F432543

General Info

Members Datasets Scaffolds Average Seq Length
393 176 786 330

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100141600|Ga0068857_1001416002
Length 363
Sequence MWNSQRESPSPSGRRWPEGPDEGSLSRRERAHAPTWWLSLTLAFLCVSTLSAALLQNSPQVPAPSANEETAFLCPMHPDYTLDVSGKCPRCGMALVRAAAYDVRDYRLDFQTIPAVVTAGRKATLRFKVSHPGFNAVIQKFEVVHDRQYHLFVISQDMEYFQHIHPEQRPDGTWTIDLTLPKAGYYKVLSDFLPAGGSTQFIARPLVTAGYAGDLAADSAHLTPDTVFKKSVEDITAEISFDPPAFVAGLYGHLTFHLTDTGTGRPVTDLQTYLGAFGHTLIMSEDMADYVHSHPIDISASDENGPKQFMLPADVDPEKLRGGPEVTFEGLMPKPGRYRAWTQFRRNGKLYTFATTFNVAASE

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 21.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100141600 3300005577 Bacteria 2174
2 Ga0065707_10208489 3300005295 Bacteria 1276
3 Ga0070676_10007618 3300005328 Bacteria 5817
4 Ga0070676_10091286 3300005328 Bacteria 1866
5 Ga0070683_100032084 3300005329 Bacteria 4781
6 Ga0070683_100124143 3300005329 Bacteria 2440
7 Ga0070690_100014981 3300005330 Bacteria 4613
8 Ga0070690_100015560 3300005330 Bacteria 4542
9 Ga0070690_100104460 3300005330 Bacteria 1882
10 Ga0070670_100124297 3300005331 Bacteria 2227
11 Ga0068869_100014450 3300005334 Bacteria 5273
12 Ga0068869_100052915 3300005334 Bacteria 2950
13 Ga0068869_100071398 3300005334 Unclassified 2570
14 Ga0068869_100096846 3300005334 Bacteria 2228
15 Ga0070666_10007094 3300005335 Bacteria 6908
16 Ga0070666_10015799 3300005335 Bacteria 4821
17 Ga0070666_10020983 3300005335 Bacteria 4230
18 Ga0070666_10061830 3300005335 Bacteria 2536
19 Ga0070666_10221181 3300005335 Unclassified 1336
20 Ga0070680_100338622 3300005336 Unclassified 1278
21 Ga0068868_100040229 3300005338 Unclassified 3638
22 Ga0070689_100023300 3300005340 Unclassified 4634
23 Ga0070689_100023312 3300005340 Bacteria 4633
24 Ga0070689_100036030 3300005340 Unclassified 3783
25 Ga0070661_100037233 3300005344 Bacteria 3538
26 Ga0070668_100223171 3300005347 Bacteria 1555
27 Ga0070669_100011161 3300005353 Bacteria 6375
28 Ga0070669_100221142 3300005353 Bacteria 1497
29 Ga0070675_100004145 3300005354 Bacteria 11012
30 Ga0070675_100006129 3300005354 Bacteria 9220
31 Ga0070675_100008305 3300005354 Bacteria 8056
32 Ga0070675_100014970 3300005354 Bacteria 6125
33 Ga0070675_100020241 3300005354 Bacteria 5309
34 Ga0070675_100105870 3300005354 Bacteria 2374
35 Ga0070675_100135367 3300005354 Bacteria 2102
36 Ga0070671_100001299 3300005355 Bacteria 18745
37 Ga0070671_100361723 3300005355 Bacteria 1239
38 Ga0070674_100000307 3300005356 Bacteria 24081
39 Ga0070673_100004487 3300005364 Bacteria 8831
40 Ga0070673_100041828 3300005364 Unclassified 3528
41 Ga0070673_100062402 3300005364 Bacteria 2960
42 Ga0070673_100094290 3300005364 Unclassified 2453
43 Ga0070688_100005415 3300005365 Bacteria 6720
44 Ga0070659_100131354 3300005366 Bacteria 2034
45 Ga0070667_100004846 3300005367 Bacteria 11274
46 Ga0070667_100008674 3300005367 Bacteria 8423
47 Ga0070713_100077008 3300005436 Bacteria 2835
48 Ga0070701_10024570 3300005438 Unclassified 2916
49 Ga0070700_100051303 3300005441 Unclassified 2568
50 Ga0070708_100198375 3300005445 Unclassified 1878
51 Ga0070663_100052036 3300005455 Bacteria 2920
52 Ga0070678_100079796 3300005456 Bacteria 2476
53 Ga0070678_100146601 3300005456 Unclassified 1896
54 Ga0070678_100163459 3300005456 Bacteria 1806
55 Ga0070662_100272225 3300005457 Unclassified 1368
56 Ga0068867_100006951 3300005459 Bacteria 8007
57 Ga0068867_100100489 3300005459 Bacteria 2208
58 Ga0068867_100114626 3300005459 Bacteria 2075
59 Ga0068867_100316704 3300005459 Unclassified 1291
60 Ga0070685_10013811 3300005466 Bacteria 4269
61 Ga0070685_10029837 3300005466 Bacteria 3033
62 Ga0070685_10064349 3300005466 Unclassified 2156
63 Ga0070707_100320552 3300005468 Bacteria 1506
64 Ga0070698_100004651 3300005471 Bacteria 15097
65 Ga0070698_100187643 3300005471 Bacteria 2005
66 Ga0070699_100067074 3300005518 Unclassified 3116
67 Ga0070684_100117300 3300005535 Bacteria 2392
68 Ga0068853_100020493 3300005539 Bacteria 5500
69 Ga0068853_100230519 3300005539 Bacteria 1694
70 Ga0070672_100034870 3300005543 Unclassified 3821
71 Ga0070672_100035222 3300005543 Bacteria 3804
72 Ga0070686_100032763 3300005544 Bacteria 3188
73 Ga0070686_100035277 3300005544 Unclassified 3088
74 Ga0070686_100039044 3300005544 Unclassified 2956
75 Ga0070693_100105892 3300005547 Bacteria 1721
76 Ga0070665_100005601 3300005548 Bacteria 12914
77 Ga0070665_100057886 3300005548 Bacteria 3886
78 Ga0068855_100023473 3300005563 Bacteria 7387
79 Ga0070664_100003281 3300005564 Bacteria 13070
80 Ga0068854_100215597 3300005578 Bacteria 1516
81 Ga0070702_100023741 3300005615 Bacteria 3262
82 Ga0070702_100086644 3300005615 Unclassified 1889
83 Ga0068852_100068815 3300005616 Bacteria 3100
84 Ga0068859_100012752 3300005617 Bacteria 8446
85 Ga0068859_100036111 3300005617 Unclassified 4960
86 Ga0068866_10051122 3300005718 Unclassified 2102
87 Ga0068861_100009192 3300005719 Bacteria 6816
88 Ga0068861_100028674 3300005719 Unclassified 4063
89 Ga0068861_100200638 3300005719 Bacteria 1674
90 Ga0068861_100208200 3300005719 Bacteria 1646
91 Ga0068870_10003740 3300005840 Bacteria 6473
92 Ga0068870_10006596 3300005840 Bacteria 5126
93 Ga0068870_10018670 3300005840 Bacteria 3352
94 Ga0068870_10025911 3300005840 Bacteria 2917
95 Ga0068863_100025446 3300005841 Bacteria 5644
96 Ga0068863_100048267 3300005841 Bacteria 4037
97 Ga0068863_100426601 3300005841 Bacteria 1299
98 Ga0068858_100028512 3300005842 Bacteria 5185
99 Ga0068858_100045193 3300005842 Unclassified 4081
100 Ga0068858_100105085 3300005842 Bacteria 2635
101 Ga0068858_100213916 3300005842 Bacteria 1824
102 Ga0068860_100017499 3300005843 Bacteria 6984
103 Ga0068860_100017507 3300005843 Bacteria 6982
104 Ga0068860_100064207 3300005843 Unclassified 3488
105 Ga0068862_100014970 3300005844 Bacteria 6443
106 Ga0068862_100207252 3300005844 Bacteria 1770
107 Ga0068862_100283983 3300005844 Bacteria 1518
108 Ga0068862_100286428 3300005844 Bacteria 1511
109 Ga0081539_10001355 3300005985 Bacteria 42627
110 Ga0081539_10010868 3300005985 Bacteria 7312
111 Ga0070715_10069442 3300006163 Unclassified 1570
112 Ga0097621_100040741 3300006237 Bacteria 3736
113 Ga0097621_100054204 3300006237 Bacteria 3269
114 Ga0097621_100104489 3300006237 Bacteria 2387
115 Ga0097621_100253325 3300006237 Unclassified 1542
116 Ga0097621_100254131 3300006237 Bacteria 1540
117 Ga0068871_100000394 3300006358 Bacteria 30490
118 Ga0068871_100003851 3300006358 Bacteria 10344
119 Ga0068871_100009258 3300006358 Bacteria 7125
120 Ga0068871_100110615 3300006358 Bacteria 2310
121 Ga0075428_100001857 3300006844 Bacteria 22640
122 Ga0075428_100008130 3300006844 Bacteria 11645
123 Ga0075428_100029831 3300006844 Bacteria 6033
124 Ga0075430_100006776 3300006846 Bacteria 9659
125 Ga0075430_100017621 3300006846 Bacteria 6082
126 Ga0075430_100075507 3300006846 Bacteria 2825
127 Ga0075430_100295733 3300006846 Unclassified 1339
128 Ga0075431_100003176 3300006847 Bacteria 15903
129 Ga0075431_100016715 3300006847 Bacteria 7450
130 Ga0075431_100045143 3300006847 Bacteria 4544
131 Ga0075433_10005616 3300006852 Bacteria 9859
132 Ga0075434_100010218 3300006871 Bacteria 8791
133 Ga0075434_100133977 3300006871 Bacteria 2497
134 Ga0075434_100218904 3300006871 Bacteria 1924
135 Ga0075434_100248838 3300006871 Bacteria 1797
136 Ga0075429_100005641 3300006880 Bacteria 10791
137 Ga0075429_100011517 3300006880 Bacteria 7669
138 Ga0068865_100013260 3300006881 Bacteria 5206
139 Ga0068865_100021912 3300006881 Bacteria 4160
140 Ga0068865_100117269 3300006881 Bacteria 1973
141 Ga0068865_100339563 3300006881 Bacteria 1213
142 Ga0075436_100172921 3300006914 Unclassified 1525
143 Ga0097620_100012753 3300006931 Bacteria 8446
144 Ga0097620_100036110 3300006931 Unclassified 4960
145 Ga0111539_10000658 3300009094 Bacteria 44608
146 Ga0111539_10049348 3300009094 Bacteria 5020
147 Ga0111539_10059530 3300009094 Bacteria 4529
148 Ga0105245_10002272 3300009098 Bacteria 17382
149 Ga0105245_10003475 3300009098 Bacteria 14107
150 Ga0105245_10014813 3300009098 Bacteria 6792
151 Ga0105245_10073451 3300009098 Unclassified 3110
152 Ga0105245_10101374 3300009098 Bacteria 2665
153 Ga0114129_10011574 3300009147 Bacteria 12561
154 Ga0114129_10011625 3300009147 Bacteria 12531
155 Ga0114129_10077909 3300009147 Unclassified 4610
156 Ga0114129_10110900 3300009147 Bacteria 3787
157 Ga0114129_10150519 3300009147 Unclassified 3185
158 Ga0105243_10010832 3300009148 Bacteria 6900
159 Ga0105241_10003080 3300009174 Bacteria 12429
160 Ga0105241_10258164 3300009174 Unclassified 1480
161 Ga0105242_10007554 3300009176 Bacteria 8366
162 Ga0105242_10009369 3300009176 Bacteria 7514
163 Ga0105242_10027774 3300009176 Unclassified 4498
164 Ga0105242_10039215 3300009176 Bacteria 3812
165 Ga0105242_10230791 3300009176 Bacteria 1659
166 Ga0105248_10000969 3300009177 Bacteria 32018
167 Ga0105248_10024716 3300009177 Bacteria 6681
168 Ga0105248_10071082 3300009177 Bacteria 3908
169 Ga0105248_10191568 3300009177 Bacteria 2304
170 Ga0105248_10201526 3300009177 Unclassified 2242
171 Ga0105248_10245857 3300009177 Unclassified 2014
172 Ga0105248_10428144 3300009177 Bacteria 1490
173 Ga0105237_10104999 3300009545 Bacteria 2817
174 Ga0105238_10016108 3300009551 Bacteria 7562
175 Ga0105238_10029571 3300009551 Bacteria 5581
176 Ga0105249_10332352 3300009553 Bacteria 1534
177 Ga0105246_10013492 3300011119 Bacteria 5123
178 Ga0157374_10023779 3300013296 Bacteria 5486
179 Ga0157374_10042296 3300013296 Bacteria 4203
180 Ga0157378_10003447 3300013297 Bacteria 14024
181 Ga0163162_10022688 3300013306 Bacteria 6188
182 Ga0163162_10030664 3300013306 Bacteria 5328
183 Ga0163162_10052984 3300013306 Bacteria 4077
184 Ga0163162_10269905 3300013306 Bacteria 1833
185 Ga0157372_10037819 3300013307 Bacteria 5324
186 Ga0157375_10026383 3300013308 Bacteria 5413
187 Ga0157375_10223229 3300013308 Bacteria 2043
188 Ga0157375_10399874 3300013308 Unclassified 1540
189 Ga0157380_10045116 3300014326 Bacteria 3458
190 Ga0157380_10051079 3300014326 Unclassified 3268
191 Ga0157380_10076820 3300014326 Unclassified 2719
192 Ga0157377_10004178 3300014745 Bacteria 6599
193 Ga0157377_10091293 3300014745 Bacteria 1799
194 Ga0157379_10009187 3300014968 Bacteria 8610
195 Ga0157379_10013903 3300014968 Bacteria 7056
196 Ga0157376_10001500 3300014969 Bacteria 15396
197 Ga0157376_10543684 3300014969 Bacteria 1148
198 Ga0163161_10170686 3300017792 Unclassified 1663
199 Ga0207682_10075908 3300025893 Unclassified 1432
200 Ga0207642_10015431 3300025899 Unclassified 2846
201 Ga0207710_10053256 3300025900 Unclassified 1821
202 Ga0207688_10000819 3300025901 Bacteria 15578
203 Ga0207688_10102229 3300025901 Bacteria 1656
204 Ga0207688_10111804 3300025901 Bacteria 1586
205 Ga0207680_10009225 3300025903 Bacteria 4881
206 Ga0207680_10027265 3300025903 Unclassified 3179
207 Ga0207680_10115087 3300025903 Unclassified 1751
208 Ga0207699_10028443 3300025906 Bacteria 3107
209 Ga0207645_10001375 3300025907 Bacteria 19967
210 Ga0207645_10006078 3300025907 Bacteria 8681
211 Ga0207645_10083926 3300025907 Bacteria 2044
212 Ga0207643_10000735 3300025908 Bacteria 20120
213 Ga0207643_10009948 3300025908 Bacteria 5110
214 Ga0207643_10072520 3300025908 Unclassified 1983
215 Ga0207654_10038999 3300025911 Unclassified 2669
216 Ga0207654_10156792 3300025911 Unclassified 1467
217 Ga0207662_10077808 3300025918 Bacteria 2018
218 Ga0207649_10012658 3300025920 Bacteria 4687
219 Ga0207646_10237545 3300025922 Unclassified 1646
220 Ga0207681_10023396 3300025923 Unclassified 3951
221 Ga0207681_10077454 3300025923 Bacteria 2337
222 Ga0207681_10137747 3300025923 Bacteria 1814
223 Ga0207694_10003370 3300025924 Bacteria 12725
224 Ga0207694_10136635 3300025924 Bacteria 1969
225 Ga0207650_10113160 3300025925 Bacteria 2104
226 Ga0207659_10003094 3300025926 Bacteria 9935
227 Ga0207659_10003912 3300025926 Bacteria 8984
228 Ga0207659_10005387 3300025926 Bacteria 7752
229 Ga0207659_10008413 3300025926 Bacteria 6404
230 Ga0207659_10013397 3300025926 Bacteria 5250
231 Ga0207659_10014799 3300025926 Bacteria 5041
232 Ga0207659_10027962 3300025926 Bacteria 3825
233 Ga0207659_10063202 3300025926 Bacteria 2675
234 Ga0207659_10110879 3300025926 Bacteria 2086
235 Ga0207687_10001509 3300025927 Bacteria 15952
236 Ga0207687_10004087 3300025927 Bacteria 9781
237 Ga0207687_10011173 3300025927 Bacteria 5865
238 Ga0207687_10093051 3300025927 Unclassified 2203
239 Ga0207700_10172480 3300025928 Bacteria 1805
240 Ga0207644_10007926 3300025931 Bacteria 6947
241 Ga0207644_10057532 3300025931 Bacteria 2808
242 Ga0207690_10144039 3300025932 Bacteria 1759
243 Ga0207706_10015821 3300025933 Bacteria 6820
244 Ga0207706_10042204 3300025933 Bacteria 4043
245 Ga0207706_10489249 3300025933 Unclassified 1062
246 Ga0207686_10014855 3300025934 Bacteria 4346
247 Ga0207686_10057067 3300025934 Bacteria 2457
248 Ga0207686_10216870 3300025934 Unclassified 1379
249 Ga0207709_10009972 3300025935 Bacteria 5233
250 Ga0207670_10026329 3300025936 Bacteria 3664
251 Ga0207670_10032105 3300025936 Bacteria 3374
252 Ga0207704_10006537 3300025938 Bacteria 5444
253 Ga0207704_10016429 3300025938 Unclassified 3804
254 Ga0207691_10000927 3300025940 Bacteria 29118
255 Ga0207691_10024928 3300025940 Bacteria 5620
256 Ga0207711_10000806 3300025941 Bacteria 30730
257 Ga0207711_10028014 3300025941 Bacteria 4737
258 Ga0207711_10051498 3300025941 Bacteria 3526
259 Ga0207711_10136160 3300025941 Bacteria 2206
260 Ga0207711_10154625 3300025941 Bacteria 2072
261 Ga0207689_10003423 3300025942 Bacteria 14486
262 Ga0207689_10011095 3300025942 Bacteria 7742
263 Ga0207689_10011349 3300025942 Bacteria 7641
264 Ga0207689_10050980 3300025942 Bacteria 3411
265 Ga0207689_10084233 3300025942 Unclassified 2613
266 Ga0207689_10110902 3300025942 Bacteria 2254
267 Ga0207689_10316618 3300025942 Unclassified 1294
268 Ga0207679_10005608 3300025945 Bacteria 7869
269 Ga0207667_10103391 3300025949 Bacteria 2938
270 Ga0207651_10012435 3300025960 Unclassified 4817
271 Ga0207651_10031664 3300025960 Bacteria 3384
272 Ga0207651_10161210 3300025960 Bacteria 1758
273 Ga0207712_10036199 3300025961 Bacteria 3360
274 Ga0207658_10097618 3300025986 Unclassified 2294
275 Ga0207658_10164842 3300025986 Bacteria 1819
276 Ga0207677_10166062 3300026023 Bacteria 1721
277 Ga0207703_10020389 3300026035 Bacteria 5184
278 Ga0207703_10040694 3300026035 Bacteria 3721
279 Ga0207703_10050858 3300026035 Unclassified 3356
280 Ga0207703_10060669 3300026035 Bacteria 3093
281 Ga0207703_10065503 3300026035 Bacteria 2986
282 Ga0207703_10406236 3300026035 Unclassified 1264
283 Ga0207639_10358586 3300026041 Bacteria 1304
284 Ga0207708_10021278 3300026075 Unclassified 4890
285 Ga0207708_10039645 3300026075 Unclassified 3589
286 Ga0207708_10167994 3300026075 Bacteria 1736
287 Ga0207641_10001150 3300026088 Bacteria 26573
288 Ga0207641_10012858 3300026088 Bacteria 6864
289 Ga0207648_10003313 3300026089 Bacteria 16914
290 Ga0207648_10028944 3300026089 Unclassified 4911
291 Ga0207648_10042167 3300026089 Bacteria 4006
292 Ga0207648_10076881 3300026089 Bacteria 2910
293 Ga0207648_10079213 3300026089 Bacteria 2866
294 Ga0207648_10219196 3300026089 Bacteria 1690
295 Ga0207648_10360977 3300026089 Unclassified 1311
296 Ga0207676_10115587 3300026095 Bacteria 2253
297 Ga0207676_10298072 3300026095 Unclassified 1471
298 Ga0207674_10145578 3300026116 Bacteria 2328
299 Ga0207674_10308034 3300026116 Unclassified 1533
300 Ga0207675_100002693 3300026118 Bacteria 17528
301 Ga0207675_100022476 3300026118 Bacteria 5873
302 Ga0207675_100055393 3300026118 Bacteria 3699
303 Ga0207675_100095433 3300026118 Bacteria 2798
304 Ga0207683_10008167 3300026121 Bacteria 8955
305 Ga0207683_10130572 3300026121 Bacteria 2259
306 Ga0207683_10161896 3300026121 Unclassified 2023
307 Ga0207683_10200208 3300026121 Bacteria 1815
308 Ga0207698_10136896 3300026142 Unclassified 2103
309 Ga0207428_10000145 3300027907 Bacteria 96603
310 Ga0207428_10003697 3300027907 Bacteria 14704
311 Ga0207428_10020462 3300027907 Bacteria 5620
312 Ga0268266_10058622 3300028379 Bacteria 3315
313 Ga0268266_10160519 3300028379 Bacteria 2033
314 Ga0268265_10213571 3300028380 Unclassified 1683
315 Ga0268264_10028662 3300028381 Bacteria 4556
316 Ga0268264_10033026 3300028381 Unclassified 4248
317 Ga0268264_10050823 3300028381 Bacteria 3453
318 Ga0268264_10233288 3300028381 Bacteria 1700
319 Ga0265314_10000216 3300031711 Bacteria 85672
320 Ga0373923_0043100 3300035111 Bacteria 1867
321 Ga0373954_0001202 3300035118 Bacteria 10392
322 Ga0373954_0004037 3300035118 Bacteria 6277
323 Ga0373927_0144315 3300035695 Bacteria 1558
324 Ga0373933_0119010 3300035724 Bacteria 1653
325 Ga0373937_0010466 3300036401 Bacteria 8098
326 Ga0373937_0110623 3300036401 Unclassified 2555
327 Ga0373937_0168975 3300036401 Archaea 2052
328 Ga0373925_0065608 3300037068 Bacteria 2735
329 Ga0436364_0908166 3300037853 Unclassified 4766
330 Ga0436365_0452654 3300039437 Unclassified 1205
331 Ga0436365_1619426 3300039437 Bacteria 3075
332 Ga0495580_0015432 3300046472 Bacteria 5760
333 Ga0495580_0135950 3300046472 Bacteria 1704
334 Ga0495582_0001391 3300046473 Bacteria 13632
335 Ga0495639_0035501 3300046475 Bacteria 2231
336 Ga0495608_0214578 3300046511 Bacteria 1209
337 Ga0495628_0046227 3300046516 Bacteria 3458
338 Ga0495630_0000908 3300046517 Bacteria 20668
339 Ga0495652_0078306 3300046529 Unclassified 2737
340 Ga0495652_0150903 3300046529 Bacteria 1816
341 Ga0495587_0007431 3300046536 Bacteria 7093
342 Ga0495598_0009087 3300046537 Bacteria 2337
343 Ga0495645_0110201 3300046543 Bacteria 1948
344 Ga0495633_0105119 3300046558 Unclassified 1310
345 Ga0495667_0031043 3300046559 Bacteria 3588
346 Ga0495667_0193226 3300046559 Unclassified 1304
347 Ga0495656_0104906 3300046615 Unclassified 1313
348 Ga0495623_0170179 3300046679 Bacteria 1273
349 Ga0495658_0014784 3300046683 Unclassified 3993
350 Ga0495658_0119387 3300046683 Bacteria 1593
351 Ga0495613_0002190 3300046689 Bacteria 14802
352 Ga0495613_0057670 3300046689 Bacteria 2851
353 Ga0495604_0056890 3300047317 Bacteria 3008
354 Ga0495674_0053235 3300047319 Bacteria 3559
355 Ga0495680_0148464 3300047322 Bacteria 1711
356 Ga0495675_0138830 3300047444 Bacteria 1507
357 Ga0495684_0000214 3300047471 Bacteria 45082
358 Ga0495684_0038719 3300047471 Bacteria 3655
359 Ga0495602_0034818 3300048088 Bacteria 4704
360 Ga0496113_0041429 3300048916 Bacteria 3399
361 nmdc:mga05p37_10172_c1 3300050507 Bacteria 11167
362 nmdc:mga05p37_186132_c1 3300050507 Bacteria 2525
363 nmdc:mga05p37_22877_c1 3300050507 Bacteria 7580
364 nmdc:mga05p37_8230_c1 3300050507 Bacteria 12333
365 nmdc:mga05p37_91835_c1 3300050507 Bacteria 3741
366 nmdc:mga09592_1172_c2 3300050508 Bacteria 7778
367 nmdc:mga09592_536086_c1 3300050508 Unclassified 1006
368 nmdc:mga09592_53999_c1 3300050508 Unclassified 3394
369 nmdc:mga09592_83813_c1 3300050508 Unclassified 2717
370 nmdc:mga0qj67_23509_c1 3300050509 Unclassified 4743
371 nmdc:mga0qj67_286910_c1 3300050509 Bacteria 1334
372 nmdc:mga0qj67_32875_c1 3300050509 Bacteria 4046
373 nmdc:mga06r32_146809_c1 3300050510 Bacteria 2336
374 nmdc:mga06r32_2191_c1 3300050510 Bacteria 17497
375 nmdc:mga06r32_240238_c1 3300050510 Bacteria 1799
376 nmdc:mga06r32_399362_c1 3300050510 Bacteria 1357
377 nmdc:mga06r32_79543_c1 3300050510 Unclassified 3189
378 nmdc:mga08y16_101188_c1 3300050511 Bacteria 3000
379 nmdc:mga08y16_119273_c1 3300050511 Bacteria 2746
380 nmdc:mga08y16_14552_c1 3300050511 Bacteria 8274
381 nmdc:mga08y16_28907_c1 3300050511 Bacteria 5844
382 nmdc:mga08y16_28978_c1 3300050511 Bacteria 5836
383 nmdc:mga08y16_300_c1 3300050511 Bacteria 44608
384 nmdc:mga08y16_6192_c1 3300050511 Bacteria 12555
385 nmdc:mga0n895_359218_c1 3300050512 Bacteria 1475
386 nmdc:mga0rr50_134308_c1 3300050513 Bacteria 1984
387 nmdc:mga0a205_14685_c1 3300050515 Bacteria 7307
388 nmdc:mga0a205_4979_c1 3300050515 Bacteria 11950
389 nmdc:mga0a205_49809_c1 3300050515 Unclassified 4044
390 nmdc:mga0a205_627_c1 3300050515 Bacteria 28069
391 Ga0495601_0002005 3300053077 Bacteria 11426
392 Ga0495601_0211227 3300053077 Unclassified 1268
393 Ga0495619_0000427 3300053085 Bacteria 28604
394 Ga0068857_100141600
395 Ga0065707_10208489
396 Ga0070676_10007618
397 Ga0070676_10091286
398 Ga0070683_100032084
399 Ga0070683_100124143
400 Ga0070690_100014981
401 Ga0070690_100015560
402 Ga0070690_100104460
403 Ga0070670_100124297
404 Ga0068869_100014450
405 Ga0068869_100052915
406 Ga0068869_100071398
407 Ga0068869_100096846
408 Ga0070666_10007094
409 Ga0070666_10015799
410 Ga0070666_10020983
411 Ga0070666_10061830
412 Ga0070666_10221181
413 Ga0070680_100338622
414 Ga0068868_100040229
415 Ga0070689_100023300
416 Ga0070689_100023312
417 Ga0070689_100036030
418 Ga0070661_100037233
419 Ga0070668_100223171
420 Ga0070669_100011161
421 Ga0070669_100221142
422 Ga0070675_100004145
423 Ga0070675_100006129
424 Ga0070675_100008305
425 Ga0070675_100014970
426 Ga0070675_100020241
427 Ga0070675_100105870
428 Ga0070675_100135367
429 Ga0070671_100001299
430 Ga0070671_100361723
431 Ga0070674_100000307
432 Ga0070673_100004487
433 Ga0070673_100041828
434 Ga0070673_100062402
435 Ga0070673_100094290
436 Ga0070688_100005415
437 Ga0070659_100131354
438 Ga0070667_100004846
439 Ga0070667_100008674
440 Ga0070713_100077008
441 Ga0070701_10024570
442 Ga0070700_100051303
443 Ga0070708_100198375
444 Ga0070663_100052036
445 Ga0070678_100079796
446 Ga0070678_100146601
447 Ga0070678_100163459
448 Ga0070662_100272225
449 Ga0068867_100006951
450 Ga0068867_100100489
451 Ga0068867_100114626
452 Ga0068867_100316704
453 Ga0070685_10013811
454 Ga0070685_10029837
455 Ga0070685_10064349
456 Ga0070707_100320552
457 Ga0070698_100004651
458 Ga0070698_100187643
459 Ga0070699_100067074
460 Ga0070684_100117300
461 Ga0068853_100020493
462 Ga0068853_100230519
463 Ga0070672_100034870
464 Ga0070672_100035222
465 Ga0070686_100032763
466 Ga0070686_100035277
467 Ga0070686_100039044
468 Ga0070693_100105892
469 Ga0070665_100005601
470 Ga0070665_100057886
471 Ga0068855_100023473
472 Ga0070664_100003281
473 Ga0068854_100215597
474 Ga0070702_100023741
475 Ga0070702_100086644
476 Ga0068852_100068815
477 Ga0068859_100012752
478 Ga0068859_100036111
479 Ga0068866_10051122
480 Ga0068861_100009192
481 Ga0068861_100028674
482 Ga0068861_100200638
483 Ga0068861_100208200
484 Ga0068870_10003740
485 Ga0068870_10006596
486 Ga0068870_10018670
487 Ga0068870_10025911
488 Ga0068863_100025446
489 Ga0068863_100048267
490 Ga0068863_100426601
491 Ga0068858_100028512
492 Ga0068858_100045193
493 Ga0068858_100105085
494 Ga0068858_100213916
495 Ga0068860_100017499
496 Ga0068860_100017507
497 Ga0068860_100064207
498 Ga0068862_100014970
499 Ga0068862_100207252
500 Ga0068862_100283983
501 Ga0068862_100286428
502 Ga0081539_10001355
503 Ga0081539_10010868
504 Ga0070715_10069442
505 Ga0097621_100040741
506 Ga0097621_100054204
507 Ga0097621_100104489
508 Ga0097621_100253325
509 Ga0097621_100254131
510 Ga0068871_100000394
511 Ga0068871_100003851
512 Ga0068871_100009258
513 Ga0068871_100110615
514 Ga0075428_100001857
515 Ga0075428_100008130
516 Ga0075428_100029831
517 Ga0075430_100006776
518 Ga0075430_100017621
519 Ga0075430_100075507
520 Ga0075430_100295733
521 Ga0075431_100003176
522 Ga0075431_100016715
523 Ga0075431_100045143
524 Ga0075433_10005616
525 Ga0075434_100010218
526 Ga0075434_100133977
527 Ga0075434_100218904
528 Ga0075434_100248838
529 Ga0075429_100005641
530 Ga0075429_100011517
531 Ga0068865_100013260
532 Ga0068865_100021912
533 Ga0068865_100117269
534 Ga0068865_100339563
535 Ga0075436_100172921
536 Ga0097620_100012753
537 Ga0097620_100036110
538 Ga0111539_10000658
539 Ga0111539_10049348
540 Ga0111539_10059530
541 Ga0105245_10002272
542 Ga0105245_10003475
543 Ga0105245_10014813
544 Ga0105245_10073451
545 Ga0105245_10101374
546 Ga0114129_10011574
547 Ga0114129_10011625
548 Ga0114129_10077909
549 Ga0114129_10110900
550 Ga0114129_10150519
551 Ga0105243_10010832
552 Ga0105241_10003080
553 Ga0105241_10258164
554 Ga0105242_10007554
555 Ga0105242_10009369
556 Ga0105242_10027774
557 Ga0105242_10039215
558 Ga0105242_10230791
559 Ga0105248_10000969
560 Ga0105248_10024716
561 Ga0105248_10071082
562 Ga0105248_10191568
563 Ga0105248_10201526
564 Ga0105248_10245857
565 Ga0105248_10428144
566 Ga0105237_10104999
567 Ga0105238_10016108
568 Ga0105238_10029571
569 Ga0105249_10332352
570 Ga0105246_10013492
571 Ga0157374_10023779
572 Ga0157374_10042296
573 Ga0157378_10003447
574 Ga0163162_10022688
575 Ga0163162_10030664
576 Ga0163162_10052984
577 Ga0163162_10269905
578 Ga0157372_10037819
579 Ga0157375_10026383
580 Ga0157375_10223229
581 Ga0157375_10399874
582 Ga0157380_10045116
583 Ga0157380_10051079
584 Ga0157380_10076820
585 Ga0157377_10004178
586 Ga0157377_10091293
587 Ga0157379_10009187
588 Ga0157379_10013903
589 Ga0157376_10001500
590 Ga0157376_10543684
591 Ga0163161_10170686
592 Ga0207682_10075908
593 Ga0207642_10015431
594 Ga0207710_10053256
595 Ga0207688_10000819
596 Ga0207688_10102229
597 Ga0207688_10111804
598 Ga0207680_10009225
599 Ga0207680_10027265
600 Ga0207680_10115087
601 Ga0207699_10028443
602 Ga0207645_10001375
603 Ga0207645_10006078
604 Ga0207645_10083926
605 Ga0207643_10000735
606 Ga0207643_10009948
607 Ga0207643_10072520
608 Ga0207654_10038999
609 Ga0207654_10156792
610 Ga0207662_10077808
611 Ga0207649_10012658
612 Ga0207646_10237545
613 Ga0207681_10023396
614 Ga0207681_10077454
615 Ga0207681_10137747
616 Ga0207694_10003370
617 Ga0207694_10136635
618 Ga0207650_10113160
619 Ga0207659_10003094
620 Ga0207659_10003912
621 Ga0207659_10005387
622 Ga0207659_10008413
623 Ga0207659_10013397
624 Ga0207659_10014799
625 Ga0207659_10027962
626 Ga0207659_10063202
627 Ga0207659_10110879
628 Ga0207687_10001509
629 Ga0207687_10004087
630 Ga0207687_10011173
631 Ga0207687_10093051
632 Ga0207700_10172480
633 Ga0207644_10007926
634 Ga0207644_10057532
635 Ga0207690_10144039
636 Ga0207706_10015821
637 Ga0207706_10042204
638 Ga0207706_10489249
639 Ga0207686_10014855
640 Ga0207686_10057067
641 Ga0207686_10216870
642 Ga0207709_10009972
643 Ga0207670_10026329
644 Ga0207670_10032105
645 Ga0207704_10006537
646 Ga0207704_10016429
647 Ga0207691_10000927
648 Ga0207691_10024928
649 Ga0207711_10000806
650 Ga0207711_10028014
651 Ga0207711_10051498
652 Ga0207711_10136160
653 Ga0207711_10154625
654 Ga0207689_10003423
655 Ga0207689_10011095
656 Ga0207689_10011349
657 Ga0207689_10050980
658 Ga0207689_10084233
659 Ga0207689_10110902
660 Ga0207689_10316618
661 Ga0207679_10005608
662 Ga0207667_10103391
663 Ga0207651_10012435
664 Ga0207651_10031664
665 Ga0207651_10161210
666 Ga0207712_10036199
667 Ga0207658_10097618
668 Ga0207658_10164842
669 Ga0207677_10166062
670 Ga0207703_10020389
671 Ga0207703_10040694
672 Ga0207703_10050858
673 Ga0207703_10060669
674 Ga0207703_10065503
675 Ga0207703_10406236
676 Ga0207639_10358586
677 Ga0207708_10021278
678 Ga0207708_10039645
679 Ga0207708_10167994
680 Ga0207641_10001150
681 Ga0207641_10012858
682 Ga0207648_10003313
683 Ga0207648_10028944
684 Ga0207648_10042167
685 Ga0207648_10076881
686 Ga0207648_10079213
687 Ga0207648_10219196
688 Ga0207648_10360977
689 Ga0207676_10115587
690 Ga0207676_10298072
691 Ga0207674_10145578
692 Ga0207674_10308034
693 Ga0207675_100002693
694 Ga0207675_100022476
695 Ga0207675_100055393
696 Ga0207675_100095433
697 Ga0207683_10008167
698 Ga0207683_10130572
699 Ga0207683_10161896
700 Ga0207683_10200208
701 Ga0207698_10136896
702 Ga0207428_10000145
703 Ga0207428_10003697
704 Ga0207428_10020462
705 Ga0268266_10058622
706 Ga0268266_10160519
707 Ga0268265_10213571
708 Ga0268264_10028662
709 Ga0268264_10033026
710 Ga0268264_10050823
711 Ga0268264_10233288
712 Ga0265314_10000216
713 Ga0373923_0043100
714 Ga0373954_0001202
715 Ga0373954_0004037
716 Ga0373927_0144315
717 Ga0373933_0119010
718 Ga0373937_0010466
719 Ga0373937_0110623
720 Ga0373937_0168975
721 Ga0373925_0065608
722 Ga0436364_0908166
723 Ga0436365_0452654
724 Ga0436365_1619426
725 Ga0495580_0015432
726 Ga0495580_0135950
727 Ga0495582_0001391
728 Ga0495639_0035501
729 Ga0495608_0214578
730 Ga0495628_0046227
731 Ga0495630_0000908
732 Ga0495652_0078306
733 Ga0495652_0150903
734 Ga0495587_0007431
735 Ga0495598_0009087
736 Ga0495645_0110201
737 Ga0495633_0105119
738 Ga0495667_0031043
739 Ga0495667_0193226
740 Ga0495656_0104906
741 Ga0495623_0170179
742 Ga0495658_0014784
743 Ga0495658_0119387
744 Ga0495613_0002190
745 Ga0495613_0057670
746 Ga0495604_0056890
747 Ga0495674_0053235
748 Ga0495680_0148464
749 Ga0495675_0138830
750 Ga0495684_0000214
751 Ga0495684_0038719
752 Ga0495602_0034818
753 Ga0496113_0041429
754 nmdc:mga05p37_10172_c1
755 nmdc:mga05p37_186132_c1
756 nmdc:mga05p37_22877_c1
757 nmdc:mga05p37_8230_c1
758 nmdc:mga05p37_91835_c1
759 nmdc:mga09592_1172_c2
760 nmdc:mga09592_536086_c1
761 nmdc:mga09592_53999_c1
762 nmdc:mga09592_83813_c1
763 nmdc:mga0qj67_23509_c1
764 nmdc:mga0qj67_286910_c1
765 nmdc:mga0qj67_32875_c1
766 nmdc:mga06r32_146809_c1
767 nmdc:mga06r32_2191_c1
768 nmdc:mga06r32_240238_c1
769 nmdc:mga06r32_399362_c1
770 nmdc:mga06r32_79543_c1
771 nmdc:mga08y16_101188_c1
772 nmdc:mga08y16_119273_c1
773 nmdc:mga08y16_14552_c1
774 nmdc:mga08y16_28907_c1
775 nmdc:mga08y16_28978_c1
776 nmdc:mga08y16_300_c1
777 nmdc:mga08y16_6192_c1
778 nmdc:mga0n895_359218_c1
779 nmdc:mga0rr50_134308_c1
780 nmdc:mga0a205_14685_c1
781 nmdc:mga0a205_4979_c1
782 nmdc:mga0a205_49809_c1
783 nmdc:mga0a205_627_c1
784 Ga0495601_0002005
785 Ga0495601_0211227
786 Ga0495619_0000427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19335

HMBD

Heavy metal binding domain

72

98

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uc2-assembly4.cif.gz_D crystal structure of a duf4426 family protein (pa0388) from pseudomonas aeruginosa pao1 at 2.09 a resolution 0.7253 197 330
8d6k-assembly1.cif.gz_B sco glgei-v279s in complex with cyclohexyl carbasugar 0.716 85 159
1goc-assembly1.cif.gz_A cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution 0.715 304 328
5vt4-assembly2.cif.gz_C sco glgei-v279s in complex with a pyrolidene-based methyl-phosphonate compound 0.7078 85 159
3aa2-assembly1.cif.gz_A a52i e. coli rnase hi 0.7051 305 328
ID Description Score Start End Superfamily
af_Q57989_212_292_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.7539 307 330 3.30.160.40
af_F1Q5U3_774_866_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.707 75 179 2.60.40.10
af_Q08BN9_78_289_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.706 70 160 2.60.40.10
af_Q8I2V7_318_421_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7041 84 176 2.60.40.10
af_Q80YX1_899_982_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7035 84 175 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V9IA99-F1-model_v4 Heavy metal binding domain-containing protein 0.9538 37 330 GO:0046872
AF-A0A841U7T5-F1-model_v4 Secreted protein 0.9504 74 330
AF-A0A1M4U1W8-F1-model_v4 YtkA-like 0.9412 74 331
AF-A0A842PZ11-F1-model_v4 deleted 0.941 74 159
AF-A0A1I1X3B2-F1-model_v4 YtkA-like 0.9398 74 331

Map