F432629

General Info

Members Datasets Scaffolds Average Seq Length
393 190 786 422

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10006397|Ga0265338_100063975
Length 486
Sequence VPGDPRRAPRTAGPALGKPGKSGGPRPPLDFTIMAEPYGTHSDRRGRPGGDHSRTDPSDADQSRVYQYGAAQYGGRLAVRSVPVPDPGDDFLDQIPVPAAVAWVRQSAGLAGWGEAARVTLPAGADRFTAAEKWLRELADNAQVDDAVRRRGSGLVAFGTFTFDDTSDGSVLVVPRAVLGRDGTGNAWLTTVTPAGSTPEEAAVPFQPPALPGDIRWHDGSLSAMEWEQAVGEAVRRIRHSAELRKVVLARDLYASADRPVDPRVLLRRLAARYPGCYTFAVDGLVGATPELLISRDSWEVGSLVLAGTTSRGATPAEDSELARALLGSAKENEEHEYAAASLRDTLAPLCAAMYIAPRPELIRLPNVQHLGTRVRGTLAAVKSALALVAAVHPTAAVGGTPTDAAVEVIRELESMDRERYAGPVGWVDADGNGEWGIALRCAQLDGHRARLFAGCGIVAGSDPAAELAETESKFRPMRTALEQSG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
188 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
189 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
190 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 1.02
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.11
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10006397 3300028800 Bacteria 15016
2 Ga0070658_10198885 3300005327 Bacteria 1690
3 Ga0070683_100050339 3300005329 Bacteria 3856
4 Ga0070683_100069679 3300005329 Bacteria 3279
5 Ga0070667_100031004 3300005367 Bacteria 4458
6 Ga0070709_10000300 3300005434 Bacteria 31461
7 Ga0070709_10126774 3300005434 Bacteria 1737
8 Ga0070714_100000583 3300005435 Bacteria 26209
9 Ga0070714_100002089 3300005435 Bacteria 14640
10 Ga0070714_100005423 3300005435 Bacteria 9733
11 Ga0070714_100025023 3300005435 Bacteria 4922
12 Ga0070714_100025321 3300005435 Bacteria 4896
13 Ga0070714_100054661 3300005435 Bacteria 3411
14 Ga0070714_100118641 3300005435 Bacteria 2351
15 Ga0070714_100140636 3300005435 Bacteria 2166
16 Ga0070714_100141035 3300005435 Bacteria 2163
17 Ga0070713_100001870 3300005436 Bacteria 13588
18 Ga0070713_100004086 3300005436 Bacteria 9722
19 Ga0070713_100012650 3300005436 Bacteria 6201
20 Ga0070713_100013070 3300005436 Bacteria 6116
21 Ga0070713_100020877 3300005436 Bacteria 5028
22 Ga0070713_100030947 3300005436 Bacteria 4256
23 Ga0070710_10001803 3300005437 Bacteria 10115
24 Ga0070711_100011747 3300005439 Bacteria 5445
25 Ga0070711_100012893 3300005439 Bacteria 5237
26 Ga0070711_100037215 3300005439 Bacteria 3264
27 Ga0070711_100091167 3300005439 Bacteria 2196
28 Ga0070705_100062762 3300005440 Bacteria 2214
29 Ga0070708_100021672 3300005445 Bacteria 5438
30 Ga0070708_100029881 3300005445 Bacteria 4704
31 Ga0070708_100045128 3300005445 Bacteria 3881
32 Ga0070708_100081174 3300005445 Bacteria 2935
33 Ga0070708_100196922 3300005445 Bacteria 1885
34 Ga0070681_10037632 3300005458 Bacteria 4854
35 Ga0070706_100005344 3300005467 Bacteria 12241
36 Ga0070706_100006071 3300005467 Bacteria 11417
37 Ga0070706_100025056 3300005467 Bacteria 5491
38 Ga0070706_100104466 3300005467 Bacteria 2635
39 Ga0070706_100163166 3300005467 Bacteria 2081
40 Ga0070707_100000684 3300005468 Bacteria 33600
41 Ga0070707_100003195 3300005468 Bacteria 15508
42 Ga0070707_100007416 3300005468 Bacteria 10187
43 Ga0070707_100017433 3300005468 Bacteria 6751
44 Ga0070707_100032213 3300005468 Bacteria 4993
45 Ga0070707_100069921 3300005468 Bacteria 3381
46 Ga0070707_100090964 3300005468 Bacteria 2954
47 Ga0070707_100099296 3300005468 Bacteria 2820
48 Ga0070707_100200702 3300005468 Bacteria 1944
49 Ga0070707_100207222 3300005468 Bacteria 1911
50 Ga0070698_100003261 3300005471 Bacteria 17825
51 Ga0070698_100004003 3300005471 Bacteria 16216
52 Ga0070698_100004293 3300005471 Bacteria 15670
53 Ga0070698_100006357 3300005471 Bacteria 12830
54 Ga0070698_100013511 3300005471 Bacteria 8642
55 Ga0070699_100050520 3300005518 Bacteria 3600
56 Ga0070699_100067622 3300005518 Bacteria 3103
57 Ga0070699_100143057 3300005518 Bacteria 2113
58 Ga0070679_100037810 3300005530 Bacteria 4796
59 Ga0070679_100125147 3300005530 Bacteria 2553
60 Ga0070684_100132780 3300005535 Bacteria 2247
61 Ga0070684_100168096 3300005535 Bacteria 1991
62 Ga0070704_100103476 3300005549 Bacteria 2151
63 Ga0068856_100079630 3300005614 Bacteria 3249
64 Ga0070702_100053439 3300005615 Bacteria 2321
65 Ga0068852_100225603 3300005616 Bacteria 1784
66 Ga0068864_100086255 3300005618 Bacteria 2762
67 Ga0068863_100103447 3300005841 Bacteria 2709
68 Ga0068858_100015935 3300005842 Bacteria 7061
69 Ga0068860_100228251 3300005843 Bacteria 1809
70 Ga0070717_10009071 3300006028 Bacteria 7468
71 Ga0070717_10027674 3300006028 Bacteria 4532
72 Ga0070717_10031058 3300006028 Bacteria 4295
73 Ga0070717_10038037 3300006028 Bacteria 3910
74 Ga0070717_10171645 3300006028 Bacteria 1886
75 Ga0070715_10005071 3300006163 Bacteria 4369
76 Ga0070716_100040016 3300006173 Bacteria 2606
77 Ga0070716_100073414 3300006173 Bacteria 2018
78 Ga0070716_100074629 3300006173 Bacteria 2004
79 Ga0070712_100009016 3300006175 Bacteria 6281
80 Ga0097621_100047269 3300006237 Bacteria 3487
81 Ga0068871_100059107 3300006358 Bacteria 3123
82 Ga0075433_10046147 3300006852 Bacteria 3788
83 Ga0075434_100007409 3300006871 Bacteria 10161
84 Ga0075434_100406976 3300006871 Bacteria 1382
85 Ga0075436_100015384 3300006914 Bacteria 5240
86 Ga0075435_100003256 3300007076 Bacteria 10997
87 Ga0075435_100301030 3300007076 Bacteria 1371
88 Ga0157369_10032295 3300013105 Bacteria 5759
89 Ga0157374_10012022 3300013296 Bacteria 7516
90 Ga0163162_10019124 3300013306 Bacteria 6718
91 Ga0163163_10031381 3300014325 Bacteria 5127
92 Ga0163163_10035741 3300014325 Bacteria 4822
93 Ga0157379_10015627 3300014968 Bacteria 6667
94 Ga0206356_11098751 3300020070 Bacteria 1874
95 Ga0206354_11678251 3300020081 Bacteria 2470
96 Ga0206353_11639587 3300020082 Bacteria 2277
97 Ga0213873_10000032 3300021358 Bacteria 36510
98 Ga0213876_10051857 3300021384 Bacteria 2168
99 Ga0213875_10000102 3300021388 Bacteria 96815
100 Ga0213875_10000159 3300021388 Bacteria 71303
101 Ga0213875_10000243 3300021388 Bacteria 54536
102 Ga0213875_10010490 3300021388 Bacteria 4633
103 Ga0213875_10041378 3300021388 Bacteria 2168
104 Ga0224712_10030710 3300022467 Bacteria 1942
105 Ga0224572_1003284 3300024225 Bacteria 2718
106 Ga0207692_10001510 3300025898 Bacteria 8744
107 Ga0207692_10009142 3300025898 Bacteria 4127
108 Ga0207685_10003920 3300025905 Bacteria 3696
109 Ga0207699_10000373 3300025906 Bacteria 23641
110 Ga0207699_10005720 3300025906 Bacteria 5977
111 Ga0207699_10008579 3300025906 Bacteria 5051
112 Ga0207699_10046126 3300025906 Bacteria 2547
113 Ga0207699_10064360 3300025906 Bacteria 2218
114 Ga0207699_10086848 3300025906 Bacteria 1954
115 Ga0207684_10002478 3300025910 Bacteria 18590
116 Ga0207684_10003082 3300025910 Bacteria 16508
117 Ga0207684_10024056 3300025910 Bacteria 5197
118 Ga0207684_10059927 3300025910 Bacteria 3233
119 Ga0207684_10089648 3300025910 Bacteria 2620
120 Ga0207684_10166024 3300025910 Bacteria 1902
121 Ga0207684_10177637 3300025910 Bacteria 1836
122 Ga0207707_10036650 3300025912 Bacteria 4287
123 Ga0207693_10002838 3300025915 Bacteria 15009
124 Ga0207693_10007382 3300025915 Bacteria 9041
125 Ga0207693_10016495 3300025915 Bacteria 5902
126 Ga0207693_10017098 3300025915 Bacteria 5788
127 Ga0207693_10018737 3300025915 Bacteria 5509
128 Ga0207693_10044707 3300025915 Bacteria 3480
129 Ga0207663_10003240 3300025916 Bacteria 7933
130 Ga0207663_10005197 3300025916 Bacteria 6550
131 Ga0207663_10036424 3300025916 Bacteria 2960
132 Ga0207652_10171245 3300025921 Bacteria 1948
133 Ga0207646_10000121 3300025922 Bacteria 106299
134 Ga0207646_10002090 3300025922 Bacteria 23959
135 Ga0207646_10006784 3300025922 Bacteria 11785
136 Ga0207646_10021216 3300025922 Bacteria 6005
137 Ga0207646_10090406 3300025922 Bacteria 2740
138 Ga0207646_10159151 3300025922 Bacteria 2037
139 Ga0207646_10199048 3300025922 Bacteria 1809
140 Ga0207700_10000825 3300025928 Bacteria 17915
141 Ga0207700_10001247 3300025928 Bacteria 14501
142 Ga0207700_10002216 3300025928 Bacteria 11153
143 Ga0207700_10011587 3300025928 Bacteria 5631
144 Ga0207700_10012292 3300025928 Bacteria 5512
145 Ga0207700_10015813 3300025928 Bacteria 4991
146 Ga0207700_10026053 3300025928 Bacteria 4072
147 Ga0207700_10031353 3300025928 Bacteria 3775
148 Ga0207700_10064332 3300025928 Bacteria 2793
149 Ga0207664_10000662 3300025929 Bacteria 23702
150 Ga0207664_10002310 3300025929 Bacteria 12586
151 Ga0207664_10008628 3300025929 Bacteria 7123
152 Ga0207664_10016962 3300025929 Bacteria 5326
153 Ga0207664_10078227 3300025929 Bacteria 2682
154 Ga0207665_10002413 3300025939 Bacteria 12646
155 Ga0207665_10004471 3300025939 Bacteria 9286
156 Ga0207665_10005662 3300025939 Bacteria 8323
157 Ga0207665_10038808 3300025939 Bacteria 3173
158 Ga0207665_10049434 3300025939 Bacteria 2825
159 Ga0207661_10167366 3300025944 Bacteria 1911
160 Ga0207661_10279146 3300025944 Bacteria 1493
161 Ga0207679_10263997 3300025945 Bacteria 1470
162 Ga0207658_10117714 3300025986 Bacteria 2112
163 Ga0207677_10047789 3300026023 Bacteria 2876
164 Ga0207703_10019126 3300026035 Bacteria 5350
165 Ga0207678_10050017 3300026067 Bacteria 3611
166 Ga0207702_10037810 3300026078 Bacteria 4041
167 Ga0207674_10033530 3300026116 Bacteria 5375
168 Ga0207674_10083113 3300026116 Bacteria 3202
169 Ga0207698_10178293 3300026142 Bacteria 1879
170 Ga0265337_1000901 3300028556 Bacteria 15635
171 Ga0265326_10000938 3300028558 Bacteria 10514
172 Ga0265319_1000417 3300028563 Bacteria 30701
173 Ga0265334_10000158 3300028573 Bacteria 41931
174 Ga0265336_10001757 3300028666 Bacteria 9504
175 Ga0265338_10000059 3300028800 Bacteria 198047
176 Ga0265338_10002685 3300028800 Bacteria 26141
177 Ga0265338_10007182 3300028800 Bacteria 13939
178 Ga0265324_10001497 3300029957 Bacteria 13242
179 Ga0265332_10000496 3300031238 Bacteria 27209
180 Ga0265320_10012089 3300031240 Bacteria 5047
181 Ga0265339_10066200 3300031249 Bacteria 1935
182 Ga0265316_10047216 3300031344 Bacteria 3407
183 Ga0265313_10018423 3300031595 Bacteria 3920
184 Ga0265314_10010760 3300031711 Bacteria 7608
185 Ga0265342_10004567 3300031712 Bacteria 10825
186 Ga0373926_0001047 3300035083 Bacteria 8120
187 Ga0373934_0008920 3300035086 Bacteria 3747
188 Ga0373934_0010038 3300035086 Bacteria 3553
189 Ga0373934_0039688 3300035086 Bacteria 1856
190 Ga0373940_0029927 3300035088 Bacteria 1445
191 Ga0373923_0019308 3300035111 Bacteria 2637
192 Ga0373936_0000206 3300035113 Bacteria 19595
193 Ga0373936_0002535 3300035113 Bacteria 6851
194 Ga0373945_0001919 3300035116 Bacteria 6451
195 Ga0373953_0003432 3300035117 Bacteria 4934
196 Ga0373953_0003744 3300035117 Bacteria 4777
197 Ga0373953_0018672 3300035117 Bacteria 2569
198 Ga0373954_0075189 3300035118 Bacteria 1608
199 Ga0373956_0004223 3300035119 Bacteria 5765
200 Ga0373956_0008838 3300035119 Bacteria 4081
201 Ga0373957_0032478 3300035120 Bacteria 1922
202 Ga0373957_0041385 3300035120 Bacteria 1735
203 Ga0373943_0001364 3300035170 Bacteria 11010
204 Ga0373946_0000123 3300035171 Bacteria 22784
205 Ga0373955_0036337 3300035172 Bacteria 2613
206 Ga0373924_0004896 3300035410 Bacteria 4706
207 Ga0373935_0000443 3300035692 Bacteria 21444
208 Ga0373935_0011632 3300035692 Bacteria 5286
209 Ga0373935_0015812 3300035692 Bacteria 4565
210 Ga0373935_0096525 3300035692 Bacteria 1943
211 Ga0373927_0001451 3300035695 Bacteria 17876
212 Ga0373933_0011085 3300035724 Bacteria 4954
213 Ga0373933_0035561 3300035724 Bacteria 2909
214 Ga0373947_0000032 3300035725 Bacteria 72445
215 Ga0373947_0000510 3300035725 Bacteria 22565
216 Ga0373947_0046043 3300035725 Bacteria 2611
217 Ga0373937_0126076 3300036401 Bacteria 2388
218 Ga0373937_0160782 3300036401 Bacteria 2105
219 Ga0373937_0165829 3300036401 Bacteria 2071
220 Ga0373925_0000779 3300037068 Bacteria 29324
221 Ga0373925_0000879 3300037068 Bacteria 27479
222 Ga0373925_0013779 3300037068 Bacteria 5852
223 Ga0373925_0068920 3300037068 Bacteria 2671
224 Ga0436364_0050479 3300037853 Bacteria 121594
225 Ga0436364_0340984 3300037853 Bacteria 7704
226 Ga0436364_0789043 3300037853 Bacteria 48837
227 Ga0436364_0933782 3300037853 Bacteria 18268
228 Ga0436364_0940223 3300037853 Bacteria 123217
229 Ga0436364_1343719 3300037853 Bacteria 1695
230 Ga0436365_0596589 3300039437 Bacteria 2025
231 Ga0436365_1346750 3300039437 Bacteria 5549
232 Ga0436362_0405432 3300039453 Bacteria 89010
233 Ga0466966_0013056 3300044684 Bacteria 5500
234 Ga0466961_0182194 3300044693 Bacteria 1304
235 Ga0466963_0007934 3300044694 Bacteria 6355
236 Ga0466963_0022271 3300044694 Bacteria 4011
237 Ga0466971_0001806 3300044719 Bacteria 9086
238 Ga0466971_0036859 3300044719 Bacteria 2193
239 Ga0466968_0000284 3300044735 Bacteria 16130
240 Ga0466970_0001118 3300044765 Bacteria 12997
241 Ga0466970_0024602 3300044765 Bacteria 3150
242 Ga0466957_0005856 3300044842 Bacteria 6922
243 Ga0466959_0075035 3300045049 Bacteria 2444
244 Ga0466958_0008338 3300045836 Bacteria 5743
245 Ga0466958_0095039 3300045836 Bacteria 1847
246 Ga0466967_0030264 3300045976 Bacteria 4541
247 Ga0466967_0062127 3300045976 Bacteria 3315
248 Ga0466967_0159032 3300045976 Bacteria 2119
249 Ga0495592_0028469 3300046454 Bacteria 4231
250 Ga0495629_0016369 3300046459 Bacteria 5322
251 Ga0495641_0006259 3300046461 Bacteria 7756
252 Ga0495641_0033591 3300046461 Bacteria 2433
253 Ga0495641_0055932 3300046461 Bacteria 1790
254 Ga0495651_0010666 3300046462 Bacteria 7068
255 Ga0495651_0012138 3300046462 Bacteria 6631
256 Ga0495651_0047966 3300046462 Bacteria 3299
257 Ga0495651_0117501 3300046462 Bacteria 1957
258 Ga0495651_0234909 3300046462 Bacteria 1260
259 Ga0495653_0005553 3300046463 Bacteria 10279
260 Ga0495653_0019577 3300046463 Bacteria 5488
261 Ga0495653_0021307 3300046463 Bacteria 5251
262 Ga0495582_0002756 3300046473 Bacteria 9802
263 Ga0495662_0026285 3300046476 Bacteria 2812
264 Ga0495664_0003974 3300046477 Bacteria 8072
265 Ga0495664_0004620 3300046477 Bacteria 7531
266 Ga0495664_0012531 3300046477 Bacteria 4804
267 Ga0495608_0001682 3300046511 Bacteria 15896
268 Ga0495608_0008595 3300046511 Bacteria 7150
269 Ga0495608_0044874 3300046511 Bacteria 2948
270 Ga0495608_0056282 3300046511 Bacteria 2597
271 Ga0495628_0003123 3300046516 Bacteria 14874
272 Ga0495628_0061863 3300046516 Bacteria 2935
273 Ga0495630_0001678 3300046517 Bacteria 15421
274 Ga0495630_0046993 3300046517 Bacteria 3227
275 Ga0495630_0136504 3300046517 Bacteria 1864
276 Ga0495652_0004852 3300046529 Bacteria 12772
277 Ga0495652_0009003 3300046529 Bacteria 9083
278 Ga0495652_0014642 3300046529 Bacteria 7032
279 Ga0495652_0071539 3300046529 Bacteria 2894
280 Ga0495652_0073135 3300046529 Bacteria 2855
281 Ga0495652_0125746 3300046529 Bacteria 2037
282 Ga0495652_0139166 3300046529 Bacteria 1911
283 Ga0495665_0017334 3300046531 Bacteria 3874
284 Ga0495665_0061703 3300046531 Bacteria 1979
285 Ga0495640_0015959 3300046533 Bacteria 5635
286 Ga0495640_0067550 3300046533 Bacteria 2407
287 Ga0495586_0044454 3300046535 Bacteria 2393
288 Ga0495587_0004106 3300046536 Bacteria 9633
289 Ga0495587_0049774 3300046536 Bacteria 2480
290 Ga0495587_0054205 3300046536 Bacteria 2363
291 Ga0495645_0068196 3300046543 Bacteria 2568
292 Ga0495645_0131587 3300046543 Bacteria 1752
293 Ga0495667_0002066 3300046559 Bacteria 13331
294 Ga0495667_0006956 3300046559 Bacteria 7673
295 Ga0495667_0008013 3300046559 Bacteria 7163
296 Ga0495667_0009525 3300046559 Bacteria 6583
297 Ga0495634_0012121 3300046642 Bacteria 6246
298 Ga0495634_0026363 3300046642 Bacteria 4057
299 Ga0495635_0002813 3300046663 Bacteria 11939
300 Ga0495635_0015952 3300046663 Bacteria 5247
301 Ga0495635_0023860 3300046663 Bacteria 4262
302 Ga0495635_0142547 3300046663 Bacteria 1631
303 Ga0495657_0004958 3300046675 Bacteria 10583
304 Ga0495657_0011003 3300046675 Bacteria 6785
305 Ga0495657_0014663 3300046675 Bacteria 5753
306 Ga0495599_0013539 3300046678 Bacteria 5038
307 Ga0495599_0041941 3300046678 Bacteria 2872
308 Ga0495599_0051069 3300046678 Bacteria 2591
309 Ga0495599_0110547 3300046678 Bacteria 1712
310 Ga0495623_0053764 3300046679 Bacteria 2542
311 Ga0495646_0045125 3300046680 Bacteria 2693
312 Ga0495646_0064431 3300046680 Bacteria 2172
313 Ga0495613_0052745 3300046689 Bacteria 2994
314 Ga0495624_0010196 3300046690 Bacteria 6480
315 Ga0495624_0038363 3300046690 Bacteria 3078
316 Ga0495600_0012351 3300046809 Bacteria 5337
317 Ga0495600_0020198 3300046809 Bacteria 4260
318 Ga0495600_0037314 3300046809 Bacteria 3159
319 Ga0495600_0062594 3300046809 Bacteria 2431
320 Ga0495581_0089842 3300047315 Bacteria 1781
321 Ga0495604_0014611 3300047317 Bacteria 6258
322 Ga0495604_0022428 3300047317 Bacteria 5041
323 Ga0495674_0002077 3300047319 Bacteria 19657
324 Ga0495674_0002794 3300047319 Bacteria 16941
325 Ga0495674_0013066 3300047319 Bacteria 7814
326 Ga0495674_0033381 3300047319 Bacteria 4662
327 Ga0495674_0053815 3300047319 Bacteria 3536
328 Ga0495674_0161510 3300047319 Bacteria 1874
329 Ga0495676_0171269 3300047321 Bacteria 1528
330 Ga0495680_0009540 3300047322 Bacteria 8720
331 Ga0495680_0023783 3300047322 Bacteria 5091
332 Ga0495680_0038268 3300047322 Bacteria 3835
333 Ga0495684_0006613 3300047471 Bacteria 8991
334 Ga0495684_0011361 3300047471 Bacteria 6875
335 Ga0495684_0019598 3300047471 Bacteria 5212
336 Ga0495684_0046956 3300047471 Bacteria 3303
337 Ga0495593_0017179 3300047673 Bacteria 4072
338 Ga0495602_0053891 3300048088 Bacteria 3557
339 Ga0495602_0100012 3300048088 Bacteria 2382
340 Ga0495602_0150568 3300048088 Bacteria 1829
341 Ga0496100_0169351 3300048903 Bacteria 1571
342 Ga0496102_0060508 3300048905 Bacteria 3464
343 Ga0496102_0095958 3300048905 Bacteria 2749
344 Ga0496102_0255009 3300048905 Bacteria 1654
345 Ga0496104_0010526 3300048907 Bacteria 8263
346 Ga0496104_0150832 3300048907 Bacteria 2231
347 Ga0496105_0024959 3300048908 Bacteria 4859
348 Ga0496105_0028035 3300048908 Bacteria 4605
349 Ga0496105_0049930 3300048908 Bacteria 3456
350 Ga0496105_0245160 3300048908 Bacteria 1453
351 Ga0496106_0048576 3300048909 Bacteria 3195
352 Ga0496108_0011196 3300048911 Bacteria 7289
353 Ga0496108_0051682 3300048911 Bacteria 3443
354 Ga0496109_0048010 3300048912 Bacteria 3884
355 Ga0496109_0095836 3300048912 Bacteria 2748
356 Ga0496109_0116169 3300048912 Bacteria 2490
357 Ga0496110_0030321 3300048913 Bacteria 4661
358 Ga0496111_0032057 3300048914 Bacteria 3746
359 Ga0496111_0076981 3300048914 Bacteria 2432
360 Ga0496112_0025185 3300048915 Bacteria 5710
361 Ga0496113_0047196 3300048916 Bacteria 3200
362 Ga0496113_0096235 3300048916 Bacteria 2289
363 Ga0496114_0008124 3300048917 Bacteria 8316
364 Ga0496115_0179985 3300048918 Bacteria 1748
365 Ga0496118_0096400 3300048921 Bacteria 2016
366 Ga0496126_0168744 3300048929 Bacteria 1866
367 Ga0501031_0039683 3300049568 Bacteria 3073
368 Ga0501036_0010387 3300049572 Bacteria 7687
369 Ga0501038_0064376 3300049574 Bacteria 3127
370 Ga0501039_0238831 3300049575 Bacteria 1429
371 Ga0501042_0077932 3300049578 Bacteria 2373
372 Ga0501048_0127076 3300049582 Bacteria 1803
373 Ga0501074_0077921 3300049590 Bacteria 2379
374 Ga0501075_0032121 3300049591 Bacteria 3899
375 Ga0501076_0012467 3300049592 Bacteria 6357
376 Ga0501077_0191661 3300049593 Bacteria 1299
377 Ga0501035_0087187 3300049822 Bacteria 2751
378 Ga0501045_0007701 3300049824 Bacteria 7493
379 nmdc:mga0n895_1628_c1 3300050512 Bacteria 16956
380 nmdc:mga0rr50_1250_c1 3300050513 Bacteria 13870
381 nmdc:mga08x19_29689_c1 3300050514 Bacteria 3430
382 nmdc:mga0a205_3821_c1 3300050515 Bacteria 13493
383 Ga0495612_0003655 3300053078 Bacteria 6376
384 Ga0495612_0033089 3300053078 Bacteria 2091
385 Ga0495595_0009281 3300053084 Bacteria 4063
386 Ga0495595_0021167 3300053084 Bacteria 2838
387 Ga0495619_0017166 3300053085 Bacteria 4584
388 Ga0495619_0027119 3300053085 Bacteria 3690
389 Ga0466962_0000550 3300061719 Bacteria 16549
390 2812348928 2811994878 Bacteria 5992952
391 3003004181 3002998708 Bacteria 11715108
392 8053952798 8053945823 Bacteria 8962862
393 8056062610 8056060235 Bacteria 7259403
394 Ga0265338_10006397
395 Ga0070658_10198885
396 Ga0070683_100050339
397 Ga0070683_100069679
398 Ga0070667_100031004
399 Ga0070709_10000300
400 Ga0070709_10126774
401 Ga0070714_100000583
402 Ga0070714_100002089
403 Ga0070714_100005423
404 Ga0070714_100025023
405 Ga0070714_100025321
406 Ga0070714_100054661
407 Ga0070714_100118641
408 Ga0070714_100140636
409 Ga0070714_100141035
410 Ga0070713_100001870
411 Ga0070713_100004086
412 Ga0070713_100012650
413 Ga0070713_100013070
414 Ga0070713_100020877
415 Ga0070713_100030947
416 Ga0070710_10001803
417 Ga0070711_100011747
418 Ga0070711_100012893
419 Ga0070711_100037215
420 Ga0070711_100091167
421 Ga0070705_100062762
422 Ga0070708_100021672
423 Ga0070708_100029881
424 Ga0070708_100045128
425 Ga0070708_100081174
426 Ga0070708_100196922
427 Ga0070681_10037632
428 Ga0070706_100005344
429 Ga0070706_100006071
430 Ga0070706_100025056
431 Ga0070706_100104466
432 Ga0070706_100163166
433 Ga0070707_100000684
434 Ga0070707_100003195
435 Ga0070707_100007416
436 Ga0070707_100017433
437 Ga0070707_100032213
438 Ga0070707_100069921
439 Ga0070707_100090964
440 Ga0070707_100099296
441 Ga0070707_100200702
442 Ga0070707_100207222
443 Ga0070698_100003261
444 Ga0070698_100004003
445 Ga0070698_100004293
446 Ga0070698_100006357
447 Ga0070698_100013511
448 Ga0070699_100050520
449 Ga0070699_100067622
450 Ga0070699_100143057
451 Ga0070679_100037810
452 Ga0070679_100125147
453 Ga0070684_100132780
454 Ga0070684_100168096
455 Ga0070704_100103476
456 Ga0068856_100079630
457 Ga0070702_100053439
458 Ga0068852_100225603
459 Ga0068864_100086255
460 Ga0068863_100103447
461 Ga0068858_100015935
462 Ga0068860_100228251
463 Ga0070717_10009071
464 Ga0070717_10027674
465 Ga0070717_10031058
466 Ga0070717_10038037
467 Ga0070717_10171645
468 Ga0070715_10005071
469 Ga0070716_100040016
470 Ga0070716_100073414
471 Ga0070716_100074629
472 Ga0070712_100009016
473 Ga0097621_100047269
474 Ga0068871_100059107
475 Ga0075433_10046147
476 Ga0075434_100007409
477 Ga0075434_100406976
478 Ga0075436_100015384
479 Ga0075435_100003256
480 Ga0075435_100301030
481 Ga0157369_10032295
482 Ga0157374_10012022
483 Ga0163162_10019124
484 Ga0163163_10031381
485 Ga0163163_10035741
486 Ga0157379_10015627
487 Ga0206356_11098751
488 Ga0206354_11678251
489 Ga0206353_11639587
490 Ga0213873_10000032
491 Ga0213876_10051857
492 Ga0213875_10000102
493 Ga0213875_10000159
494 Ga0213875_10000243
495 Ga0213875_10010490
496 Ga0213875_10041378
497 Ga0224712_10030710
498 Ga0224572_1003284
499 Ga0207692_10001510
500 Ga0207692_10009142
501 Ga0207685_10003920
502 Ga0207699_10000373
503 Ga0207699_10005720
504 Ga0207699_10008579
505 Ga0207699_10046126
506 Ga0207699_10064360
507 Ga0207699_10086848
508 Ga0207684_10002478
509 Ga0207684_10003082
510 Ga0207684_10024056
511 Ga0207684_10059927
512 Ga0207684_10089648
513 Ga0207684_10166024
514 Ga0207684_10177637
515 Ga0207707_10036650
516 Ga0207693_10002838
517 Ga0207693_10007382
518 Ga0207693_10016495
519 Ga0207693_10017098
520 Ga0207693_10018737
521 Ga0207693_10044707
522 Ga0207663_10003240
523 Ga0207663_10005197
524 Ga0207663_10036424
525 Ga0207652_10171245
526 Ga0207646_10000121
527 Ga0207646_10002090
528 Ga0207646_10006784
529 Ga0207646_10021216
530 Ga0207646_10090406
531 Ga0207646_10159151
532 Ga0207646_10199048
533 Ga0207700_10000825
534 Ga0207700_10001247
535 Ga0207700_10002216
536 Ga0207700_10011587
537 Ga0207700_10012292
538 Ga0207700_10015813
539 Ga0207700_10026053
540 Ga0207700_10031353
541 Ga0207700_10064332
542 Ga0207664_10000662
543 Ga0207664_10002310
544 Ga0207664_10008628
545 Ga0207664_10016962
546 Ga0207664_10078227
547 Ga0207665_10002413
548 Ga0207665_10004471
549 Ga0207665_10005662
550 Ga0207665_10038808
551 Ga0207665_10049434
552 Ga0207661_10167366
553 Ga0207661_10279146
554 Ga0207679_10263997
555 Ga0207658_10117714
556 Ga0207677_10047789
557 Ga0207703_10019126
558 Ga0207678_10050017
559 Ga0207702_10037810
560 Ga0207674_10033530
561 Ga0207674_10083113
562 Ga0207698_10178293
563 Ga0265337_1000901
564 Ga0265326_10000938
565 Ga0265319_1000417
566 Ga0265334_10000158
567 Ga0265336_10001757
568 Ga0265338_10000059
569 Ga0265338_10002685
570 Ga0265338_10007182
571 Ga0265324_10001497
572 Ga0265332_10000496
573 Ga0265320_10012089
574 Ga0265339_10066200
575 Ga0265316_10047216
576 Ga0265313_10018423
577 Ga0265314_10010760
578 Ga0265342_10004567
579 Ga0373926_0001047
580 Ga0373934_0008920
581 Ga0373934_0010038
582 Ga0373934_0039688
583 Ga0373940_0029927
584 Ga0373923_0019308
585 Ga0373936_0000206
586 Ga0373936_0002535
587 Ga0373945_0001919
588 Ga0373953_0003432
589 Ga0373953_0003744
590 Ga0373953_0018672
591 Ga0373954_0075189
592 Ga0373956_0004223
593 Ga0373956_0008838
594 Ga0373957_0032478
595 Ga0373957_0041385
596 Ga0373943_0001364
597 Ga0373946_0000123
598 Ga0373955_0036337
599 Ga0373924_0004896
600 Ga0373935_0000443
601 Ga0373935_0011632
602 Ga0373935_0015812
603 Ga0373935_0096525
604 Ga0373927_0001451
605 Ga0373933_0011085
606 Ga0373933_0035561
607 Ga0373947_0000032
608 Ga0373947_0000510
609 Ga0373947_0046043
610 Ga0373937_0126076
611 Ga0373937_0160782
612 Ga0373937_0165829
613 Ga0373925_0000779
614 Ga0373925_0000879
615 Ga0373925_0013779
616 Ga0373925_0068920
617 Ga0436364_0050479
618 Ga0436364_0340984
619 Ga0436364_0789043
620 Ga0436364_0933782
621 Ga0436364_0940223
622 Ga0436364_1343719
623 Ga0436365_0596589
624 Ga0436365_1346750
625 Ga0436362_0405432
626 Ga0466966_0013056
627 Ga0466961_0182194
628 Ga0466963_0007934
629 Ga0466963_0022271
630 Ga0466971_0001806
631 Ga0466971_0036859
632 Ga0466968_0000284
633 Ga0466970_0001118
634 Ga0466970_0024602
635 Ga0466957_0005856
636 Ga0466959_0075035
637 Ga0466958_0008338
638 Ga0466958_0095039
639 Ga0466967_0030264
640 Ga0466967_0062127
641 Ga0466967_0159032
642 Ga0495592_0028469
643 Ga0495629_0016369
644 Ga0495641_0006259
645 Ga0495641_0033591
646 Ga0495641_0055932
647 Ga0495651_0010666
648 Ga0495651_0012138
649 Ga0495651_0047966
650 Ga0495651_0117501
651 Ga0495651_0234909
652 Ga0495653_0005553
653 Ga0495653_0019577
654 Ga0495653_0021307
655 Ga0495582_0002756
656 Ga0495662_0026285
657 Ga0495664_0003974
658 Ga0495664_0004620
659 Ga0495664_0012531
660 Ga0495608_0001682
661 Ga0495608_0008595
662 Ga0495608_0044874
663 Ga0495608_0056282
664 Ga0495628_0003123
665 Ga0495628_0061863
666 Ga0495630_0001678
667 Ga0495630_0046993
668 Ga0495630_0136504
669 Ga0495652_0004852
670 Ga0495652_0009003
671 Ga0495652_0014642
672 Ga0495652_0071539
673 Ga0495652_0073135
674 Ga0495652_0125746
675 Ga0495652_0139166
676 Ga0495665_0017334
677 Ga0495665_0061703
678 Ga0495640_0015959
679 Ga0495640_0067550
680 Ga0495586_0044454
681 Ga0495587_0004106
682 Ga0495587_0049774
683 Ga0495587_0054205
684 Ga0495645_0068196
685 Ga0495645_0131587
686 Ga0495667_0002066
687 Ga0495667_0006956
688 Ga0495667_0008013
689 Ga0495667_0009525
690 Ga0495634_0012121
691 Ga0495634_0026363
692 Ga0495635_0002813
693 Ga0495635_0015952
694 Ga0495635_0023860
695 Ga0495635_0142547
696 Ga0495657_0004958
697 Ga0495657_0011003
698 Ga0495657_0014663
699 Ga0495599_0013539
700 Ga0495599_0041941
701 Ga0495599_0051069
702 Ga0495599_0110547
703 Ga0495623_0053764
704 Ga0495646_0045125
705 Ga0495646_0064431
706 Ga0495613_0052745
707 Ga0495624_0010196
708 Ga0495624_0038363
709 Ga0495600_0012351
710 Ga0495600_0020198
711 Ga0495600_0037314
712 Ga0495600_0062594
713 Ga0495581_0089842
714 Ga0495604_0014611
715 Ga0495604_0022428
716 Ga0495674_0002077
717 Ga0495674_0002794
718 Ga0495674_0013066
719 Ga0495674_0033381
720 Ga0495674_0053815
721 Ga0495674_0161510
722 Ga0495676_0171269
723 Ga0495680_0009540
724 Ga0495680_0023783
725 Ga0495680_0038268
726 Ga0495684_0006613
727 Ga0495684_0011361
728 Ga0495684_0019598
729 Ga0495684_0046956
730 Ga0495593_0017179
731 Ga0495602_0053891
732 Ga0495602_0100012
733 Ga0495602_0150568
734 Ga0496100_0169351
735 Ga0496102_0060508
736 Ga0496102_0095958
737 Ga0496102_0255009
738 Ga0496104_0010526
739 Ga0496104_0150832
740 Ga0496105_0024959
741 Ga0496105_0028035
742 Ga0496105_0049930
743 Ga0496105_0245160
744 Ga0496106_0048576
745 Ga0496108_0011196
746 Ga0496108_0051682
747 Ga0496109_0048010
748 Ga0496109_0095836
749 Ga0496109_0116169
750 Ga0496110_0030321
751 Ga0496111_0032057
752 Ga0496111_0076981
753 Ga0496112_0025185
754 Ga0496113_0047196
755 Ga0496113_0096235
756 Ga0496114_0008124
757 Ga0496115_0179985
758 Ga0496118_0096400
759 Ga0496126_0168744
760 Ga0501031_0039683
761 Ga0501036_0010387
762 Ga0501038_0064376
763 Ga0501039_0238831
764 Ga0501042_0077932
765 Ga0501048_0127076
766 Ga0501074_0077921
767 Ga0501075_0032121
768 Ga0501076_0012467
769 Ga0501077_0191661
770 Ga0501035_0087187
771 Ga0501045_0007701
772 nmdc:mga0n895_1628_c1
773 nmdc:mga0rr50_1250_c1
774 nmdc:mga08x19_29689_c1
775 nmdc:mga0a205_3821_c1
776 Ga0495612_0003655
777 Ga0495612_0033089
778 Ga0495595_0009281
779 Ga0495595_0021167
780 Ga0495619_0017166
781 Ga0495619_0027119
782 Ga0466962_0000550
783 2812348928
784 3003004181
785 8053952798
786 8056062610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00425

Chorismate_bind

chorismate binding enzyme

223

474

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3os6-assembly1.cif.gz_B crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8721 35 428
3os6-assembly2.cif.gz_D crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8711 33 428
3os6-assembly2.cif.gz_C crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.865 35 428
3os6-assembly2.cif.gz_D crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8621 33 428
3os6-assembly1.cif.gz_B crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8608 35 428
ID Description Score Start End Superfamily
3os6D00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8675 33 428 3.60.120.10
3os6D00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8585 33 428 3.60.120.10
af_P9WFW9_3_372_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8497 42 428 3.60.120.10
af_Q9S7H8_74_558_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8283 19 428 3.60.120.10
5jy8A00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8268 45 428 3.60.120.10
ID Description Score Start End GO Terms
AF-A0A7H4N506-F1-model_v4 Isochorismate synthase (EC 5.4.4.2) 0.9841 233 364 GO:0008909
GO:0009058
AF-A0A7K0Z7E4-F1-model_v4 Isochorismate synthase 0.9824 207 428 GO:0009058
GO:0016020
AF-A0A645HDC1-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.9807 233 432 GO:0008909
GO:0009058
AF-A0A6L8E7G1-F1-model_v4 Chorismate-utilising enzyme C-terminal domain-containing protein 0.9788 275 428 GO:0009058
AF-A0A6J6I096-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.9781 233 431 GO:0008909
GO:0009697

Map