F432529

General Info

Members Datasets Scaffolds Average Seq Length
393 238 786 234

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100167788|Ga0070663_1001677882
Length 259
Sequence MPSGGEITLTRTVLAGPEGGYLGEPLMSARPNIVLVHGAWADGSSFSAVIERLQADGYNVTAPQFPESSLAADVARLRQVLARQDGPTIVAGHSYGGQIITALGTDAPNVVGLVYIAAFGLDEGESIGGLLVQGPPTPALAHLDIDQQGFAWLPEDDFVNHFAADVDPVRARVMHAVQQPLAWSALDEVMGVPAWKSHPSWFLVADGDQAIPPDAERQFAARMGATTVEVPTNHVAMISHPDDVVQLIEAAAKAVQSAN

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
97 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
98 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
111 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.62
Metatranscriptomes 7.12
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 6.11
Rhizosphere 90.59
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100167788 3300005455 Bacteria 1694
2 JGI25407J50210_10009774 3300003373 Bacteria 2434
3 Ga0070658_10105392 3300005327 Bacteria 2332
4 Ga0070658_10257055 3300005327 Bacteria 1482
5 Ga0070680_100029449 3300005336 Bacteria 4410
6 Ga0070691_10208727 3300005341 Bacteria 1030
7 Ga0070692_10040788 3300005345 Bacteria 2376
8 Ga0070668_100167523 3300005347 Bacteria 1787
9 Ga0070709_10007883 3300005434 Bacteria 5849
10 Ga0070709_10160215 3300005434 Bacteria 1564
11 Ga0070714_100042064 3300005435 Bacteria 3859
12 Ga0070714_100070449 3300005435 Bacteria 3022
13 Ga0070714_100197078 3300005435 Bacteria 1841
14 Ga0070714_100467001 3300005435 Bacteria 1200
15 Ga0070714_100503809 3300005435 Bacteria 1155
16 Ga0070714_100754735 3300005435 Bacteria 941
17 Ga0070713_100036224 3300005436 Bacteria 3980
18 Ga0070713_100055530 3300005436 Bacteria 3291
19 Ga0070713_100158055 3300005436 Bacteria 2022
20 Ga0070713_100168687 3300005436 Bacteria 1959
21 Ga0070713_100295752 3300005436 Bacteria 1489
22 Ga0070713_100911605 3300005436 Bacteria 846
23 Ga0070710_10008445 3300005437 Bacteria 5013
24 Ga0070710_10177054 3300005437 Bacteria 1333
25 Ga0070711_100001090 3300005439 Bacteria 14511
26 Ga0070711_100027671 3300005439 Bacteria 3724
27 Ga0070711_100174088 3300005439 Bacteria 1643
28 Ga0070708_100062515 3300005445 Bacteria 3330
29 Ga0070708_100076230 3300005445 Bacteria 3028
30 Ga0070708_100446243 3300005445 Bacteria 1220
31 Ga0070708_100475845 3300005445 Bacteria 1178
32 Ga0070708_100717570 3300005445 Bacteria 941
33 Ga0070681_10017492 3300005458 Bacteria 7165
34 Ga0070681_10872829 3300005458 Unclassified 818
35 Ga0070706_100002642 3300005467 Bacteria 17937
36 Ga0070706_100040974 3300005467 Bacteria 4276
37 Ga0070706_100051064 3300005467 Bacteria 3815
38 Ga0070706_100415880 3300005467 Bacteria 1251
39 Ga0070706_100452005 3300005467 Bacteria 1195
40 Ga0070706_100488469 3300005467 Bacteria 1146
41 Ga0070707_100005990 3300005468 Bacteria 11343
42 Ga0070707_100012821 3300005468 Bacteria 7825
43 Ga0070707_100013771 3300005468 Bacteria 7574
44 Ga0070707_100053207 3300005468 Bacteria 3881
45 Ga0070707_100114271 3300005468 Bacteria 2619
46 Ga0070707_100158962 3300005468 Bacteria 2201
47 Ga0070698_100028076 3300005471 Bacteria 5848
48 Ga0070699_100029339 3300005518 Bacteria 4743
49 Ga0070699_100212245 3300005518 Bacteria 1723
50 Ga0070699_100350165 3300005518 Bacteria 1330
51 Ga0070699_100617775 3300005518 Bacteria 989
52 Ga0070679_100011016 3300005530 Bacteria 8597
53 Ga0070679_100142391 3300005530 Bacteria 2376
54 Ga0070697_100049797 3300005536 Bacteria 3399
55 Ga0070697_100083449 3300005536 Bacteria 2635
56 Ga0070697_100228449 3300005536 Bacteria 1587
57 Ga0070697_100279703 3300005536 Bacteria 1431
58 Ga0070665_100090248 3300005548 Bacteria 3070
59 Ga0070665_100668257 3300005548 Bacteria 1052
60 Ga0068857_100258613 3300005577 Bacteria 1597
61 Ga0068861_100072288 3300005719 Bacteria 2676
62 Ga0081455_10000318 3300005937 Bacteria 63202
63 Ga0081538_10000428 3300005981 Bacteria 47270
64 Ga0081538_10001397 3300005981 Bacteria 24777
65 Ga0081538_10001824 3300005981 Bacteria 21449
66 Ga0081538_10005691 3300005981 Bacteria 11149
67 Ga0081538_10015298 3300005981 Bacteria 5948
68 Ga0081538_10059569 3300005981 Bacteria 2204
69 Ga0081538_10166667 3300005981 Bacteria 969
70 Ga0081540_1000498 3300005983 Bacteria 38585
71 Ga0081540_1126424 3300005983 Bacteria 1051
72 Ga0081539_10081573 3300005985 Bacteria 1698
73 Ga0070717_10020304 3300006028 Bacteria 5222
74 Ga0070717_10096894 3300006028 Bacteria 2499
75 Ga0070717_10140499 3300006028 Bacteria 2083
76 Ga0070717_10179563 3300006028 Bacteria 1844
77 Ga0070717_10422848 3300006028 Bacteria 1199
78 Ga0070717_10765314 3300006028 Bacteria 878
79 Ga0070716_100041559 3300006173 Bacteria 2562
80 Ga0070712_100036918 3300006175 Bacteria 3327
81 Ga0070712_100053702 3300006175 Bacteria 2814
82 Ga0070712_100083593 3300006175 Bacteria 2318
83 Ga0075428_100857918 3300006844 Bacteria 964
84 Ga0075433_10003255 3300006852 Bacteria 12540
85 Ga0075433_10303980 3300006852 Bacteria 1412
86 Ga0075434_100276862 3300006871 Bacteria 1697
87 Ga0075435_100048073 3300007076 Bacteria 3426
88 Ga0075435_100271914 3300007076 Bacteria 1446
89 Ga0075435_100514996 3300007076 Bacteria 1035
90 Ga0111539_10405142 3300009094 Bacteria 1589
91 Ga0105245_10253226 3300009098 Bacteria 1711
92 Ga0105247_10480137 3300009101 Bacteria 902
93 Ga0114129_10033867 3300009147 Bacteria 7215
94 Ga0105248_10971745 3300009177 Bacteria 959
95 Ga0105237_10026599 3300009545 Bacteria 5914
96 Ga0105237_10685880 3300009545 Bacteria 1031
97 Ga0105238_10624738 3300009551 Bacteria 1086
98 Ga0105249_10556492 3300009553 Bacteria 1198
99 Ga0157371_10150881 3300013102 Bacteria 1657
100 Ga0157374_10304609 3300013296 Bacteria 1577
101 Ga0163162_10230108 3300013306 Bacteria 1984
102 Ga0157372_10721962 3300013307 Bacteria 1159
103 Ga0157377_10292674 3300014745 Bacteria 1072
104 Ga0163161_10478780 3300017792 Bacteria 1010
105 Ga0184599_136360 3300019188 Bacteria 1232
106 Ga0197907_11077068 3300020069 Bacteria 1161
107 Ga0206356_11421400 3300020070 Bacteria 1126
108 Ga0206355_1077302 3300020076 Bacteria 1348
109 Ga0206350_10231399 3300020080 Bacteria 1721
110 Ga0206350_10450223 3300020080 Bacteria 1580
111 Ga0206354_10119708 3300020081 Bacteria 1178
112 Ga0154015_1206648 3300020610 Bacteria 956
113 Ga0224712_10011818 3300022467 Bacteria 2723
114 Ga0224712_10025920 3300022467 Bacteria 2066
115 Ga0224712_10044405 3300022467 Bacteria 1695
116 Ga0207692_10000600 3300025898 Bacteria 12769
117 Ga0207647_10104453 3300025904 Bacteria 1679
118 Ga0207699_10000475 3300025906 Bacteria 20401
119 Ga0207699_10099722 3300025906 Bacteria 1841
120 Ga0207699_10155597 3300025906 Bacteria 1517
121 Ga0207699_10381477 3300025906 Bacteria 1000
122 Ga0207705_10014182 3300025909 Bacteria 5740
123 Ga0207684_10001050 3300025910 Bacteria 30876
124 Ga0207684_10001980 3300025910 Bacteria 21140
125 Ga0207684_10002951 3300025910 Bacteria 16855
126 Ga0207684_10003143 3300025910 Bacteria 16265
127 Ga0207684_10003474 3300025910 Bacteria 15373
128 Ga0207684_10031797 3300025910 Bacteria 4490
129 Ga0207684_10163156 3300025910 Bacteria 1919
130 Ga0207684_10176036 3300025910 Bacteria 1845
131 Ga0207707_10650750 3300025912 Bacteria 888
132 Ga0207693_10011971 3300025915 Bacteria 7014
133 Ga0207693_10016144 3300025915 Bacteria 5973
134 Ga0207693_10016419 3300025915 Bacteria 5917
135 Ga0207693_10231246 3300025915 Bacteria 1452
136 Ga0207663_10002460 3300025916 Bacteria 8914
137 Ga0207663_10036926 3300025916 Bacteria 2942
138 Ga0207663_10080235 3300025916 Bacteria 2133
139 Ga0207663_10186933 3300025916 Bacteria 1484
140 Ga0207660_10063774 3300025917 Bacteria 2658
141 Ga0207652_10004965 3300025921 Bacteria 10772
142 Ga0207646_10001698 3300025922 Bacteria 26773
143 Ga0207646_10004873 3300025922 Bacteria 14383
144 Ga0207646_10011961 3300025922 Bacteria 8369
145 Ga0207646_10059234 3300025922 Bacteria 3420
146 Ga0207646_10182555 3300025922 Bacteria 1895
147 Ga0207646_10233901 3300025922 Unclassified 1660
148 Ga0207687_10172244 3300025927 Bacteria 1670
149 Ga0207700_10000830 3300025928 Bacteria 17852
150 Ga0207700_10003033 3300025928 Bacteria 9687
151 Ga0207700_10668872 3300025928 Bacteria 926
152 Ga0207700_10913399 3300025928 Bacteria 786
153 Ga0207664_10001140 3300025929 Bacteria 17679
154 Ga0207664_10011546 3300025929 Bacteria 6286
155 Ga0207664_10011911 3300025929 Bacteria 6206
156 Ga0207664_10074391 3300025929 Bacteria 2745
157 Ga0207664_10102634 3300025929 Bacteria 2365
158 Ga0207664_10162566 3300025929 Bacteria 1905
159 Ga0207664_10313465 3300025929 Bacteria 1383
160 Ga0207664_10739317 3300025929 Bacteria 885
161 Ga0207670_10181263 3300025936 Bacteria 1587
162 Ga0207665_10017695 3300025939 Bacteria 4684
163 Ga0207665_10023719 3300025939 Bacteria 4040
164 Ga0207665_10260131 3300025939 Bacteria 1285
165 Ga0207689_10054421 3300025942 Bacteria 3295
166 Ga0207661_10593408 3300025944 Bacteria 1016
167 Ga0207651_10199992 3300025960 Bacteria 1601
168 Ga0207668_10193669 3300025972 Bacteria 1613
169 Ga0207640_10026606 3300025981 Bacteria 3515
170 Ga0207678_10105193 3300026067 Bacteria 2408
171 Ga0207702_10310929 3300026078 Bacteria 1498
172 Ga0207702_10849301 3300026078 Bacteria 904
173 Ga0207674_10240919 3300026116 Bacteria 1755
174 Ga0207675_100228506 3300026118 Bacteria 1795
175 Ga0207675_100325481 3300026118 Bacteria 1501
176 Ga0207428_10218703 3300027907 Bacteria 1429
177 Ga0268266_10508427 3300028379 Bacteria 1151
178 Ga0265762_1007037 3300030760 Bacteria 2010
179 Ga0265762_1026085 3300030760 Bacteria 1092
180 Ga0265775_100378 3300030762 Bacteria 1762
181 Ga0265777_100591 3300030877 Bacteria 1720
182 Ga0265777_101280 3300030877 Bacteria 1323
183 Ga0265779_100848 3300031043 Bacteria 1240
184 Ga0265332_10046865 3300031238 Bacteria 1861
185 Ga0265325_10008946 3300031241 Bacteria 5880
186 Ga0265327_10020135 3300031251 Bacteria 4077
187 Ga0265316_10368182 3300031344 Bacteria 1038
188 Ga0307513_10032682 3300031456 Bacteria 5863
189 Ga0307408_100092767 3300031548 Bacteria 2283
190 Ga0310117_100069 3300031592 Bacteria 4640
191 Ga0265313_10000416 3300031595 Bacteria 45693
192 Ga0310103_108496 3300031614 Bacteria 1385
193 Ga0310115_107906 3300031635 Bacteria 1261
194 Ga0310105_106497 3300031666 Bacteria 1288
195 Ga0310119_108279 3300031686 Bacteria 1272
196 Ga0310101_111264 3300031690 Bacteria 996
197 Ga0307413_10004578 3300031824 Bacteria 6039
198 Ga0307410_10000468 3300031852 Bacteria 16347
199 Ga0307406_10011037 3300031901 Bacteria 5116
200 Ga0307406_10273187 3300031901 Bacteria 1285
201 Ga0307407_10000667 3300031903 Bacteria 11065
202 Ga0307412_10005930 3300031911 Bacteria 6888
203 Ga0307409_100095022 3300031995 Bacteria 2454
204 Ga0307409_100363240 3300031995 Bacteria 1370
205 Ga0307416_100078533 3300032002 Bacteria 2777
206 Ga0307411_10000599 3300032005 Bacteria 12936
207 Ga0307415_100001898 3300032126 Bacteria 10261
208 Ga0307415_100051314 3300032126 Bacteria 2798
209 Ga0316215_1005340 3300033544 Bacteria 1238
210 Ga0316212_1001273 3300033547 Bacteria 3413
211 Ga0373926_0008928 3300035083 Bacteria 3341
212 Ga0373934_0003306 3300035086 Bacteria 5901
213 Ga0373944_0000957 3300035089 Bacteria 7147
214 Ga0373944_0048246 3300035089 Bacteria 1336
215 Ga0373923_0000263 3300035111 Bacteria 11465
216 Ga0373936_0000495 3300035113 Bacteria 13320
217 Ga0373945_0039340 3300035116 Bacteria 1704
218 Ga0373954_0001892 3300035118 Bacteria 8646
219 Ga0373956_0003103 3300035119 Bacteria 6719
220 Ga0373957_0239375 3300035120 Bacteria 762
221 Ga0373943_0000491 3300035170 Bacteria 16851
222 Ga0373946_0003286 3300035171 Bacteria 5742
223 Ga0373955_0009379 3300035172 Bacteria 4579
224 Ga0373955_0311621 3300035172 Bacteria 950
225 Ga0373924_0000133 3300035410 Bacteria 21727
226 Ga0373924_0088102 3300035410 Bacteria 1326
227 Ga0373931_0788152 3300035691 Bacteria 633
228 Ga0373935_0013233 3300035692 Bacteria 4976
229 Ga0373935_0169171 3300035692 Bacteria 1494
230 Ga0373935_0375294 3300035692 Bacteria 1017
231 Ga0373927_0004536 3300035695 Bacteria 9703
232 Ga0373927_0064578 3300035695 Bacteria 2368
233 Ga0373933_0004048 3300035724 Bacteria 8077
234 Ga0373933_0042741 3300035724 Bacteria 2679
235 Ga0373947_0005720 3300035725 Bacteria 7250
236 Ga0373947_0235112 3300035725 Bacteria 1208
237 Ga0310104_09993 3300036242 Unclassified 776
238 Ga0373937_0017731 3300036401 Bacteria 6352
239 Ga0373937_0116124 3300036401 Bacteria 2492
240 Ga0265778_002687 3300036457 Bacteria 1738
241 Ga0265778_005811 3300036457 Bacteria 1314
242 Ga0265778_009410 3300036457 Bacteria 1099
243 Ga0265778_018252 3300036457 Bacteria 851
244 Ga0373925_0000006 3300037068 Bacteria 278942
245 Ga0373925_0053027 3300037068 Bacteria 3030
246 Ga0373925_0072728 3300037068 Bacteria 2601
247 Ga0395899_0055965 3300037312 Bacteria 2916
248 Ga0395900_0040457 3300037418 Bacteria 4804
249 Ga0395900_0182260 3300037418 Bacteria 2133
250 Ga0395900_0558870 3300037418 Bacteria 1088
251 Ga0395900_0796954 3300037418 Bacteria 873
252 Ga0395898_0336572 3300037466 Bacteria 1439
253 Ga0395905_0122292 3300037471 Bacteria 2447
254 Ga0395905_0293246 3300037471 Bacteria 1513
255 Ga0395901_0006945 3300038443 Bacteria 11436
256 Ga0436363_0107713 3300039450 Bacteria 2056
257 Ga0436363_0617629 3300039450 Bacteria 1048
258 Ga0439455_0089305 3300042012 Bacteria 844
259 Ga0439440_0013647 3300042993 Bacteria 1745
260 Ga0466963_0005468 3300044694 Bacteria 7440
261 Ga0466964_0051888 3300044706 Bacteria 1685
262 Ga0466957_0216517 3300044842 Bacteria 1263
263 Ga0466958_0000877 3300045836 Bacteria 13433
264 Ga0466967_0000309 3300045976 Bacteria 22007
265 Ga0495592_0006962 3300046454 Bacteria 8447
266 Ga0495603_0000796 3300046455 Bacteria 18040
267 Ga0495629_0002799 3300046459 Bacteria 13303
268 Ga0495641_0006338 3300046461 Bacteria 7688
269 Ga0495651_0024918 3300046462 Bacteria 4654
270 Ga0495651_0097927 3300046462 Bacteria 2189
271 Ga0495653_0024361 3300046463 Bacteria 4877
272 Ga0495653_0035731 3300046463 Bacteria 3919
273 Ga0495653_0270235 3300046463 Bacteria 1120
274 Ga0495580_0004673 3300046472 Bacteria 11487
275 Ga0495582_0000484 3300046473 Bacteria 21782
276 Ga0495639_0001689 3300046475 Bacteria 9792
277 Ga0495662_0001070 3300046476 Bacteria 13455
278 Ga0495664_0001684 3300046477 Bacteria 11752
279 Ga0495594_0007002 3300046499 Bacteria 5795
280 Ga0495608_0008715 3300046511 Bacteria 7095
281 Ga0495618_0011897 3300046514 Bacteria 5280
282 Ga0495628_0013088 3300046516 Bacteria 6985
283 Ga0495628_0215170 3300046516 Bacteria 1444
284 Ga0495630_0015430 3300046517 Bacteria 5578
285 Ga0495630_0491272 3300046517 Bacteria 941
286 Ga0495666_0003595 3300046526 Bacteria 7836
287 Ga0495652_0024621 3300046529 Bacteria 5325
288 Ga0495652_0025880 3300046529 Bacteria 5185
289 Ga0495652_0265570 3300046529 Bacteria 1264
290 Ga0495665_0007859 3300046531 Bacteria 5775
291 Ga0495640_0022137 3300046533 Bacteria 4652
292 Ga0495586_0006719 3300046535 Bacteria 6144
293 Ga0495587_0006123 3300046536 Bacteria 7852
294 Ga0495587_0085509 3300046536 Bacteria 1826
295 Ga0495645_0004322 3300046543 Bacteria 9706
296 Ga0495645_0266205 3300046543 Bacteria 1133
297 Ga0495667_0004517 3300046559 Bacteria 9391
298 Ga0495667_0168907 3300046559 Bacteria 1406
299 Ga0495667_0342261 3300046559 Bacteria 945
300 Ga0495634_0004002 3300046642 Bacteria 11702
301 Ga0495634_0069558 3300046642 Bacteria 2322
302 Ga0495635_0006387 3300046663 Bacteria 8214
303 Ga0495659_0065132 3300046664 Bacteria 1355
304 Ga0495588_0008925 3300046674 Bacteria 4616
305 Ga0495657_0010018 3300046675 Bacteria 7149
306 Ga0495599_0003050 3300046678 Bacteria 9749
307 Ga0495623_0008030 3300046679 Bacteria 6860
308 Ga0495623_0170089 3300046679 Bacteria 1274
309 Ga0495646_0005778 3300046680 Bacteria 7848
310 Ga0495647_0005570 3300046681 Bacteria 4133
311 Ga0495658_0007666 3300046683 Bacteria 5350
312 Ga0495613_0016529 3300046689 Bacteria 5494
313 Ga0495624_0009011 3300046690 Bacteria 6934
314 Ga0495600_0021688 3300046809 Bacteria 4117
315 Ga0495581_0000290 3300047315 Bacteria 24348
316 Ga0495581_0289293 3300047315 Bacteria 958
317 Ga0495604_0021216 3300047317 Bacteria 5185
318 Ga0495604_0086064 3300047317 Bacteria 2344
319 Ga0495674_0055489 3300047319 Bacteria 3474
320 Ga0495674_0136254 3300047319 Bacteria 2066
321 Ga0495674_0373705 3300047319 Bacteria 1154
322 Ga0495676_0006291 3300047321 Bacteria 10926
323 Ga0495676_0319477 3300047321 Bacteria 1043
324 Ga0495680_0036010 3300047322 Bacteria 3979
325 Ga0495680_0121557 3300047322 Bacteria 1927
326 Ga0495680_0522246 3300047322 Bacteria 803
327 Ga0495675_0002192 3300047444 Bacteria 11646
328 Ga0495684_0003559 3300047471 Bacteria 12168
329 Ga0495593_0003684 3300047673 Bacteria 9149
330 Ga0495602_0015051 3300048088 Bacteria 7823
331 Ga0495614_0004514 3300048089 Bacteria 6279
332 Ga0495614_0109255 3300048089 Bacteria 1214
333 Ga0496100_0010898 3300048903 Bacteria 5160
334 Ga0496101_0009288 3300048904 Bacteria 6458
335 Ga0496102_0074788 3300048905 Bacteria 3114
336 Ga0496104_0030399 3300048907 Bacteria 5019
337 Ga0496104_0064753 3300048907 Bacteria 3467
338 Ga0496104_0271391 3300048907 Bacteria 1609
339 Ga0496106_0004689 3300048909 Bacteria 10131
340 Ga0496106_0021904 3300048909 Bacteria 4747
341 Ga0496107_0017695 3300048910 Bacteria 5014
342 Ga0496107_0235934 3300048910 Bacteria 1361
343 Ga0496107_0323573 3300048910 Bacteria 1147
344 Ga0496108_0066800 3300048911 Bacteria 3033
345 Ga0496108_0454234 3300048911 Bacteria 1119
346 Ga0496110_0214865 3300048913 Bacteria 1749
347 Ga0496110_0421064 3300048913 Bacteria 1217
348 Ga0496111_0219870 3300048914 Bacteria 1411
349 Ga0496111_0296714 3300048914 Bacteria 1198
350 Ga0496112_0510185 3300048915 Bacteria 1138
351 Ga0496113_0043887 3300048916 Bacteria 3310
352 Ga0496113_0534539 3300048916 Bacteria 941
353 Ga0496115_0037299 3300048918 Bacteria 3852
354 Ga0496115_0049705 3300048918 Bacteria 3357
355 Ga0496115_0058935 3300048918 Bacteria 3091
356 Ga0496115_0375989 3300048918 Bacteria 1156
357 Ga0501031_0083318 3300049568 Bacteria 2084
358 Ga0501033_0262484 3300049570 Bacteria 1222
359 Ga0501034_0327313 3300049571 Bacteria 1464
360 Ga0501036_0087110 3300049572 Bacteria 2640
361 Ga0501038_0008766 3300049574 Bacteria 9277
362 Ga0501040_0035987 3300049576 Bacteria 3358
363 Ga0501041_0028525 3300049577 Bacteria 3367
364 Ga0501042_0138159 3300049578 Bacteria 1756
365 Ga0501048_0196836 3300049582 Bacteria 1428
366 Ga0501070_0082721 3300049586 Bacteria 2657
367 Ga0501071_0313436 3300049587 Bacteria 1190
368 Ga0501074_0010475 3300049590 Bacteria 6729
369 Ga0501075_0056440 3300049591 Bacteria 2956
370 Ga0501076_0305557 3300049592 Bacteria 1304
371 Ga0501081_0018379 3300049743 Bacteria 4643
372 Ga0501035_0128369 3300049822 Bacteria 2212
373 Ga0501045_0006435 3300049824 Bacteria 8135
374 nmdc:mga05p37_52130_c1 3300050507 Bacteria 5032
375 nmdc:mga05p37_701208_c1 3300050507 Bacteria 1124
376 nmdc:mga08y16_326534_c1 3300050511 Bacteria 1579
377 nmdc:mga0n895_395173_c1 3300050512 Bacteria 1399
378 nmdc:mga0rr50_269501_c1 3300050513 Bacteria 1418
379 nmdc:mga08x19_100820_c1 3300050514 Bacteria 1916
380 nmdc:mga0a205_11931_c1 3300050515 Bacteria 8024
381 nmdc:mga0a205_233777_c1 3300050515 Bacteria 1721
382 nmdc:mga0a205_761163_c1 3300050515 Bacteria 817
383 Ga0495601_0007273 3300053077 Bacteria 6492
384 Ga0495601_0055773 3300053077 Bacteria 2502
385 Ga0495612_0001886 3300053078 Bacteria 8623
386 Ga0495595_0032759 3300053084 Bacteria 2342
387 Ga0495619_0004780 3300053085 Bacteria 8615
388 Ga0500641_0070059 3300053096 Bacteria 1475
389 Ga0501084_0177405 3300054114 Bacteria 1798
390 Ga0590071_046663 3300059421 Bacteria 1047
391 Ga0501082_0053158 3300060353 Bacteria 3492
392 Ga0530510_0136825 3300061734 Bacteria 1804
393 2623585535 2622736626 Bacteria 7181580
394 Ga0070663_100167788
395 JGI25407J50210_10009774
396 Ga0070658_10105392
397 Ga0070658_10257055
398 Ga0070680_100029449
399 Ga0070691_10208727
400 Ga0070692_10040788
401 Ga0070668_100167523
402 Ga0070709_10007883
403 Ga0070709_10160215
404 Ga0070714_100042064
405 Ga0070714_100070449
406 Ga0070714_100197078
407 Ga0070714_100467001
408 Ga0070714_100503809
409 Ga0070714_100754735
410 Ga0070713_100036224
411 Ga0070713_100055530
412 Ga0070713_100158055
413 Ga0070713_100168687
414 Ga0070713_100295752
415 Ga0070713_100911605
416 Ga0070710_10008445
417 Ga0070710_10177054
418 Ga0070711_100001090
419 Ga0070711_100027671
420 Ga0070711_100174088
421 Ga0070708_100062515
422 Ga0070708_100076230
423 Ga0070708_100446243
424 Ga0070708_100475845
425 Ga0070708_100717570
426 Ga0070681_10017492
427 Ga0070681_10872829
428 Ga0070706_100002642
429 Ga0070706_100040974
430 Ga0070706_100051064
431 Ga0070706_100415880
432 Ga0070706_100452005
433 Ga0070706_100488469
434 Ga0070707_100005990
435 Ga0070707_100012821
436 Ga0070707_100013771
437 Ga0070707_100053207
438 Ga0070707_100114271
439 Ga0070707_100158962
440 Ga0070698_100028076
441 Ga0070699_100029339
442 Ga0070699_100212245
443 Ga0070699_100350165
444 Ga0070699_100617775
445 Ga0070679_100011016
446 Ga0070679_100142391
447 Ga0070697_100049797
448 Ga0070697_100083449
449 Ga0070697_100228449
450 Ga0070697_100279703
451 Ga0070665_100090248
452 Ga0070665_100668257
453 Ga0068857_100258613
454 Ga0068861_100072288
455 Ga0081455_10000318
456 Ga0081538_10000428
457 Ga0081538_10001397
458 Ga0081538_10001824
459 Ga0081538_10005691
460 Ga0081538_10015298
461 Ga0081538_10059569
462 Ga0081538_10166667
463 Ga0081540_1000498
464 Ga0081540_1126424
465 Ga0081539_10081573
466 Ga0070717_10020304
467 Ga0070717_10096894
468 Ga0070717_10140499
469 Ga0070717_10179563
470 Ga0070717_10422848
471 Ga0070717_10765314
472 Ga0070716_100041559
473 Ga0070712_100036918
474 Ga0070712_100053702
475 Ga0070712_100083593
476 Ga0075428_100857918
477 Ga0075433_10003255
478 Ga0075433_10303980
479 Ga0075434_100276862
480 Ga0075435_100048073
481 Ga0075435_100271914
482 Ga0075435_100514996
483 Ga0111539_10405142
484 Ga0105245_10253226
485 Ga0105247_10480137
486 Ga0114129_10033867
487 Ga0105248_10971745
488 Ga0105237_10026599
489 Ga0105237_10685880
490 Ga0105238_10624738
491 Ga0105249_10556492
492 Ga0157371_10150881
493 Ga0157374_10304609
494 Ga0163162_10230108
495 Ga0157372_10721962
496 Ga0157377_10292674
497 Ga0163161_10478780
498 Ga0184599_136360
499 Ga0197907_11077068
500 Ga0206356_11421400
501 Ga0206355_1077302
502 Ga0206350_10231399
503 Ga0206350_10450223
504 Ga0206354_10119708
505 Ga0154015_1206648
506 Ga0224712_10011818
507 Ga0224712_10025920
508 Ga0224712_10044405
509 Ga0207692_10000600
510 Ga0207647_10104453
511 Ga0207699_10000475
512 Ga0207699_10099722
513 Ga0207699_10155597
514 Ga0207699_10381477
515 Ga0207705_10014182
516 Ga0207684_10001050
517 Ga0207684_10001980
518 Ga0207684_10002951
519 Ga0207684_10003143
520 Ga0207684_10003474
521 Ga0207684_10031797
522 Ga0207684_10163156
523 Ga0207684_10176036
524 Ga0207707_10650750
525 Ga0207693_10011971
526 Ga0207693_10016144
527 Ga0207693_10016419
528 Ga0207693_10231246
529 Ga0207663_10002460
530 Ga0207663_10036926
531 Ga0207663_10080235
532 Ga0207663_10186933
533 Ga0207660_10063774
534 Ga0207652_10004965
535 Ga0207646_10001698
536 Ga0207646_10004873
537 Ga0207646_10011961
538 Ga0207646_10059234
539 Ga0207646_10182555
540 Ga0207646_10233901
541 Ga0207687_10172244
542 Ga0207700_10000830
543 Ga0207700_10003033
544 Ga0207700_10668872
545 Ga0207700_10913399
546 Ga0207664_10001140
547 Ga0207664_10011546
548 Ga0207664_10011911
549 Ga0207664_10074391
550 Ga0207664_10102634
551 Ga0207664_10162566
552 Ga0207664_10313465
553 Ga0207664_10739317
554 Ga0207670_10181263
555 Ga0207665_10017695
556 Ga0207665_10023719
557 Ga0207665_10260131
558 Ga0207689_10054421
559 Ga0207661_10593408
560 Ga0207651_10199992
561 Ga0207668_10193669
562 Ga0207640_10026606
563 Ga0207678_10105193
564 Ga0207702_10310929
565 Ga0207702_10849301
566 Ga0207674_10240919
567 Ga0207675_100228506
568 Ga0207675_100325481
569 Ga0207428_10218703
570 Ga0268266_10508427
571 Ga0265762_1007037
572 Ga0265762_1026085
573 Ga0265775_100378
574 Ga0265777_100591
575 Ga0265777_101280
576 Ga0265779_100848
577 Ga0265332_10046865
578 Ga0265325_10008946
579 Ga0265327_10020135
580 Ga0265316_10368182
581 Ga0307513_10032682
582 Ga0307408_100092767
583 Ga0310117_100069
584 Ga0265313_10000416
585 Ga0310103_108496
586 Ga0310115_107906
587 Ga0310105_106497
588 Ga0310119_108279
589 Ga0310101_111264
590 Ga0307413_10004578
591 Ga0307410_10000468
592 Ga0307406_10011037
593 Ga0307406_10273187
594 Ga0307407_10000667
595 Ga0307412_10005930
596 Ga0307409_100095022
597 Ga0307409_100363240
598 Ga0307416_100078533
599 Ga0307411_10000599
600 Ga0307415_100001898
601 Ga0307415_100051314
602 Ga0316215_1005340
603 Ga0316212_1001273
604 Ga0373926_0008928
605 Ga0373934_0003306
606 Ga0373944_0000957
607 Ga0373944_0048246
608 Ga0373923_0000263
609 Ga0373936_0000495
610 Ga0373945_0039340
611 Ga0373954_0001892
612 Ga0373956_0003103
613 Ga0373957_0239375
614 Ga0373943_0000491
615 Ga0373946_0003286
616 Ga0373955_0009379
617 Ga0373955_0311621
618 Ga0373924_0000133
619 Ga0373924_0088102
620 Ga0373931_0788152
621 Ga0373935_0013233
622 Ga0373935_0169171
623 Ga0373935_0375294
624 Ga0373927_0004536
625 Ga0373927_0064578
626 Ga0373933_0004048
627 Ga0373933_0042741
628 Ga0373947_0005720
629 Ga0373947_0235112
630 Ga0310104_09993
631 Ga0373937_0017731
632 Ga0373937_0116124
633 Ga0265778_002687
634 Ga0265778_005811
635 Ga0265778_009410
636 Ga0265778_018252
637 Ga0373925_0000006
638 Ga0373925_0053027
639 Ga0373925_0072728
640 Ga0395899_0055965
641 Ga0395900_0040457
642 Ga0395900_0182260
643 Ga0395900_0558870
644 Ga0395900_0796954
645 Ga0395898_0336572
646 Ga0395905_0122292
647 Ga0395905_0293246
648 Ga0395901_0006945
649 Ga0436363_0107713
650 Ga0436363_0617629
651 Ga0439455_0089305
652 Ga0439440_0013647
653 Ga0466963_0005468
654 Ga0466964_0051888
655 Ga0466957_0216517
656 Ga0466958_0000877
657 Ga0466967_0000309
658 Ga0495592_0006962
659 Ga0495603_0000796
660 Ga0495629_0002799
661 Ga0495641_0006338
662 Ga0495651_0024918
663 Ga0495651_0097927
664 Ga0495653_0024361
665 Ga0495653_0035731
666 Ga0495653_0270235
667 Ga0495580_0004673
668 Ga0495582_0000484
669 Ga0495639_0001689
670 Ga0495662_0001070
671 Ga0495664_0001684
672 Ga0495594_0007002
673 Ga0495608_0008715
674 Ga0495618_0011897
675 Ga0495628_0013088
676 Ga0495628_0215170
677 Ga0495630_0015430
678 Ga0495630_0491272
679 Ga0495666_0003595
680 Ga0495652_0024621
681 Ga0495652_0025880
682 Ga0495652_0265570
683 Ga0495665_0007859
684 Ga0495640_0022137
685 Ga0495586_0006719
686 Ga0495587_0006123
687 Ga0495587_0085509
688 Ga0495645_0004322
689 Ga0495645_0266205
690 Ga0495667_0004517
691 Ga0495667_0168907
692 Ga0495667_0342261
693 Ga0495634_0004002
694 Ga0495634_0069558
695 Ga0495635_0006387
696 Ga0495659_0065132
697 Ga0495588_0008925
698 Ga0495657_0010018
699 Ga0495599_0003050
700 Ga0495623_0008030
701 Ga0495623_0170089
702 Ga0495646_0005778
703 Ga0495647_0005570
704 Ga0495658_0007666
705 Ga0495613_0016529
706 Ga0495624_0009011
707 Ga0495600_0021688
708 Ga0495581_0000290
709 Ga0495581_0289293
710 Ga0495604_0021216
711 Ga0495604_0086064
712 Ga0495674_0055489
713 Ga0495674_0136254
714 Ga0495674_0373705
715 Ga0495676_0006291
716 Ga0495676_0319477
717 Ga0495680_0036010
718 Ga0495680_0121557
719 Ga0495680_0522246
720 Ga0495675_0002192
721 Ga0495684_0003559
722 Ga0495593_0003684
723 Ga0495602_0015051
724 Ga0495614_0004514
725 Ga0495614_0109255
726 Ga0496100_0010898
727 Ga0496101_0009288
728 Ga0496102_0074788
729 Ga0496104_0030399
730 Ga0496104_0064753
731 Ga0496104_0271391
732 Ga0496106_0004689
733 Ga0496106_0021904
734 Ga0496107_0017695
735 Ga0496107_0235934
736 Ga0496107_0323573
737 Ga0496108_0066800
738 Ga0496108_0454234
739 Ga0496110_0214865
740 Ga0496110_0421064
741 Ga0496111_0219870
742 Ga0496111_0296714
743 Ga0496112_0510185
744 Ga0496113_0043887
745 Ga0496113_0534539
746 Ga0496115_0037299
747 Ga0496115_0049705
748 Ga0496115_0058935
749 Ga0496115_0375989
750 Ga0501031_0083318
751 Ga0501033_0262484
752 Ga0501034_0327313
753 Ga0501036_0087110
754 Ga0501038_0008766
755 Ga0501040_0035987
756 Ga0501041_0028525
757 Ga0501042_0138159
758 Ga0501048_0196836
759 Ga0501070_0082721
760 Ga0501071_0313436
761 Ga0501074_0010475
762 Ga0501075_0056440
763 Ga0501076_0305557
764 Ga0501081_0018379
765 Ga0501035_0128369
766 Ga0501045_0006435
767 nmdc:mga05p37_52130_c1
768 nmdc:mga05p37_701208_c1
769 nmdc:mga08y16_326534_c1
770 nmdc:mga0n895_395173_c1
771 nmdc:mga0rr50_269501_c1
772 nmdc:mga08x19_100820_c1
773 nmdc:mga0a205_11931_c1
774 nmdc:mga0a205_233777_c1
775 nmdc:mga0a205_761163_c1
776 Ga0495601_0007273
777 Ga0495601_0055773
778 Ga0495612_0001886
779 Ga0495595_0032759
780 Ga0495619_0004780
781 Ga0500641_0070059
782 Ga0501084_0177405
783 Ga0590071_046663
784 Ga0501082_0053158
785 Ga0530510_0136825
786 2623585535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12695

Abhydrolase_5

Alpha/beta hydrolase family

32

132

0.9

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

33

247

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.903 5 226
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.894 5 226
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.8762 5 226
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.8661 5 226
7wwf-assembly3.cif.gz_E crystal structure of bioh3 from mycolicibacterium smegmatis 0.8647 5 222
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9565 4 225 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.924 4 225 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8871 6 225 3.40.50.1820
af_I1JYD1_9_266_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8673 1 226 3.40.50.1820
af_A0A0R0FZI3_6_303_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8653 1 225 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A535X0H1-F1-model_v4 Alpha/beta hydrolase 0.991 3 225 GO:0016787
AF-A0A536GSF7-F1-model_v4 Alpha/beta hydrolase 0.9906 2 225 GO:0016787
AF-A0A2E0L8Z7-F1-model_v4 Alpha/beta hydrolase 0.9887 4 226 GO:0016020
GO:0016787
AF-A0A538H435-F1-model_v4 Alpha/beta hydrolase 0.9878 4 226 GO:0016787
AF-A0A418MWP4-F1-model_v4 Alpha/beta hydrolase 0.9874 1 226 GO:0016787

Map