F432497

General Info

Members Datasets Scaffolds Average Seq Length
393 191 786 158

Family's Representative Sequence

Representative Sequence 3300004798|Ga0058859_11716650|Ga0058859_117166501
Length 160
Sequence MKGDPKVIDYLNKALRHELTAVNQYWLHYRLLDNWGIKDLAKKWRAESIEEMEHADKLIDRIIFLDGFPNMQVLDPLHIGQNVGEVMDCDLKAEYSARALYEEAATHCHAVKDYVTRDIFEKLMKDEESHIDFLETQIDLIKKIGVELYSQKHIGEMDHD

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0
Rhizoplane 1.78
Rhizosphere 92.88
Stem 0
Stem Tuber 0
Unclassified 12.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11716650 3300004798 Bacteria 553
2 Ga0058860_11471490 3300004801 Bacteria 618
3 Ga0070658_10063675 3300005327 Unclassified 3007
4 Ga0070683_100060651 3300005329 Bacteria 3516
5 Ga0070683_100084012 3300005329 Bacteria 2983
6 Ga0070690_100216943 3300005330 Unclassified 1339
7 Ga0070680_100000779 3300005336 Bacteria 22350
8 Ga0070680_100100861 3300005336 Bacteria 2396
9 Ga0070680_100107575 3300005336 Bacteria 2320
10 Ga0070680_100501769 3300005336 Bacteria 1038
11 Ga0070682_100583339 3300005337 Bacteria 880
12 Ga0070682_100806573 3300005337 Unclassified 763
13 Ga0068868_101468049 3300005338 Bacteria 638
14 Ga0070660_100666867 3300005339 Unclassified 871
15 Ga0070689_100086758 3300005340 Bacteria 2461
16 Ga0070689_100179532 3300005340 Unclassified 1719
17 Ga0070689_100249918 3300005340 Bacteria 1463
18 Ga0070689_100882967 3300005340 Bacteria 790
19 Ga0070691_10495949 3300005341 Bacteria 705
20 Ga0070671_100044041 3300005355 Bacteria 3708
21 Ga0070671_100064562 3300005355 Bacteria 3049
22 Ga0070673_101220600 3300005364 Bacteria 705
23 Ga0070688_100034989 3300005365 Bacteria 3048
24 Ga0070688_100390681 3300005365 Unclassified 1028
25 Ga0070659_101591055 3300005366 Bacteria 583
26 Ga0070709_10446866 3300005434 Bacteria 973
27 Ga0070714_100270982 3300005435 Bacteria 1574
28 Ga0070713_100938194 3300005436 Bacteria 833
29 Ga0070711_100658256 3300005439 Bacteria 879
30 Ga0070708_100190080 3300005445 Unclassified 1920
31 Ga0070663_100301217 3300005455 Bacteria 1283
32 Ga0070681_10030452 3300005458 Bacteria 5414
33 Ga0070681_10175103 3300005458 Bacteria 2067
34 Ga0070681_10175810 3300005458 Bacteria 2063
35 Ga0070681_10931986 3300005458 Bacteria 787
36 Ga0068867_100332478 3300005459 Bacteria 1262
37 Ga0068867_101148471 3300005459 Bacteria 711
38 Ga0070685_10668140 3300005466 Unclassified 754
39 Ga0070685_11216958 3300005466 Bacteria 573
40 Ga0070679_100060672 3300005530 Bacteria 3769
41 Ga0070679_100232634 3300005530 Bacteria 1802
42 Ga0070679_100454793 3300005530 Bacteria 1225
43 Ga0070679_100608475 3300005530 Bacteria 1036
44 Ga0070684_100218213 3300005535 Unclassified 1740
45 Ga0070684_100268201 3300005535 Bacteria 1562
46 Ga0070665_100027303 3300005548 Bacteria 5750
47 Ga0070665_100519045 3300005548 Bacteria 1203
48 Ga0068855_100037950 3300005563 Bacteria 5726
49 Ga0068855_100304785 3300005563 Bacteria 1763
50 Ga0068855_100453717 3300005563 Bacteria 1398
51 Ga0070664_100741974 3300005564 Unclassified 916
52 Ga0070664_101019284 3300005564 Bacteria 778
53 Ga0070664_101676507 3300005564 Bacteria 602
54 Ga0068856_100819676 3300005614 Bacteria 950
55 Ga0068856_101245713 3300005614 Bacteria 760
56 Ga0068859_100138008 3300005617 Bacteria 2512
57 Ga0068859_100863162 3300005617 Bacteria 991
58 Ga0068864_100588189 3300005618 Bacteria 1079
59 Ga0068851_10054266 3300005834 Bacteria 2041
60 Ga0068863_100013414 3300005841 Bacteria 7902
61 Ga0068863_100320238 3300005841 Bacteria 1506
62 Ga0068858_100173183 3300005842 Bacteria 2036
63 Ga0068858_100742961 3300005842 Bacteria 956
64 Ga0075365_10222768 3300006038 Bacteria 1323
65 Ga0075363_100032952 3300006048 Bacteria 2694
66 Ga0070715_10758681 3300006163 Bacteria 585
67 Ga0075367_10009863 3300006178 Bacteria 5003
68 Ga0075367_10038891 3300006178 Bacteria 2772
69 Ga0097621_100109727 3300006237 Bacteria 2331
70 Ga0097621_100202990 3300006237 Unclassified 1722
71 Ga0097621_100736366 3300006237 Bacteria 910
72 Ga0097621_100871999 3300006237 Unclassified 837
73 Ga0097621_101115804 3300006237 Bacteria 741
74 Ga0075370_10016300 3300006353 Bacteria 3998
75 Ga0068871_100085833 3300006358 Bacteria 2615
76 Ga0068871_100196206 3300006358 Bacteria 1741
77 Ga0068871_100484234 3300006358 Bacteria 1113
78 Ga0068871_100775155 3300006358 Bacteria 883
79 Ga0068871_100802564 3300006358 Bacteria 868
80 Ga0068871_100934864 3300006358 Bacteria 805
81 Ga0068871_101213044 3300006358 Bacteria 708
82 Ga0068871_101440093 3300006358 Bacteria 650
83 Ga0075430_100838648 3300006846 Unclassified 757
84 Ga0075431_100011755 3300006847 Bacteria 8833
85 Ga0097620_100138010 3300006931 Bacteria 2512
86 Ga0097620_100863216 3300006931 Bacteria 991
87 Ga0105240_10002071 3300009093 Bacteria 32871
88 Ga0105240_10002802 3300009093 Bacteria 27559
89 Ga0105240_10043775 3300009093 Bacteria 5693
90 Ga0105240_10321122 3300009093 Bacteria 1765
91 Ga0105240_10395756 3300009093 Bacteria 1557
92 Ga0105240_10493031 3300009093 Bacteria 1364
93 Ga0105240_10561206 3300009093 Unclassified 1262
94 Ga0105240_11211115 3300009093 Bacteria 799
95 Ga0105245_10267136 3300009098 Bacteria 1667
96 Ga0105245_10457542 3300009098 Unclassified 1286
97 Ga0105245_11142885 3300009098 Unclassified 826
98 Ga0105245_11933031 3300009098 Bacteria 643
99 Ga0105247_10401857 3300009101 Unclassified 976
100 Ga0105247_10617439 3300009101 Bacteria 806
101 Ga0114129_10081732 3300009147 Bacteria 4491
102 Ga0105243_10284876 3300009148 Unclassified 1490
103 Ga0105241_10328262 3300009174 Bacteria 1321
104 Ga0105242_10091477 3300009176 Bacteria 2561
105 Ga0105242_10143333 3300009176 Unclassified 2076
106 Ga0105242_10267792 3300009176 Bacteria 1546
107 Ga0105242_10348681 3300009176 Bacteria 1367
108 Ga0105248_10059879 3300009177 Bacteria 4277
109 Ga0105248_10065288 3300009177 Bacteria 4086
110 Ga0105248_10098850 3300009177 Unclassified 3288
111 Ga0105248_10301537 3300009177 Bacteria 1804
112 Ga0105248_10846021 3300009177 Bacteria 1033
113 Ga0105237_10001515 3300009545 Bacteria 30472
114 Ga0105237_10004874 3300009545 Bacteria 15372
115 Ga0105237_10083464 3300009545 Bacteria 3186
116 Ga0105237_11382436 3300009545 Bacteria 710
117 Ga0105237_11433259 3300009545 Unclassified 697
118 Ga0105237_11451262 3300009545 Bacteria 693
119 Ga0105238_10564663 3300009551 Bacteria 1143
120 Ga0105249_12749023 3300009553 Bacteria 564
121 Ga0105239_10071230 3300010375 Bacteria 3820
122 Ga0157373_10415230 3300013100 Bacteria 966
123 Ga0157371_10145201 3300013102 Bacteria 1690
124 Ga0157370_10001880 3300013104 Bacteria 25866
125 Ga0157370_10133194 3300013104 Bacteria 2318
126 Ga0157370_10151517 3300013104 Bacteria 2158
127 Ga0157369_10015381 3300013105 Bacteria 8627
128 Ga0157369_10038640 3300013105 Bacteria 5218
129 Ga0157369_10277799 3300013105 Unclassified 1744
130 Ga0157374_10259461 3300013296 Bacteria 1711
131 Ga0157374_10261405 3300013296 Bacteria 1705
132 Ga0157374_10646123 3300013296 Unclassified 1070
133 Ga0157378_10258043 3300013297 Bacteria 1671
134 Ga0157378_10451940 3300013297 Bacteria 1275
135 Ga0157378_10856048 3300013297 Bacteria 938
136 Ga0157378_11176237 3300013297 Bacteria 806
137 Ga0157378_11705069 3300013297 Bacteria 677
138 Ga0163162_10001773 3300013306 Bacteria 20228
139 Ga0163162_10151885 3300013306 Bacteria 2434
140 Ga0163162_10612878 3300013306 Bacteria 1214
141 Ga0157372_10093560 3300013307 Bacteria 3421
142 Ga0157372_10264633 3300013307 Bacteria 1997
143 Ga0157372_10389302 3300013307 Bacteria 1624
144 Ga0157372_10646239 3300013307 Bacteria 1232
145 Ga0157372_11031341 3300013307 Unclassified 952
146 Ga0157375_10036580 3300013308 Bacteria 4698
147 Ga0157375_10693098 3300013308 Bacteria 1173
148 Ga0157375_10818659 3300013308 Bacteria 1079
149 Ga0157375_10969010 3300013308 Bacteria 991
150 Ga0163163_10001078 3300014325 Bacteria 23143
151 Ga0163163_10035380 3300014325 Bacteria 4843
152 Ga0163163_10192523 3300014325 Bacteria 2087
153 Ga0163163_10987171 3300014325 Bacteria 905
154 Ga0157379_10120608 3300014968 Bacteria 2359
155 Ga0157376_10011872 3300014969 Bacteria 6440
156 Ga0157376_10108916 3300014969 Bacteria 2435
157 Ga0157376_10117279 3300014969 Bacteria 2353
158 Ga0157376_10600337 3300014969 Bacteria 1095
159 Ga0157376_11034202 3300014969 Unclassified 845
160 Ga0206354_11104002 3300020081 Bacteria 665
161 Ga0213876_10118975 3300021384 Bacteria 1402
162 Ga0213875_10060471 3300021388 Unclassified 1772
163 Ga0224712_10066810 3300022467 Bacteria 1449
164 Ga0207699_10690590 3300025906 Bacteria 747
165 Ga0207705_10024678 3300025909 Bacteria 4290
166 Ga0207705_10054225 3300025909 Unclassified 2890
167 Ga0207684_10129949 3300025910 Bacteria 2162
168 Ga0207654_10204102 3300025911 Bacteria 1303
169 Ga0207654_10249758 3300025911 Bacteria 1188
170 Ga0207707_10122787 3300025912 Bacteria 2271
171 Ga0207707_10175915 3300025912 Bacteria 1870
172 Ga0207707_11111767 3300025912 Bacteria 644
173 Ga0207695_10006792 3300025913 Bacteria 14748
174 Ga0207695_10019554 3300025913 Bacteria 7792
175 Ga0207695_10165161 3300025913 Bacteria 2143
176 Ga0207695_11246665 3300025913 Bacteria 624
177 Ga0207671_10047456 3300025914 Bacteria 3179
178 Ga0207671_10094114 3300025914 Bacteria 2261
179 Ga0207671_10406222 3300025914 Bacteria 1083
180 Ga0207663_10618204 3300025916 Bacteria 853
181 Ga0207660_10003279 3300025917 Bacteria 10581
182 Ga0207660_10033868 3300025917 Bacteria 3537
183 Ga0207660_10162786 3300025917 Bacteria 1723
184 Ga0207660_10319056 3300025917 Bacteria 1240
185 Ga0207652_10130092 3300025921 Bacteria 2245
186 Ga0207652_10168751 3300025921 Bacteria 1963
187 Ga0207681_10692485 3300025923 Unclassified 847
188 Ga0207681_10962198 3300025923 Unclassified 716
189 Ga0207694_10236316 3300025924 Bacteria 1493
190 Ga0207650_11336286 3300025925 Unclassified 610
191 Ga0207687_10486068 3300025927 Bacteria 1029
192 Ga0207700_10339484 3300025928 Bacteria 1306
193 Ga0207644_10020292 3300025931 Bacteria 4518
194 Ga0207644_10140018 3300025931 Bacteria 1862
195 Ga0207686_10085854 3300025934 Bacteria 2065
196 Ga0207686_10103188 3300025934 Bacteria 1908
197 Ga0207686_10111492 3300025934 Unclassified 1846
198 Ga0207686_10165910 3300025934 Unclassified 1553
199 Ga0207686_10524352 3300025934 Bacteria 922
200 Ga0207686_10656837 3300025934 Bacteria 830
201 Ga0207670_10043911 3300025936 Unclassified 2955
202 Ga0207670_10220306 3300025936 Bacteria 1452
203 Ga0207670_10453695 3300025936 Bacteria 1034
204 Ga0207670_10709770 3300025936 Bacteria 833
205 Ga0207665_10562416 3300025939 Bacteria 887
206 Ga0207711_10806533 3300025941 Bacteria 874
207 Ga0207661_10043214 3300025944 Unclassified 3556
208 Ga0207661_10280953 3300025944 Bacteria 1488
209 Ga0207679_10703969 3300025945 Unclassified 917
210 Ga0207667_10026967 3300025949 Bacteria 6266
211 Ga0207667_10112419 3300025949 Bacteria 2808
212 Ga0207667_10247421 3300025949 Bacteria 1824
213 Ga0207651_11444133 3300025960 Unclassified 619
214 Ga0207651_11577051 3300025960 Bacteria 591
215 Ga0207658_10389402 3300025986 Bacteria 1223
216 Ga0207677_10197888 3300026023 Bacteria 1595
217 Ga0207677_11290740 3300026023 Bacteria 670
218 Ga0207703_10286836 3300026035 Bacteria 1497
219 Ga0207703_10989995 3300026035 Bacteria 806
220 Ga0207678_11329696 3300026067 Bacteria 636
221 Ga0207702_10776282 3300026078 Bacteria 947
222 Ga0207702_10869258 3300026078 Bacteria 893
223 Ga0207641_10010108 3300026088 Bacteria 7760
224 Ga0207641_11953875 3300026088 Unclassified 588
225 Ga0207641_12394616 3300026088 Bacteria 527
226 Ga0207676_10290736 3300026095 Bacteria 1488
227 Ga0207676_11275829 3300026095 Unclassified 729
228 Ga0207676_11434442 3300026095 Bacteria 687
229 Ga0209813_10087946 3300027866 Bacteria 1038
230 Ga0268266_10041897 3300028379 Bacteria 3909
231 Ga0268266_10554983 3300028379 Bacteria 1101
232 Ga0265338_10250736 3300028800 Bacteria 1306
233 Ga0265338_10543002 3300028800 Bacteria 814
234 Ga0265325_10000976 3300031241 Bacteria 20534
235 Ga0265331_10044158 3300031250 Bacteria 2156
236 Ga0265316_10001334 3300031344 Bacteria 26542
237 Ga0265316_10003502 3300031344 Bacteria 15841
238 Ga0265316_10252188 3300031344 Bacteria 1295
239 Ga0265316_10291228 3300031344 Unclassified 1191
240 Ga0265314_10008320 3300031711 Bacteria 8898
241 Ga0307406_11300555 3300031901 Bacteria 634
242 Ga0373939_0300571 3300035114 Bacteria 640
243 Ga0373943_0540975 3300035170 Bacteria 683
244 Ga0373927_0576043 3300035695 Bacteria 744
245 Ga0373927_0971791 3300035695 Bacteria 560
246 Ga0373933_0258888 3300035724 Unclassified 1122
247 Ga0373933_0364662 3300035724 Bacteria 940
248 Ga0373947_0513337 3300035725 Bacteria 815
249 Ga0373937_0176841 3300036401 Bacteria 2004
250 Ga0373937_0523374 3300036401 Bacteria 1127
251 Ga0395900_0361032 3300037418 Bacteria 1424
252 Ga0395898_0124310 3300037466 Bacteria 2472
253 Ga0395898_0260974 3300037466 Unclassified 1653
254 Ga0395898_0327622 3300037466 Bacteria 1461
255 Ga0436364_0555491 3300037853 Bacteria 7298
256 Ga0436364_1075526 3300037853 Bacteria 1688
257 Ga0436365_0376737 3300039437 Bacteria 3675
258 Ga0436360_0772217 3300039438 Bacteria 1204
259 Ga0495653_0377377 3300046463 Bacteria 906
260 Ga0495580_0004034 3300046472 Bacteria 12390
261 Ga0495580_0328488 3300046472 Unclassified 1039
262 Ga0495580_0341626 3300046472 Bacteria 1015
263 Ga0495580_0822747 3300046472 Bacteria 601
264 Ga0495605_0294620 3300046474 Bacteria 687
265 Ga0495594_0303631 3300046499 Unclassified 909
266 Ga0495594_0700200 3300046499 Unclassified 573
267 Ga0495628_0307329 3300046516 Bacteria 1173
268 Ga0495628_0362052 3300046516 Bacteria 1065
269 Ga0495640_0166375 3300046533 Bacteria 1411
270 Ga0495640_0208066 3300046533 Bacteria 1238
271 Ga0495586_0129541 3300046535 Bacteria 1412
272 Ga0495587_0068305 3300046536 Bacteria 2070
273 Ga0495587_0534480 3300046536 Unclassified 647
274 Ga0495645_0178463 3300046543 Bacteria 1457
275 Ga0495667_0066767 3300046559 Bacteria 2351
276 Ga0495634_0212411 3300046642 Unclassified 1197
277 Ga0495634_0538022 3300046642 Bacteria 682
278 Ga0495635_0271246 3300046663 Bacteria 1141
279 Ga0495623_0371049 3300046679 Bacteria 776
280 Ga0495623_0595682 3300046679 Bacteria 575
281 Ga0495658_0574020 3300046683 Bacteria 722
282 Ga0495613_0282520 3300046689 Bacteria 1152
283 Ga0495581_0419969 3300047315 Unclassified 780
284 Ga0495636_0224059 3300047318 Bacteria 864
285 Ga0495674_0008686 3300047319 Bacteria 9662
286 Ga0495674_0043619 3300047319 Bacteria 3992
287 Ga0495674_0255536 3300047319 Bacteria 1441
288 Ga0495674_0339421 3300047319 Bacteria 1221
289 Ga0495676_0423581 3300047321 Unclassified 881
290 Ga0495680_0194219 3300047322 Bacteria 1459
291 Ga0495675_0062277 3300047444 Bacteria 2362
292 Ga0495684_0001300 3300047471 Bacteria 20056
293 Ga0495684_0038750 3300047471 Bacteria 3654
294 Ga0495684_0122575 3300047471 Bacteria 1957
295 Ga0495602_0140102 3300048088 Bacteria 1915
296 Ga0495602_0224606 3300048088 Bacteria 1415
297 Ga0496104_0084297 3300048907 Bacteria 3032
298 Ga0496104_1609257 3300048907 Unclassified 552
299 Ga0496105_0171343 3300048908 Bacteria 1779
300 Ga0496107_0207320 3300048910 Bacteria 1457
301 Ga0496114_0023417 3300048917 Bacteria 5039
302 Ga0496114_0426543 3300048917 Bacteria 1175
303 Ga0496115_0032715 3300048918 Bacteria 4103
304 Ga0501031_0001531 3300049568 Bacteria 14370
305 Ga0501031_0001871 3300049568 Bacteria 13238
306 Ga0501031_0071312 3300049568 Bacteria 2262
307 Ga0501032_0000144 3300049569 Bacteria 58016
308 Ga0501032_0008120 3300049569 Bacteria 7652
309 Ga0501032_0030206 3300049569 Bacteria 3717
310 Ga0501032_0522964 3300049569 Bacteria 757
311 Ga0501033_0000206 3300049570 Bacteria 56405
312 Ga0501033_0004699 3300049570 Bacteria 10929
313 Ga0501033_0175235 3300049570 Bacteria 1539
314 Ga0501033_0209744 3300049570 Bacteria 1389
315 Ga0501033_0778872 3300049570 Bacteria 647
316 Ga0501034_0000159 3300049571 Bacteria 127397
317 Ga0501034_0170521 3300049571 Bacteria 2143
318 Ga0501036_0001330 3300049572 Bacteria 18970
319 Ga0501036_0034291 3300049572 Bacteria 4293
320 Ga0501036_0040973 3300049572 Bacteria 3919
321 Ga0501036_0077067 3300049572 Bacteria 2821
322 Ga0501036_0146102 3300049572 Bacteria 1994
323 Ga0501037_0000396 3300049573 Bacteria 36209
324 Ga0501037_0001963 3300049573 Bacteria 14861
325 Ga0501037_0020949 3300049573 Bacteria 4829
326 Ga0501038_0000371 3300049574 Bacteria 38754
327 Ga0501038_0025663 3300049574 Bacteria 5249
328 Ga0501038_0111033 3300049574 Bacteria 2271
329 Ga0501038_0212240 3300049574 Bacteria 1548
330 Ga0501038_0429961 3300049574 Bacteria 1017
331 Ga0501039_0000926 3300049575 Bacteria 21446
332 Ga0501039_0064791 3300049575 Bacteria 2833
333 Ga0501039_0562540 3300049575 Bacteria 894
334 Ga0501040_0059579 3300049576 Bacteria 2623
335 Ga0501042_0341011 3300049578 Bacteria 1083
336 Ga0501043_0000202 3300049579 Bacteria 54441
337 Ga0501043_0003541 3300049579 Bacteria 12833
338 Ga0501043_0148241 3300049579 Bacteria 1836
339 Ga0501046_0000397 3300049580 Bacteria 43539
340 Ga0501046_0339200 3300049580 Bacteria 1092
341 Ga0501047_0000288 3300049581 Bacteria 57965
342 Ga0501047_0016457 3300049581 Bacteria 7060
343 Ga0501047_0165656 3300049581 Bacteria 2081
344 Ga0501047_0185810 3300049581 Bacteria 1943
345 Ga0501048_0000834 3300049582 Bacteria 22734
346 Ga0501048_0516615 3300049582 Bacteria 856
347 Ga0501067_0000333 3300049583 Bacteria 25656
348 Ga0501068_0000525 3300049584 Bacteria 19427
349 Ga0501068_0025605 3300049584 Bacteria 3470
350 Ga0501069_0001191 3300049585 Bacteria 12646
351 Ga0501069_0068166 3300049585 Bacteria 1991
352 Ga0501070_0007787 3300049586 Bacteria 9081
353 Ga0501070_0084523 3300049586 Bacteria 2627
354 Ga0501070_0091010 3300049586 Bacteria 2525
355 Ga0501071_0030655 3300049587 Bacteria 3805
356 Ga0501073_0000034 3300049589 Bacteria 95224
357 Ga0501073_0026495 3300049589 Bacteria 4153
358 Ga0501073_0119702 3300049589 Bacteria 1825
359 Ga0501074_0000395 3300049590 Bacteria 25957
360 Ga0501074_0053321 3300049590 Bacteria 2917
361 Ga0501077_0616740 3300049593 Bacteria 697
362 Ga0501079_0003579 3300049741 Bacteria 11425
363 Ga0501080_0000846 3300049742 Bacteria 25014
364 Ga0501080_0199637 3300049742 Bacteria 1836
365 Ga0501081_0269861 3300049743 Bacteria 1244
366 Ga0501083_0001286 3300049744 Bacteria 16988
367 Ga0501083_0048522 3300049744 Bacteria 2865
368 Ga0501035_0000137 3300049822 Bacteria 89273
369 Ga0501035_0005448 3300049822 Bacteria 12037
370 Ga0501035_0120536 3300049822 Bacteria 2293
371 Ga0501035_0207768 3300049822 Bacteria 1676
372 Ga0501044_0000431 3300049823 Bacteria 51668
373 Ga0501044_0003281 3300049823 Bacteria 18216
374 Ga0501044_0031295 3300049823 Bacteria 5601
375 Ga0501044_0066314 3300049823 Bacteria 3681
376 Ga0501044_0349003 3300049823 Bacteria 1399
377 Ga0501045_0004376 3300049824 Bacteria 9739
378 Ga0501045_0007978 3300049824 Bacteria 7375
379 nmdc:mga03n38_117099_c1 3300050490 Bacteria 1305
380 nmdc:mga0yw44_133750_c1 3300050492 Bacteria 1607
381 nmdc:mga0k408_192733_c1 3300050493 Bacteria 1216
382 nmdc:mga06z11_185785_c1 3300050494 Bacteria 1201
383 nmdc:mga06z11_46101_c1 3300050494 Bacteria 2207
384 nmdc:mga04h51_114291_c1 3300050495 Bacteria 999
385 nmdc:mga07m45_10203_c1 3300050496 Bacteria 4367
386 nmdc:mga06r32_24135_c1 3300050510 Bacteria 5639
387 Ga0495601_0339637 3300053077 Unclassified 977
388 Ga0500568_0024772 3300053139 Bacteria 2538
389 Ga0501084_0019419 3300054114 Bacteria 5662
390 Ga0501084_0333403 3300054114 Bacteria 1281
391 Ga0501082_0002663 3300060353 Bacteria 15606
392 Ga0501082_0005081 3300060353 Bacteria 11462
393 Ga0501082_0593034 3300060353 Bacteria 969
394 Ga0058859_11716650
395 Ga0058860_11471490
396 Ga0070658_10063675
397 Ga0070683_100060651
398 Ga0070683_100084012
399 Ga0070690_100216943
400 Ga0070680_100000779
401 Ga0070680_100100861
402 Ga0070680_100107575
403 Ga0070680_100501769
404 Ga0070682_100583339
405 Ga0070682_100806573
406 Ga0068868_101468049
407 Ga0070660_100666867
408 Ga0070689_100086758
409 Ga0070689_100179532
410 Ga0070689_100249918
411 Ga0070689_100882967
412 Ga0070691_10495949
413 Ga0070671_100044041
414 Ga0070671_100064562
415 Ga0070673_101220600
416 Ga0070688_100034989
417 Ga0070688_100390681
418 Ga0070659_101591055
419 Ga0070709_10446866
420 Ga0070714_100270982
421 Ga0070713_100938194
422 Ga0070711_100658256
423 Ga0070708_100190080
424 Ga0070663_100301217
425 Ga0070681_10030452
426 Ga0070681_10175103
427 Ga0070681_10175810
428 Ga0070681_10931986
429 Ga0068867_100332478
430 Ga0068867_101148471
431 Ga0070685_10668140
432 Ga0070685_11216958
433 Ga0070679_100060672
434 Ga0070679_100232634
435 Ga0070679_100454793
436 Ga0070679_100608475
437 Ga0070684_100218213
438 Ga0070684_100268201
439 Ga0070665_100027303
440 Ga0070665_100519045
441 Ga0068855_100037950
442 Ga0068855_100304785
443 Ga0068855_100453717
444 Ga0070664_100741974
445 Ga0070664_101019284
446 Ga0070664_101676507
447 Ga0068856_100819676
448 Ga0068856_101245713
449 Ga0068859_100138008
450 Ga0068859_100863162
451 Ga0068864_100588189
452 Ga0068851_10054266
453 Ga0068863_100013414
454 Ga0068863_100320238
455 Ga0068858_100173183
456 Ga0068858_100742961
457 Ga0075365_10222768
458 Ga0075363_100032952
459 Ga0070715_10758681
460 Ga0075367_10009863
461 Ga0075367_10038891
462 Ga0097621_100109727
463 Ga0097621_100202990
464 Ga0097621_100736366
465 Ga0097621_100871999
466 Ga0097621_101115804
467 Ga0075370_10016300
468 Ga0068871_100085833
469 Ga0068871_100196206
470 Ga0068871_100484234
471 Ga0068871_100775155
472 Ga0068871_100802564
473 Ga0068871_100934864
474 Ga0068871_101213044
475 Ga0068871_101440093
476 Ga0075430_100838648
477 Ga0075431_100011755
478 Ga0097620_100138010
479 Ga0097620_100863216
480 Ga0105240_10002071
481 Ga0105240_10002802
482 Ga0105240_10043775
483 Ga0105240_10321122
484 Ga0105240_10395756
485 Ga0105240_10493031
486 Ga0105240_10561206
487 Ga0105240_11211115
488 Ga0105245_10267136
489 Ga0105245_10457542
490 Ga0105245_11142885
491 Ga0105245_11933031
492 Ga0105247_10401857
493 Ga0105247_10617439
494 Ga0114129_10081732
495 Ga0105243_10284876
496 Ga0105241_10328262
497 Ga0105242_10091477
498 Ga0105242_10143333
499 Ga0105242_10267792
500 Ga0105242_10348681
501 Ga0105248_10059879
502 Ga0105248_10065288
503 Ga0105248_10098850
504 Ga0105248_10301537
505 Ga0105248_10846021
506 Ga0105237_10001515
507 Ga0105237_10004874
508 Ga0105237_10083464
509 Ga0105237_11382436
510 Ga0105237_11433259
511 Ga0105237_11451262
512 Ga0105238_10564663
513 Ga0105249_12749023
514 Ga0105239_10071230
515 Ga0157373_10415230
516 Ga0157371_10145201
517 Ga0157370_10001880
518 Ga0157370_10133194
519 Ga0157370_10151517
520 Ga0157369_10015381
521 Ga0157369_10038640
522 Ga0157369_10277799
523 Ga0157374_10259461
524 Ga0157374_10261405
525 Ga0157374_10646123
526 Ga0157378_10258043
527 Ga0157378_10451940
528 Ga0157378_10856048
529 Ga0157378_11176237
530 Ga0157378_11705069
531 Ga0163162_10001773
532 Ga0163162_10151885
533 Ga0163162_10612878
534 Ga0157372_10093560
535 Ga0157372_10264633
536 Ga0157372_10389302
537 Ga0157372_10646239
538 Ga0157372_11031341
539 Ga0157375_10036580
540 Ga0157375_10693098
541 Ga0157375_10818659
542 Ga0157375_10969010
543 Ga0163163_10001078
544 Ga0163163_10035380
545 Ga0163163_10192523
546 Ga0163163_10987171
547 Ga0157379_10120608
548 Ga0157376_10011872
549 Ga0157376_10108916
550 Ga0157376_10117279
551 Ga0157376_10600337
552 Ga0157376_11034202
553 Ga0206354_11104002
554 Ga0213876_10118975
555 Ga0213875_10060471
556 Ga0224712_10066810
557 Ga0207699_10690590
558 Ga0207705_10024678
559 Ga0207705_10054225
560 Ga0207684_10129949
561 Ga0207654_10204102
562 Ga0207654_10249758
563 Ga0207707_10122787
564 Ga0207707_10175915
565 Ga0207707_11111767
566 Ga0207695_10006792
567 Ga0207695_10019554
568 Ga0207695_10165161
569 Ga0207695_11246665
570 Ga0207671_10047456
571 Ga0207671_10094114
572 Ga0207671_10406222
573 Ga0207663_10618204
574 Ga0207660_10003279
575 Ga0207660_10033868
576 Ga0207660_10162786
577 Ga0207660_10319056
578 Ga0207652_10130092
579 Ga0207652_10168751
580 Ga0207681_10692485
581 Ga0207681_10962198
582 Ga0207694_10236316
583 Ga0207650_11336286
584 Ga0207687_10486068
585 Ga0207700_10339484
586 Ga0207644_10020292
587 Ga0207644_10140018
588 Ga0207686_10085854
589 Ga0207686_10103188
590 Ga0207686_10111492
591 Ga0207686_10165910
592 Ga0207686_10524352
593 Ga0207686_10656837
594 Ga0207670_10043911
595 Ga0207670_10220306
596 Ga0207670_10453695
597 Ga0207670_10709770
598 Ga0207665_10562416
599 Ga0207711_10806533
600 Ga0207661_10043214
601 Ga0207661_10280953
602 Ga0207679_10703969
603 Ga0207667_10026967
604 Ga0207667_10112419
605 Ga0207667_10247421
606 Ga0207651_11444133
607 Ga0207651_11577051
608 Ga0207658_10389402
609 Ga0207677_10197888
610 Ga0207677_11290740
611 Ga0207703_10286836
612 Ga0207703_10989995
613 Ga0207678_11329696
614 Ga0207702_10776282
615 Ga0207702_10869258
616 Ga0207641_10010108
617 Ga0207641_11953875
618 Ga0207641_12394616
619 Ga0207676_10290736
620 Ga0207676_11275829
621 Ga0207676_11434442
622 Ga0209813_10087946
623 Ga0268266_10041897
624 Ga0268266_10554983
625 Ga0265338_10250736
626 Ga0265338_10543002
627 Ga0265325_10000976
628 Ga0265331_10044158
629 Ga0265316_10001334
630 Ga0265316_10003502
631 Ga0265316_10252188
632 Ga0265316_10291228
633 Ga0265314_10008320
634 Ga0307406_11300555
635 Ga0373939_0300571
636 Ga0373943_0540975
637 Ga0373927_0576043
638 Ga0373927_0971791
639 Ga0373933_0258888
640 Ga0373933_0364662
641 Ga0373947_0513337
642 Ga0373937_0176841
643 Ga0373937_0523374
644 Ga0395900_0361032
645 Ga0395898_0124310
646 Ga0395898_0260974
647 Ga0395898_0327622
648 Ga0436364_0555491
649 Ga0436364_1075526
650 Ga0436365_0376737
651 Ga0436360_0772217
652 Ga0495653_0377377
653 Ga0495580_0004034
654 Ga0495580_0328488
655 Ga0495580_0341626
656 Ga0495580_0822747
657 Ga0495605_0294620
658 Ga0495594_0303631
659 Ga0495594_0700200
660 Ga0495628_0307329
661 Ga0495628_0362052
662 Ga0495640_0166375
663 Ga0495640_0208066
664 Ga0495586_0129541
665 Ga0495587_0068305
666 Ga0495587_0534480
667 Ga0495645_0178463
668 Ga0495667_0066767
669 Ga0495634_0212411
670 Ga0495634_0538022
671 Ga0495635_0271246
672 Ga0495623_0371049
673 Ga0495623_0595682
674 Ga0495658_0574020
675 Ga0495613_0282520
676 Ga0495581_0419969
677 Ga0495636_0224059
678 Ga0495674_0008686
679 Ga0495674_0043619
680 Ga0495674_0255536
681 Ga0495674_0339421
682 Ga0495676_0423581
683 Ga0495680_0194219
684 Ga0495675_0062277
685 Ga0495684_0001300
686 Ga0495684_0038750
687 Ga0495684_0122575
688 Ga0495602_0140102
689 Ga0495602_0224606
690 Ga0496104_0084297
691 Ga0496104_1609257
692 Ga0496105_0171343
693 Ga0496107_0207320
694 Ga0496114_0023417
695 Ga0496114_0426543
696 Ga0496115_0032715
697 Ga0501031_0001531
698 Ga0501031_0001871
699 Ga0501031_0071312
700 Ga0501032_0000144
701 Ga0501032_0008120
702 Ga0501032_0030206
703 Ga0501032_0522964
704 Ga0501033_0000206
705 Ga0501033_0004699
706 Ga0501033_0175235
707 Ga0501033_0209744
708 Ga0501033_0778872
709 Ga0501034_0000159
710 Ga0501034_0170521
711 Ga0501036_0001330
712 Ga0501036_0034291
713 Ga0501036_0040973
714 Ga0501036_0077067
715 Ga0501036_0146102
716 Ga0501037_0000396
717 Ga0501037_0001963
718 Ga0501037_0020949
719 Ga0501038_0000371
720 Ga0501038_0025663
721 Ga0501038_0111033
722 Ga0501038_0212240
723 Ga0501038_0429961
724 Ga0501039_0000926
725 Ga0501039_0064791
726 Ga0501039_0562540
727 Ga0501040_0059579
728 Ga0501042_0341011
729 Ga0501043_0000202
730 Ga0501043_0003541
731 Ga0501043_0148241
732 Ga0501046_0000397
733 Ga0501046_0339200
734 Ga0501047_0000288
735 Ga0501047_0016457
736 Ga0501047_0165656
737 Ga0501047_0185810
738 Ga0501048_0000834
739 Ga0501048_0516615
740 Ga0501067_0000333
741 Ga0501068_0000525
742 Ga0501068_0025605
743 Ga0501069_0001191
744 Ga0501069_0068166
745 Ga0501070_0007787
746 Ga0501070_0084523
747 Ga0501070_0091010
748 Ga0501071_0030655
749 Ga0501073_0000034
750 Ga0501073_0026495
751 Ga0501073_0119702
752 Ga0501074_0000395
753 Ga0501074_0053321
754 Ga0501077_0616740
755 Ga0501079_0003579
756 Ga0501080_0000846
757 Ga0501080_0199637
758 Ga0501081_0269861
759 Ga0501083_0001286
760 Ga0501083_0048522
761 Ga0501035_0000137
762 Ga0501035_0005448
763 Ga0501035_0120536
764 Ga0501035_0207768
765 Ga0501044_0000431
766 Ga0501044_0003281
767 Ga0501044_0031295
768 Ga0501044_0066314
769 Ga0501044_0349003
770 Ga0501045_0004376
771 Ga0501045_0007978
772 nmdc:mga03n38_117099_c1
773 nmdc:mga0yw44_133750_c1
774 nmdc:mga0k408_192733_c1
775 nmdc:mga06z11_185785_c1
776 nmdc:mga06z11_46101_c1
777 nmdc:mga04h51_114291_c1
778 nmdc:mga07m45_10203_c1
779 nmdc:mga06r32_24135_c1
780 Ga0495601_0339637
781 Ga0500568_0024772
782 Ga0501084_0019419
783 Ga0501084_0333403
784 Ga0501082_0002663
785 Ga0501082_0005081
786 Ga0501082_0593034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

8

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4am2-assembly1.cif.gz_A bacterioferritin from blastochloris viridis 0.9913 1 158
3bkn-assembly1.cif.gz_A the structure of mycobacterial bacterioferritin 0.9852 1 155
3gvy-assembly1.cif.gz_B crystal structure of bacterioferritin from r.sphaeroides 0.9839 1 158
5zur-assembly1.cif.gz_B achromobacter dh1f bacterioferritin 0.9837 1 155
3gvy-assembly1.cif.gz_C crystal structure of bacterioferritin from r.sphaeroides 0.9831 1 158
ID Description Score Start End Superfamily
4am2B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9913 1 158 1.20.1260.10
5xx9B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9896 1 157 1.20.1260.10
3e2cA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9878 1 154 1.20.1260.10
3gvyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9851 1 156 1.20.1260.10
5zurA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9844 1 153 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A258LLL3-F1-model_v4 Bacterioferritin 0.9979 1 133 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A258DYD7-F1-model_v4 Bacterioferritin 0.9971 1 118 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A167GY78-F1-model_v4 deleted 0.9969 1 139
AF-A0A1M3AFY0-F1-model_v4 deleted 0.9952 1 140
AF-A0A3C2DH40-F1-model_v4 Bacterioferritin 0.9936 1 133 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037

Map