 2516
307 Ga0501047_0304913 3300049581 Bacteria 1434
308 Ga0501067_0093616 3300049583 Bacteria 1668
309 Ga0501067_0151262 3300049583 Bacteria 1293
310 Ga0501071_0005906 3300049587 Bacteria 7919
311 Ga0501071_0098417 3300049587 Bacteria 2155
312 Ga0501071_0119982 3300049587 Bacteria 1949
313 Ga0501072_0014415 3300049588 Bacteria 6059
314 Ga0501072_0025306 3300049588 Bacteria 4623
315 Ga0501072_0203664 3300049588 Unclassified 1578
316 Ga0501074_0065439 3300049590 Bacteria 2617
317 Ga0501074_0231140 3300049590 Unclassified 1316
318 Ga0501075_0010672 3300049591 Bacteria 6464
319 Ga0501075_0041211 3300049591 Bacteria 3460
320 Ga0501075_0158355 3300049591 Bacteria 1727
321 Ga0501076_0004336 3300049592 Bacteria 10068
322 Ga0501076_0057677 3300049592 Bacteria 3084
323 Ga0501076_0115846 3300049592 Bacteria 2168
324 Ga0501076_0136380 3300049592 Bacteria 1992
325 Ga0501077_0032113 3300049593 Bacteria 3342
326 Ga0501077_0052680 3300049593 Unclassified 2584
327 Ga0501077_0090793 3300049593 Bacteria 1936
328 Ga0501077_0098642 3300049593 Bacteria 1852
329 Ga0501225_0052853 3300049705 Bacteria 1133
330 Ga0501079_0083118 3300049741 Bacteria 2477
331 Ga0501079_0094946 3300049741 Bacteria 2311
332 Ga0501080_0183409 3300049742 Bacteria 1925
333 Ga0501080_0430792 3300049742 Bacteria 1184
334 Ga0501081_0026605 3300049743 Bacteria 3902
335 Ga0501081_0029409 3300049743 Bacteria 3713
336 Ga0501081_0079613 3300049743 Bacteria 2292
337 Ga0501081_0113739 3300049743 Bacteria 1922
338 Ga0501045_0006810 3300049824 Bacteria 7918
339 Ga0501045_0169963 3300049824 Bacteria 1624
340 Ga0501045_0573654 3300049824 Bacteria 836
341 nmdc:mga00v17_128624_c1 3300050491 Bacteria 1617
342 nmdc:mga0k408_62854_c1 3300050493 Unclassified 2159
343 nmdc:mga05p37_11403_c1 3300050507 Bacteria 10579
344 nmdc:mga05p37_156423_c1 3300050507 Bacteria 2785
345 nmdc:mga05p37_15661_c1 3300050507 Bacteria 9114
346 nmdc:mga05p37_3819_c1 3300050507 Bacteria 17617
347 nmdc:mga05p37_495_c1 3300050507 Bacteria 43222
348 nmdc:mga05p37_5252_c1 3300050507 Bacteria 15201
349 nmdc:mga05p37_55203_c1 3300050507 Bacteria 4887
350 nmdc:mga05p37_6503_c2 3300050507 Bacteria 11287
351 nmdc:mga05p37_961_c1 3300050507 Bacteria 32612
352 nmdc:mga09592_10896_c1 3300050508 Bacteria 7400
353 nmdc:mga09592_2031_c1 3300050508 Bacteria 16324
354 nmdc:mga09592_95562_c1 3300050508 Unclassified 2542
355 nmdc:mga0qj67_132900_c1 3300050509 Unclassified 2016
356 nmdc:mga0qj67_2135_c1 3300050509 Bacteria 14068
357 nmdc:mga0qj67_59993_c1 3300050509 Bacteria 3018
358 nmdc:mga0qj67_65383_c1 3300050509 Bacteria 2895
359 nmdc:mga06r32_109075_c1 3300050510 Bacteria 2722
360 nmdc:mga06r32_16856_c1 3300050510 Bacteria 6663
361 nmdc:mga06r32_457903_c1 3300050510 Bacteria 1255
362 nmdc:mga06r32_487333_c1 3300050510 Unclassified 1211
363 nmdc:mga06r32_79922_c1 3300050510 Bacteria 3181
364 nmdc:mga08y16_11518_c1 3300050511 Bacteria 9292
365 nmdc:mga08y16_164134_c1 3300050511 Bacteria 2307
366 nmdc:mga08y16_32515_c1 3300050511 Bacteria 5483
367 nmdc:mga08y16_450854_c1 3300050511 Bacteria 1312
368 nmdc:mga08y16_455525_c1 3300050511 Unclassified 1304
369 nmdc:mga0n895_10454_c1 3300050512 Bacteria 8201
370 nmdc:mga0n895_253910_c1 3300050512 Unclassified 1784
371 nmdc:mga0n895_391440_c1 3300050512 Bacteria 1406
372 nmdc:mga0n895_46140_c1 3300050512 Bacteria 4255
373 nmdc:mga0rr50_16018_c1 3300050513 Bacteria 4965
374 nmdc:mga0rr50_493328_c1 3300050513 Bacteria 1041
375 nmdc:mga0a205_109181_c1 3300050515 Bacteria 2665
376 nmdc:mga0a205_195000_c1 3300050515 Bacteria 1916
377 nmdc:mga0a205_67600_c1 3300050515 Bacteria 3452
378 Ga0495601_0071292 3300053077 Bacteria 2219
379 Ga0495601_0228740 3300053077 Bacteria 1215
380 Ga0495619_0178486 3300053085 Bacteria 1469
381 Ga0501084_0007641 3300054114 Bacteria 8913
382 Ga0501084_0103342 3300054114 Bacteria 2393
383 Ga0501084_0118672 3300054114 Bacteria 2224
384 Ga0501084_0192753 3300054114 Bacteria 1719
385 Ga0501084_0741406 3300054114 Bacteria 828
386 Ga0590071_008204 3300059421 Bacteria 2462
387 Ga0590071_011597 3300059421 Bacteria 2061
388 Ga0590071_040063 3300059421 Bacteria 1127
389 Ga0590074_007455 3300059423 Bacteria 1819
390 Ga0590077_000434 3300059426 Bacteria 11752
391 Ga0501082_0255244 3300060353 Bacteria 1525
392 Ga0501082_0268694 3300060353 Bacteria 1484
393 Ga0530510_0023581 3300061734 Bacteria 4386
394 Ga0530510_0403699 3300061734 Bacteria 1030
395 Ga0075431_100040075
396 Ga0065712_10091981
397 Ga0065712_10102744
398 Ga0065712_10144867
399 Ga0065715_10031263
400 Ga0065715_10120275
401 Ga0065715_10184799
402 Ga0065715_10188944
403 Ga0065715_10235585
404 Ga0070683_100009233
405 Ga0070683_100046792
406 Ga0070683_100080911
407 Ga0070683_100198721
408 Ga0070690_100071811
409 Ga0070670_100006839
410 Ga0070670_100018916
411 Ga0070670_100029588
412 Ga0070670_100032392
413 Ga0070670_100055327
414 Ga0070670_100093231
415 Ga0070670_100593481
416 Ga0068869_100013680
417 Ga0070666_10008944
418 Ga0070666_10202676
419 Ga0070689_100039871
420 Ga0070689_100050114
421 Ga0070687_100173556
422 Ga0070661_100019334
423 Ga0070661_100419480
424 Ga0070669_100013978
425 Ga0070669_100057055
426 Ga0070669_100062054
427 Ga0070675_100017204
428 Ga0070675_100179936
429 Ga0070674_100016757
430 Ga0070674_100077932
431 Ga0070674_100290620
432 Ga0070673_100030356
433 Ga0070667_100279236
434 Ga0070663_100011303
435 Ga0070663_100139351
436 Ga0070662_100424762
437 Ga0070681_10460322
438 Ga0068867_100074594
439 Ga0070685_10003293
440 Ga0070685_10045393
441 Ga0070685_10190616
442 Ga0070698_100314384
443 Ga0070684_100179808
444 Ga0070697_100339989
445 Ga0070672_100017844
446 Ga0070672_100556023
447 Ga0070665_100046463
448 Ga0070704_100053281
449 Ga0070664_100002901
450 Ga0070664_100008083
451 Ga0070664_100184898
452 Ga0068854_100035734
453 Ga0070702_100020742
454 Ga0070702_100166698
455 Ga0068852_100479803
456 Ga0068864_100031471
457 Ga0068864_100118517
458 Ga0068863_100010801
459 Ga0068863_100049221
460 Ga0075365_10011187
461 Ga0075368_10058929
462 Ga0075364_10004297
463 Ga0075364_10351650
464 Ga0075366_10077562
465 Ga0068871_100041804
466 Ga0075428_100005950
467 Ga0075428_100006210
468 Ga0075428_100039614
469 Ga0075428_100108179
470 Ga0075428_100120829
471 Ga0075430_100002319
472 Ga0075430_100017232
473 Ga0075430_100028894
474 Ga0075430_100288055
475 Ga0075431_100004102
476 Ga0075431_100011761
477 Ga0075431_100018285
478 Ga0075431_100025951
479 Ga0075431_100029812
480 Ga0075431_100097608
481 Ga0075431_100122701
482 Ga0075431_100197222
483 Ga0075431_100412725
484 Ga0075433_10027410
485 Ga0075433_10050721
486 Ga0075433_10369263
487 Ga0075434_100001079
488 Ga0075429_100002617
489 Ga0075429_100012495
490 Ga0075429_100142167
491 Ga0075429_100207909
492 Ga0068865_100110806
493 Ga0097620_100128383
494 Ga0075435_100004639
495 Ga0105240_10209184
496 Ga0111539_10003731
497 Ga0111539_10026508
498 Ga0111539_10076506
499 Ga0111539_10143885
500 Ga0111539_10162575
501 Ga0111539_10204733
502 Ga0114129_10000006
503 Ga0114129_10000086
504 Ga0114129_10002028
505 Ga0114129_10016405
506 Ga0114129_10023419
507 Ga0114129_10029872
508 Ga0114129_10031981
509 Ga0114129_10166185
510 Ga0114129_10175533
511 Ga0114129_10250839
512 Ga0114129_10380376
513 Ga0114129_10708688
514 Ga0105241_10085733
515 Ga0105242_10095720
516 Ga0105242_10183918
517 Ga0105248_10031464
518 Ga0105248_10044075
519 Ga0105248_10598488
520 Ga0105238_10412062
521 Ga0105249_10001775
522 Ga0105249_10691916
523 Ga0157370_10436469
524 Ga0157378_10028962
525 Ga0157372_10447527
526 Ga0157375_10208983
527 Ga0163163_10019551
528 Ga0163163_10132602
529 Ga0163163_10146753
530 Ga0163163_10156123
531 Ga0157380_10007449
532 Ga0157380_10227120
533 Ga0157377_10306055
534 Ga0157379_10444246
535 Ga0157376_10135067
536 Ga0157376_10203649
537 Ga0207697_10000983
538 Ga0207697_10076545
539 Ga0207688_10148119
540 Ga0207680_10137752
541 Ga0207645_10026612
542 Ga0207707_10379749
543 Ga0207662_10003979
544 Ga0207662_10277739
545 Ga0207649_10021903
546 Ga0207681_10064446
547 Ga0207681_10066610
548 Ga0207681_10171284
549 Ga0207681_10263353
550 Ga0207694_10149992
551 Ga0207650_10014068
552 Ga0207650_10029034
553 Ga0207650_10035626
554 Ga0207650_10053082
555 Ga0207650_10057529
556 Ga0207650_10166295
557 Ga0207659_10080112
558 Ga0207659_10104330
559 Ga0207659_10120877
560 Ga0207659_10259969
561 Ga0207644_10019590
562 Ga0207644_10280111
563 Ga0207690_10134202
564 Ga0207706_10167728
565 Ga0207706_10451703
566 Ga0207670_10046371
567 Ga0207669_10150873
568 Ga0207669_10247630
569 Ga0207704_10249259
570 Ga0207704_10484292
571 Ga0207691_10016772
572 Ga0207691_10019770
573 Ga0207691_10025808
574 Ga0207711_10051800
575 Ga0207711_10243359
576 Ga0207711_10405012
577 Ga0207689_10034918
578 Ga0207689_10038954
579 Ga0207689_10284877
580 Ga0207661_10003180
581 Ga0207661_10042139
582 Ga0207661_10123082
583 Ga0207679_10001534
584 Ga0207679_10003831
585 Ga0207679_10088217
586 Ga0207679_10213346
587 Ga0207651_10010533
588 Ga0207651_10111802
589 Ga0207712_10236347
590 Ga0207668_10164947
591 Ga0207668_10304269
592 Ga0207640_10104128
593 Ga0207640_10227469
594 Ga0207677_10045010
595 Ga0207677_10218687
596 Ga0207678_10034334
597 Ga0207678_10058108
598 Ga0207678_10171416
599 Ga0207708_10002942
600 Ga0207708_10195287
601 Ga0207641_10043445
602 Ga0207641_10786104
603 Ga0207648_10207478
604 Ga0207676_10094394
605 Ga0207674_10285563
606 Ga0207683_10029100
607 Ga0207683_10036707
608 Ga0207683_10169690
609 Ga0207698_10420974
610 Ga0209971_1034139
611 Ga0207428_10001565
612 Ga0207428_10066354
613 Ga0268266_10033444
614 Ga0268265_10186293
615 Ga0268264_10452885
616 Ga0307408_100032108
617 Ga0307408_100105722
618 Ga0307408_100296155
619 Ga0307405_10030931
620 Ga0307405_10058717
621 Ga0307405_10202075
622 Ga0307413_10076283
623 Ga0307413_10100120
624 Ga0307410_10068698
625 Ga0307406_10009340
626 Ga0307406_10021732
627 Ga0307406_10459666
628 Ga0307407_10017672
629 Ga0307412_10020109
630 Ga0307412_10040938
631 Ga0307412_10160569
632 Ga0307412_10526153
633 Ga0307409_100032142
634 Ga0307409_100070830
635 Ga0307416_100039356
636 Ga0307416_100081280
637 Ga0307416_100184012
638 Ga0307416_100668417
639 Ga0307411_10042835
640 Ga0307411_10067842
641 Ga0307411_10083093
642 Ga0307411_10116426
643 Ga0307415_100080326
644 Ga0307415_100165847
645 Ga0307415_100197498
646 Ga0307415_100238313
647 Ga0307415_100293317
648 Ga0373933_0156675
649 Ga0373947_0014749
650 Ga0373937_0028403
651 Ga0373925_0044665
652 Ga0439461_0043312
653 Ga0439433_0018065
654 Ga0450920_001999
655 Ga0450923_000426
656 Ga0450895_002143
657 Ga0450896_012644
658 Ga0450908_016898
659 Ga0439435_0001171
660 Ga0439435_0095966
661 Ga0439464_0002574
662 Ga0439460_0043962
663 Ga0450918_003473
664 Ga0451577_0434182
665 Ga0451576_0039290
666 Ga0495603_0067575
667 Ga0495629_0330296
668 Ga0495651_0431243
669 Ga0495630_0161054
670 Ga0495644_0215506
671 Ga0495640_0099570
672 Ga0495647_0036121
673 Ga0495658_0189853
674 Ga0496104_0003935
675 Ga0496108_0001909
676 Ga0496108_0018917
677 Ga0496109_0008025
678 Ga0496109_0011886
679 Ga0496109_0082810
680 Ga0496109_0535342
681 Ga0496110_0032847
682 Ga0496111_0079239
683 Ga0496112_0001272
684 Ga0496112_0001309
685 Ga0496112_0076181
686 Ga0496112_0183842
687 Ga0496112_0277778
688 Ga0496113_0133420
689 Ga0496113_0135692
690 Ga0496113_0218307
691 Ga0501033_0365062
692 Ga0501034_0281363
693 Ga0501038_0237897
694 Ga0501039_0010716
695 Ga0501039_0182275
696 Ga0501040_0034330
697 Ga0501041_0007550
698 Ga0501041_0040009
699 Ga0501042_0059210
700 Ga0501046_0080555
701 Ga0501047_0304913
702 Ga0501067_0093616
703 Ga0501067_0151262
704 Ga0501071_0005906
705 Ga0501071_0098417
706 Ga0501071_0119982
707 Ga0501072_0014415
708 Ga0501072_0025306
709 Ga0501072_0203664
710 Ga0501074_0065439
711 Ga0501074_0231140
712 Ga0501075_0010672
713 Ga0501075_0041211
714 Ga0501075_0158355
715 Ga0501076_0004336
716 Ga0501076_0057677
717 Ga0501076_0115846
718 Ga0501076_0136380
719 Ga0501077_0032113
720 Ga0501077_0052680
721 Ga0501077_0090793
722 Ga0501077_0098642
723 Ga0501225_0052853
724 Ga0501079_0083118
725 Ga0501079_0094946
726 Ga0501080_0183409
727 Ga0501080_0430792
728 Ga0501081_0026605
729 Ga0501081_0029409
730 Ga0501081_0079613
731 Ga0501081_0113739
732 Ga0501045_0006810
733 Ga0501045_0169963
734 Ga0501045_0573654
735 nmdc:mga00v17_128624_c1
736 nmdc:mga0k408_62854_c1
737 nmdc:mga05p37_11403_c1
738 nmdc:mga05p37_156423_c1
739 nmdc:mga05p37_15661_c1
740 nmdc:mga05p37_3819_c1
741 nmdc:mga05p37_495_c1
742 nmdc:mga05p37_5252_c1
743 nmdc:mga05p37_55203_c1
744 nmdc:mga05p37_6503_c2
745 nmdc:mga05p37_961_c1
746 nmdc:mga09592_10896_c1
747 nmdc:mga09592_2031_c1
748 nmdc:mga09592_95562_c1
749 nmdc:mga0qj67_132900_c1
750 nmdc:mga0qj67_2135_c1
751 nmdc:mga0qj67_59993_c1
752 nmdc:mga0qj67_65383_c1
753 nmdc:mga06r32_109075_c1
754 nmdc:mga06r32_16856_c1
755 nmdc:mga06r32_457903_c1
756 nmdc:mga06r32_487333_c1
757 nmdc:mga06r32_79922_c1
758 nmdc:mga08y16_11518_c1
759 nmdc:mga08y16_164134_c1
760 nmdc:mga08y16_32515_c1
761 nmdc:mga08y16_450854_c1
762 nmdc:mga08y16_455525_c1
763 nmdc:mga0n895_10454_c1
764 nmdc:mga0n895_253910_c1
765 nmdc:mga0n895_391440_c1
766 nmdc:mga0n895_46140_c1
767 nmdc:mga0rr50_16018_c1
768 nmdc:mga0rr50_493328_c1
769 nmdc:mga0a205_109181_c1
770 nmdc:mga0a205_195000_c1
771 nmdc:mga0a205_67600_c1
772 Ga0495601_0071292
773 Ga0495601_0228740
774 Ga0495619_0178486
775 Ga0501084_0007641
776 Ga0501084_0103342
777 Ga0501084_0118672
778 Ga0501084_0192753
779 Ga0501084_0741406
780 Ga0590071_008204
781 Ga0590071_011597
782 Ga0590071_040063
783 Ga0590074_007455
784 Ga0590077_000434
785 Ga0501082_0255244
786 Ga0501082_0268694
787 Ga0530510_0023581
788 Ga0530510_0403699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

57

308

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9097 12 280
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8874 12 280
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7643 1 279
4tq6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.762 6 281
4tq6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7544 6 281
ID Description Score Start End Superfamily
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9267 16 153 1.10.357.140
af_P0AEA5_14_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9197 19 172 1.10.357.140
af_Q54U71_333_454_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9184 166 282 1.20.120.1780
af_Q8I7J4_224_349_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.918 161 282 1.20.120.1780
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9153 162 281 1.20.120.1780
ID Description Score Start End GO Terms
AF-A0A7Y5U2X4-F1-model_v4 UbiA family prenyltransferase 0.9826 3 283 GO:0005886
GO:0006744
GO:0016765
AF-A0A7V8WEA2-F1-model_v4 UbiA family prenyltransferase 0.9818 91 283 GO:0005886
GO:0006744
GO:0016765
AF-A0A7C4U5G3-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9811 40 283 GO:0005886
GO:0006744
GO:0016765
AF-A0A381Z278-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9803 60 283 GO:0005886
GO:0006744
GO:0016765
AF-A0A7C3PVR0-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9791 1 238 GO:0005886
GO:0006744
GO:0016765

Map