F432443

General Info

Members Datasets Scaffolds Average Seq Length
392 279 390 140

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0003285|Ga0500641_0003285_542_1024
Length 160
Sequence MADGRRPTNRIHSIRSQETDMRFMMLMIPKGYENAAPGTMPDAKAVEAMMAYNTSLQQAGVLLALDGLHPPSMGARVSFEGGKPKVTDGPFAEAKEIVGGYWMIQVKSREEAIEWASRCPGSGNEVIEVRQVQEIAEFPADVQAAAAGFVEMQKTTGHTS

Samples

Sample ID Description Type Environment
1 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
2 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
278 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.26
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0
Rhizoplane 7.14
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1042978 3300001977 Bacteria 630
2 JGI24738J21930_10023665 3300002075 Bacteria 1264
3 JGI24751J29686_10029448 3300002459 Bacteria 1140
4 JGI25165J46597_1042313 3300003214 Bacteria 584
5 Ga0065715_10384517 3300005293 Bacteria 888
6 Ga0070658_10126911 3300005327 Bacteria 2124
7 Ga0070676_10011459 3300005328 Bacteria 4821
8 Ga0070676_10151766 3300005328 Bacteria 1484
9 Ga0070683_100175726 3300005329 Bacteria 2033
10 Ga0070690_100000828 3300005330 Bacteria 15680
11 Ga0070690_100003208 3300005330 Bacteria 8917
12 Ga0070690_100342641 3300005330 Bacteria 1083
13 Ga0070670_100009649 3300005331 Bacteria 8238
14 Ga0070670_101520238 3300005331 Bacteria 615
15 Ga0070677_10021235 3300005333 Bacteria 2380
16 Ga0068869_100043947 3300005334 Bacteria 3211
17 Ga0068869_100058766 3300005334 Bacteria 2813
18 Ga0070666_10003149 3300005335 Bacteria 10017
19 Ga0070680_100011329 3300005336 Bacteria 6896
20 Ga0070682_100007406 3300005337 Bacteria 6192
21 Ga0068868_100077813 3300005338 Bacteria 2654
22 Ga0070689_100002488 3300005340 Bacteria 12048
23 Ga0070689_100012584 3300005340 Bacteria 6102
24 Ga0070691_10000310 3300005341 Bacteria 17151
25 Ga0070687_100331583 3300005343 Bacteria 976
26 Ga0070687_100377090 3300005343 Bacteria 923
27 Ga0070661_100001241 3300005344 Bacteria 17916
28 Ga0070692_10000736 3300005345 Bacteria 10640
29 Ga0070668_100000234 3300005347 Bacteria 36207
30 Ga0070669_100203262 3300005353 Bacteria 1560
31 Ga0070675_100002384 3300005354 Bacteria 13994
32 Ga0070675_100009972 3300005354 Bacteria 7409
33 Ga0070675_101027452 3300005354 Bacteria 757
34 Ga0070671_100004504 3300005355 Bacteria 11031
35 Ga0070671_100025325 3300005355 Bacteria 4867
36 Ga0070674_100001018 3300005356 Bacteria 14617
37 Ga0070674_100309948 3300005356 Bacteria 1261
38 Ga0070673_100000403 3300005364 Bacteria 22935
39 Ga0070673_100007250 3300005364 Bacteria 7297
40 Ga0070688_100009268 3300005365 Bacteria 5374
41 Ga0070659_100024047 3300005366 Bacteria 4668
42 Ga0070659_100432034 3300005366 Bacteria 1115
43 Ga0070667_100003240 3300005367 Bacteria 13920
44 Ga0070667_100104221 3300005367 Bacteria 2453
45 Ga0070709_10011069 3300005434 Bacteria 5016
46 Ga0070714_100022290 3300005435 Bacteria 5193
47 Ga0070713_100063928 3300005436 Bacteria 3087
48 Ga0070713_100550927 3300005436 Bacteria 1092
49 Ga0070710_10008768 3300005437 Bacteria 4932
50 Ga0070701_10058240 3300005438 Bacteria 2027
51 Ga0070711_100010291 3300005439 Bacteria 5785
52 Ga0070705_100001109 3300005440 Bacteria 14913
53 Ga0070700_100000966 3300005441 Bacteria 14202
54 Ga0070694_100006898 3300005444 Bacteria 6901
55 Ga0070663_100163610 3300005455 Bacteria 1714
56 Ga0070678_100042334 3300005456 Bacteria 3236
57 Ga0070662_100828174 3300005457 Bacteria 787
58 Ga0070681_10020522 3300005458 Bacteria 6622
59 Ga0070681_10077911 3300005458 Bacteria 3271
60 Ga0068867_100503295 3300005459 Bacteria 1041
61 Ga0070685_10024005 3300005466 Bacteria 3345
62 Ga0070685_10100485 3300005466 Bacteria 1766
63 Ga0070679_100001877 3300005530 Bacteria 18910
64 Ga0070679_100233313 3300005530 Bacteria 1799
65 Ga0070679_100257295 3300005530 Bacteria 1701
66 Ga0070679_100622933 3300005530 Bacteria 1022
67 Ga0070684_100342168 3300005535 Bacteria 1375
68 Ga0070684_100391570 3300005535 Bacteria 1281
69 Ga0070697_100014153 3300005536 Bacteria 6266
70 Ga0068853_100002553 3300005539 Bacteria 13675
71 Ga0068853_100613020 3300005539 Bacteria 1034
72 Ga0070672_100006711 3300005543 Bacteria 7760
73 Ga0070672_100214399 3300005543 Bacteria 1613
74 Ga0070686_100001906 3300005544 Bacteria 11609
75 Ga0070695_100001397 3300005545 Bacteria 13379
76 Ga0070695_100049326 3300005545 Bacteria 2696
77 Ga0070696_100002930 3300005546 Bacteria 11340
78 Ga0070665_100010067 3300005548 Bacteria 9570
79 Ga0070704_100001520 3300005549 Bacteria 12505
80 Ga0068855_100003598 3300005563 Bacteria 18933
81 Ga0068855_100006487 3300005563 Bacteria 14229
82 Ga0068855_100303815 3300005563 Bacteria 1767
83 Ga0070664_100002217 3300005564 Bacteria 15619
84 Ga0068857_100193128 3300005577 Bacteria 1854
85 Ga0068854_100006266 3300005578 Bacteria 7559
86 Ga0068856_100007771 3300005614 Bacteria 10474
87 Ga0068856_100258744 3300005614 Bacteria 1756
88 Ga0070702_100001629 3300005615 Bacteria 9294
89 Ga0068852_100036803 3300005616 Bacteria 4099
90 Ga0068852_100120530 3300005616 Bacteria 2400
91 Ga0068859_100015690 3300005617 Bacteria 7612
92 Ga0068859_100939207 3300005617 Bacteria 949
93 Ga0068864_100005692 3300005618 Bacteria 10216
94 Ga0068864_100006229 3300005618 Bacteria 9784
95 Ga0068861_100001266 3300005719 Bacteria 15769
96 Ga0068870_10247951 3300005840 Bacteria 1103
97 Ga0068863_100001254 3300005841 Bacteria 25284
98 Ga0068858_100005485 3300005842 Bacteria 12419
99 Ga0068858_100006919 3300005842 Bacteria 11021
100 Ga0068860_100011677 3300005843 Bacteria 8659
101 Ga0068860_100186032 3300005843 Bacteria 2009
102 Ga0075364_10698491 3300006051 Bacteria 692
103 Ga0070715_10003841 3300006163 Bacteria 4848
104 Ga0070716_100002741 3300006173 Bacteria 8175
105 Ga0070712_100016557 3300006175 Bacteria 4762
106 Ga0075367_10344652 3300006178 Bacteria 940
107 Ga0097621_100076934 3300006237 Bacteria 2769
108 Ga0097621_100731957 3300006237 Bacteria 912
109 Ga0075428_100018307 3300006844 Bacteria 7743
110 Ga0075430_100074137 3300006846 Bacteria 2853
111 Ga0075430_100078215 3300006846 Bacteria 2773
112 Ga0075431_100403697 3300006847 Bacteria 1367
113 Ga0075429_100019110 3300006880 Bacteria 5935
114 Ga0075429_100241956 3300006880 Bacteria 1581
115 Ga0068865_100107443 3300006881 Bacteria 2052
116 Ga0097620_100015690 3300006931 Bacteria 7612
117 Ga0097620_100939178 3300006931 Bacteria 949
118 Ga0099794_10232377 3300007265 Bacteria 949
119 Ga0105250_10308492 3300009092 Bacteria 686
120 Ga0105240_10004115 3300009093 Bacteria 22328
121 Ga0105240_10014853 3300009093 Bacteria 10615
122 Ga0105240_10051181 3300009093 Bacteria 5200
123 Ga0105240_10220554 3300009093 Bacteria 2210
124 Ga0111539_10516037 3300009094 Bacteria 1392
125 Ga0111539_10852069 3300009094 Bacteria 1060
126 Ga0105245_10004081 3300009098 Bacteria 12962
127 Ga0105245_10677907 3300009098 Bacteria 1063
128 Ga0114129_10056554 3300009147 Bacteria 5494
129 Ga0114129_10320688 3300009147 Bacteria 2060
130 Ga0105243_10005218 3300009148 Bacteria 10164
131 Ga0105241_10001143 3300009174 Bacteria 20210
132 Ga0105241_10291522 3300009174 Bacteria 1397
133 Ga0105248_10002357 3300009177 Bacteria 20976
134 Ga0105237_10013591 3300009545 Bacteria 8530
135 Ga0105237_10013913 3300009545 Bacteria 8420
136 Ga0105237_10139454 3300009545 Bacteria 2419
137 Ga0105238_10001355 3300009551 Bacteria 24579
138 Ga0105238_10324779 3300009551 Bacteria 1525
139 Ga0105238_10714401 3300009551 Bacteria 1015
140 Ga0105238_11676367 3300009551 Bacteria 666
141 Ga0105249_10004381 3300009553 Bacteria 12209
142 Ga0105249_12186102 3300009553 Bacteria 626
143 Ga0099796_10035473 3300010159 Bacteria 1655
144 Ga0105239_10888805 3300010375 Bacteria 1022
145 Ga0157373_11231908 3300013100 Bacteria 565
146 Ga0157371_10013293 3300013102 Bacteria 6260
147 Ga0157370_10000298 3300013104 Bacteria 62940
148 Ga0157370_10419884 3300013104 Bacteria 1230
149 Ga0157369_10007117 3300013105 Bacteria 12901
150 Ga0157369_10014687 3300013105 Bacteria 8836
151 Ga0157369_10105199 3300013105 Bacteria 3005
152 Ga0157374_10856391 3300013296 Bacteria 926
153 Ga0157374_11837372 3300013296 Bacteria 631
154 Ga0157378_10023886 3300013297 Bacteria 5377
155 Ga0163162_10014240 3300013306 Bacteria 7769
156 Ga0163162_10851620 3300013306 Bacteria 1027
157 Ga0157372_10004863 3300013307 Bacteria 14274
158 Ga0157372_10286603 3300013307 Bacteria 1915
159 Ga0157375_10262727 3300013308 Bacteria 1888
160 Ga0157375_10296228 3300013308 Bacteria 1781
161 Ga0163163_10006733 3300014325 Bacteria 10069
162 Ga0163163_10007543 3300014325 Bacteria 9605
163 Ga0182008_10102803 3300014497 Bacteria 1413
164 Ga0157377_10011806 3300014745 Bacteria 4371
165 Ga0157377_10318284 3300014745 Bacteria 1033
166 Ga0157379_10035601 3300014968 Bacteria 4439
167 Ga0157379_10221628 3300014968 Bacteria 1714
168 Ga0157379_10273063 3300014968 Bacteria 1538
169 Ga0157379_11899748 3300014968 Bacteria 587
170 Ga0157376_10001343 3300014969 Bacteria 16214
171 Ga0157376_10003346 3300014969 Bacteria 11026
172 Ga0157376_10112123 3300014969 Bacteria 2402
173 Ga0163161_10002609 3300017792 Bacteria 12840
174 Ga0163161_10482983 3300017792 Bacteria 1006
175 Ga0224712_10569934 3300022467 Bacteria 551
176 Ga0209233_1003344 3300025261 Bacteria 5672
177 Ga0207673_1006726 3300025290 Bacteria 1428
178 Ga0207692_10775329 3300025898 Bacteria 626
179 Ga0207688_10002165 3300025901 Bacteria 10566
180 Ga0207680_10651060 3300025903 Bacteria 754
181 Ga0207647_10002823 3300025904 Bacteria 13108
182 Ga0207699_10011678 3300025906 Bacteria 4445
183 Ga0207645_10011062 3300025907 Bacteria 6174
184 Ga0207654_10357521 3300025911 Bacteria 1007
185 Ga0207707_10000470 3300025912 Bacteria 41691
186 Ga0207707_10006510 3300025912 Bacteria 10199
187 Ga0207695_10001758 3300025913 Bacteria 34365
188 Ga0207695_10216094 3300025913 Bacteria 1826
189 Ga0207695_10240779 3300025913 Bacteria 1710
190 Ga0207695_10332890 3300025913 Bacteria 1407
191 Ga0207671_10009117 3300025914 Bacteria 8334
192 Ga0207693_10002297 3300025915 Bacteria 16613
193 Ga0207663_10000540 3300025916 Bacteria 16619
194 Ga0207660_10003113 3300025917 Bacteria 10849
195 Ga0207662_10350645 3300025918 Bacteria 991
196 Ga0207657_10000793 3300025919 Bacteria 33507
197 Ga0207649_10234455 3300025920 Bacteria 1314
198 Ga0207652_10000795 3300025921 Bacteria 30149
199 Ga0207652_10059616 3300025921 Bacteria 3290
200 Ga0207652_10152593 3300025921 Bacteria 2069
201 Ga0207681_10042900 3300025923 Bacteria 3024
202 Ga0207659_10004929 3300025926 Bacteria 8088
203 Ga0207659_10037091 3300025926 Bacteria 3382
204 Ga0207659_10790317 3300025926 Bacteria 815
205 Ga0207659_10908401 3300025926 Bacteria 757
206 Ga0207687_10283531 3300025927 Bacteria 1329
207 Ga0207700_10094858 3300025928 Bacteria 2365
208 Ga0207700_10338597 3300025928 Bacteria 1307
209 Ga0207644_10030866 3300025931 Bacteria 3730
210 Ga0207644_10487582 3300025931 Bacteria 1016
211 Ga0207690_10004925 3300025932 Bacteria 7878
212 Ga0207690_11401937 3300025932 Bacteria 584
213 Ga0207706_10000771 3300025933 Bacteria 33246
214 Ga0207706_10859336 3300025933 Bacteria 768
215 Ga0207686_10022152 3300025934 Bacteria 3656
216 Ga0207709_10290244 3300025935 Bacteria 1212
217 Ga0207670_10023798 3300025936 Bacteria 3817
218 Ga0207669_10240558 3300025937 Bacteria 1341
219 Ga0207704_10129485 3300025938 Bacteria 1744
220 Ga0207665_10006767 3300025939 Bacteria 7594
221 Ga0207691_10013656 3300025940 Bacteria 7760
222 Ga0207691_10089984 3300025940 Bacteria 2752
223 Ga0207711_10066762 3300025941 Bacteria 3111
224 Ga0207689_10030996 3300025942 Bacteria 4455
225 Ga0207689_10159023 3300025942 Bacteria 1862
226 Ga0207679_10039243 3300025945 Bacteria 3380
227 Ga0207679_10175159 3300025945 Bacteria 1770
228 Ga0207679_11045919 3300025945 Bacteria 749
229 Ga0207667_10006758 3300025949 Bacteria 13848
230 Ga0207667_10178435 3300025949 Bacteria 2181
231 Ga0207651_10002140 3300025960 Bacteria 9340
232 Ga0207651_10014546 3300025960 Bacteria 4548
233 Ga0207712_10012704 3300025961 Bacteria 5381
234 Ga0207668_10109742 3300025972 Bacteria 2067
235 Ga0207640_10317299 3300025981 Bacteria 1239
236 Ga0207658_10019372 3300025986 Bacteria 4706
237 Ga0207677_10007544 3300026023 Bacteria 6031
238 Ga0207677_10116548 3300026023 Bacteria 2000
239 Ga0207703_10009675 3300026035 Bacteria 7566
240 Ga0207703_10050351 3300026035 Bacteria 3371
241 Ga0207639_10124939 3300026041 Bacteria 2120
242 Ga0207678_10001022 3300026067 Bacteria 25519
243 Ga0207678_11226350 3300026067 Bacteria 664
244 Ga0207708_10008196 3300026075 Bacteria 7742
245 Ga0207702_10010968 3300026078 Bacteria 7560
246 Ga0207702_10346541 3300026078 Bacteria 1420
247 Ga0207641_10009356 3300026088 Bacteria 8082
248 Ga0207648_10560526 3300026089 Bacteria 1050
249 Ga0207676_10005096 3300026095 Bacteria 9300
250 Ga0207676_10184361 3300026095 Bacteria 1830
251 Ga0207674_10004073 3300026116 Bacteria 17710
252 Ga0207675_100000706 3300026118 Bacteria 33090
253 Ga0207683_10005141 3300026121 Bacteria 11234
254 Ga0207683_10033494 3300026121 Bacteria 4462
255 Ga0207683_11319486 3300026121 Bacteria 668
256 Ga0207698_10130885 3300026142 Bacteria 2144
257 Ga0207428_10052400 3300027907 Bacteria 3259
258 Ga0268266_10137454 3300028379 Bacteria 2190
259 Ga0268265_11619796 3300028380 Bacteria 652
260 Ga0268264_11169520 3300028381 Bacteria 778
261 Ga0307515_10000028 3300028794 Bacteria 368467
262 Ga0307513_10083109 3300031456 Bacteria 3294
263 Ga0307408_100178704 3300031548 Bacteria 1700
264 Ga0307416_100554332 3300032002 Bacteria 1223
265 Ga0307411_12333034 3300032005 Bacteria 503
266 Ga0307415_100151202 3300032126 Bacteria 1787
267 Ga0307507_10035394 3300033179 Bacteria 5131
268 Ga0373950_0031733 3300034818 Bacteria 981
269 Ga0373928_0009529 3300035084 Bacteria 1897
270 Ga0373949_0020588 3300035090 Bacteria 1511
271 Ga0373949_0153115 3300035090 Bacteria 668
272 Ga0373952_0088765 3300035092 Bacteria 800
273 Ga0373932_0160774 3300035112 Bacteria 777
274 Ga0373939_0306191 3300035114 Bacteria 635
275 Ga0373941_0120594 3300035115 Bacteria 934
276 Ga0373961_0033944 3300035241 Bacteria 1440
277 Ga0373961_0177659 3300035241 Bacteria 740
278 Ga0373931_0002027 3300035691 Bacteria 8918
279 Ga0395905_1360146 3300037471 Bacteria 614
280 Ga0436365_0614938 3300039437 Bacteria 4152
281 Ga0439439_0262283 3300041406 Bacteria 514
282 Ga0451804_0905642 3300041463 Bacteria 887
283 Ga0439431_0059738 3300041997 Bacteria 1001
284 Ga0439445_0086199 3300042004 Bacteria 881
285 Ga0439449_0005070 3300042007 Bacteria 5065
286 Ga0439450_050995 3300042008 Bacteria 983
287 Ga0439455_0052363 3300042012 Bacteria 1069
288 Ga0439464_0019506 3300042439 Bacteria 1851
289 Ga0439460_0020276 3300042461 Bacteria 1807
290 Ga0439460_0034897 3300042461 Bacteria 1452
291 Ga0439440_0025663 3300042993 Bacteria 1359
292 Ga0453683_0673825 3300044673 Bacteria 677
293 Ga0466963_0222452 3300044694 Bacteria 1322
294 Ga0466957_0327202 3300044842 Bacteria 1035
295 Ga0466959_0181852 3300045049 Bacteria 1470
296 Ga0466958_0175508 3300045836 Bacteria 1358
297 Ga0495603_0000540 3300046455 Bacteria 21072
298 Ga0495591_001016 3300046458 Bacteria 18989
299 Ga0495629_0001758 3300046459 Bacteria 16997
300 Ga0495650_0000819 3300046471 Bacteria 37873
301 Ga0495580_0004007 3300046472 Bacteria 12434
302 Ga0495582_0063478 3300046473 Bacteria 2040
303 Ga0495605_0406662 3300046474 Bacteria 565
304 Ga0495662_0037765 3300046476 Bacteria 2333
305 Ga0495594_0236862 3300046499 Bacteria 1040
306 Ga0495606_0003946 3300046507 Bacteria 15249
307 Ga0495608_0193102 3300046511 Bacteria 1285
308 Ga0495642_0003166 3300046528 Bacteria 6527
309 Ga0495652_0163567 3300046529 Bacteria 1725
310 Ga0495654_0081606 3300046530 Bacteria 1515
311 Ga0495665_0004612 3300046531 Bacteria 7434
312 Ga0495586_0028175 3300046535 Bacteria 3007
313 Ga0495645_0000309 3300046543 Bacteria 35183
314 Ga0495667_0055184 3300046559 Bacteria 2613
315 Ga0495656_0386804 3300046615 Bacteria 730
316 Ga0495588_0103217 3300046674 Bacteria 1499
317 Ga0495623_0317607 3300046679 Bacteria 856
318 Ga0495646_0152682 3300046680 Bacteria 1283
319 Ga0495669_0269733 3300046684 Bacteria 818
320 Ga0495669_0489146 3300046684 Bacteria 598
321 Ga0495613_0066649 3300046689 Bacteria 2629
322 Ga0495624_0682530 3300046690 Bacteria 610
323 Ga0495670_0097625 3300046691 Bacteria 1510
324 Ga0495649_0417477 3300046694 Bacteria 672
325 Ga0495589_0065661 3300046794 Bacteria 1778
326 Ga0495600_0134507 3300046809 Bacteria 1606
327 Ga0495581_0008637 3300047315 Bacteria 5900
328 Ga0495672_0116593 3300047320 Bacteria 1426
329 Ga0495680_0055815 3300047322 Bacteria 3062
330 Ga0495687_009200 3300047443 Bacteria 5555
331 Ga0495675_0043300 3300047444 Bacteria 2868
332 Ga0495681_0040686 3300047470 Bacteria 2262
333 Ga0495593_0409261 3300047673 Bacteria 678
334 Ga0495614_0041485 3300048089 Bacteria 1974
335 Ga0496100_0079217 3300048903 Bacteria 2213
336 Ga0496101_0007137 3300048904 Bacteria 7224
337 Ga0496101_0189805 3300048904 Bacteria 1585
338 Ga0496101_0279223 3300048904 Bacteria 1305
339 Ga0496102_0238066 3300048905 Bacteria 1717
340 Ga0496102_0803195 3300048905 Bacteria 863
341 Ga0496102_1006287 3300048905 Bacteria 754
342 Ga0496102_1358826 3300048905 Bacteria 629
343 Ga0496104_0853499 3300048907 Bacteria 816
344 Ga0496106_0045535 3300048909 Bacteria 3295
345 Ga0496107_0024805 3300048910 Bacteria 4243
346 Ga0496107_1220416 3300048910 Bacteria 540
347 Ga0496108_0118107 3300048911 Bacteria 2273
348 Ga0496108_0389757 3300048911 Bacteria 1216
349 Ga0496108_0996507 3300048911 Bacteria 716
350 Ga0496109_1037054 3300048912 Bacteria 757
351 Ga0496109_1081907 3300048912 Bacteria 739
352 Ga0496110_0312727 3300048913 Bacteria 1430
353 Ga0496110_1494065 3300048913 Bacteria 585
354 Ga0496110_1665677 3300048913 Bacteria 548
355 Ga0496111_0153663 3300048914 Bacteria 1707
356 Ga0496112_0025435 3300048915 Bacteria 5684
357 Ga0496113_0101298 3300048916 Bacteria 2232
358 Ga0496114_0003644 3300048917 Bacteria 11845
359 Ga0496114_0021087 3300048917 Bacteria 5296
360 Ga0496115_0024293 3300048918 Bacteria 4709
361 Ga0496115_0147147 3300048918 Bacteria 1944
362 Ga0496121_0038130 3300048924 Bacteria 4261
363 Ga0496124_0036169 3300048927 Bacteria 4311
364 Ga0496126_0459322 3300048929 Bacteria 1024
365 Ga0501039_0812289 3300049575 Bacteria 729
366 Ga0501041_0164231 3300049577 Bacteria 1389
367 Ga0501041_0270572 3300049577 Bacteria 1069
368 Ga0501047_0094721 3300049581 Bacteria 2865
369 Ga0501072_0932268 3300049588 Bacteria 678
370 Ga0501072_0947755 3300049588 Bacteria 672
371 Ga0501249_138283 3300049679 Bacteria 605
372 Ga0501083_0002831 3300049744 Bacteria 11986
373 nmdc:mga00v17_153017_c1 3300050491 Bacteria 1482
374 nmdc:mga06z11_325755_c1 3300050494 Bacteria 917
375 nmdc:mga05p37_443220_c1 3300050507 Bacteria 1505
376 nmdc:mga09592_138150_c1 3300050508 Bacteria 2100
377 nmdc:mga09592_54371_c1 3300050508 Bacteria 3382
378 nmdc:mga0qj67_48870_c1 3300050509 Bacteria 3343
379 nmdc:mga06r32_109024_c1 3300050510 Bacteria 2723
380 nmdc:mga06r32_521482_c1 3300050510 Bacteria 1164
381 nmdc:mga06r32_85416_c1 3300050510 Bacteria 3077
382 nmdc:mga08y16_312081_c1 3300050511 Bacteria 1620
383 nmdc:mga0a205_5596_c1 3300050515 Bacteria 11322
384 Ga0500583_0200318 3300053092 Bacteria 992
385 Ga0500641_0003285 3300053096 Bacteria 5717
386 Ga0500658_0096283 3300053134 Bacteria 1286
387 Ga0500588_0002343 3300053146 Bacteria 3833
388 Ga0500656_014293 3300053732 Bacteria 918
389 Ga0501082_0005125 3300060353 Bacteria 11405
390 Ga0501082_1760359 3300060353 Bacteria 540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_11319486 Ga0207683_113194861 126
2 3300047320 Ga0495672_0116593 Ga0495672_0116593_971_1360 129
3 iso_pu_bacteria 2885192300 2885196279 131
4 3300041406 Ga0439439_0262283 Ga0439439_0262283_59_457 132
5 3300042007 Ga0439449_0005070 Ga0439449_0005070_3462_3860 132
6 3300007265 Ga0099794_10232377 Ga0099794_102323771 133
7 3300013100 Ga0157373_11231908 Ga0157373_112319082 133
8 3300046529 Ga0495652_0163567 Ga0495652_0163567_402_803 133
9 3300009545 Ga0105237_10013913 Ga0105237_100139136 134
10 3300014968 Ga0157379_10035601 Ga0157379_100356015 134
11 3300046684 Ga0495669_0269733 Ga0495669_0269733_206_610 134
12 3300046694 Ga0495649_0417477 Ga0495649_0417477_155_559 134
13 3300047443 Ga0495687_009200 Ga0495687_009200_4473_4877 134
14 3300048929 Ga0496126_0459322 Ga0496126_0459322_584_988 134
15 3300049575 Ga0501039_0812289 Ga0501039_0812289_47_451 134
16 3300028794 Ga0307515_10000028 Ga0307515_1000002813 135
17 3300031456 Ga0307513_10083109 Ga0307513_100831093 135
18 3300041997 Ga0439431_0059738 Ga0439431_0059738_570_980 135
19 3300042004 Ga0439445_0086199 Ga0439445_0086199_85_495 135
20 3300049581 Ga0501047_0094721 Ga0501047_0094721_1588_1995 135
21 3300049588 Ga0501072_0932268 Ga0501072_0932268_230_637 135
22 3300049744 Ga0501083_0002831 Ga0501083_0002831_676_1083 135
23 3300060353 Ga0501082_0005125 Ga0501082_0005125_84_491 135
24 3300060353 Ga0501082_1760359 Ga0501082_1760359_55_462 135
25 3300009551 Ga0105238_11676367 Ga0105238_116763671 136
26 3300033179 Ga0307507_10035394 Ga0307507_100353942 136
27 3300039437 Ga0436365_0614938 Ga0436365_0614938_2239_2652 136
28 3300041463 Ga0451804_0905642 Ga0451804_0905642_160_573 136
29 3300042461 Ga0439460_0020276 Ga0439460_0020276_1064_1477 136
30 3300046455 Ga0495603_0000540 Ga0495603_0000540_7832_8242 136
31 3300046458 Ga0495591_001016 Ga0495591_001016_15135_15548 136
32 3300046459 Ga0495629_0001758 Ga0495629_0001758_10512_10922 136
33 3300046471 Ga0495650_0000819 Ga0495650_0000819_29282_29692 136
34 3300046472 Ga0495580_0004007 Ga0495580_0004007_3744_4154 136
35 3300046473 Ga0495582_0063478 Ga0495582_0063478_253_663 136
36 3300046474 Ga0495605_0406662 Ga0495605_0406662_81_491 136
37 3300046476 Ga0495662_0037765 Ga0495662_0037765_261_671 136
38 3300046499 Ga0495594_0236862 Ga0495594_0236862_312_722 136
39 3300046511 Ga0495608_0193102 Ga0495608_0193102_741_1151 136
40 3300046528 Ga0495642_0003166 Ga0495642_0003166_1250_1660 136
41 3300046530 Ga0495654_0081606 Ga0495654_0081606_927_1337 136
42 3300046531 Ga0495665_0004612 Ga0495665_0004612_1415_1825 136
43 3300046535 Ga0495586_0028175 Ga0495586_0028175_2046_2456 136
44 3300046543 Ga0495645_0000309 Ga0495645_0000309_15767_16177 136
45 3300046559 Ga0495667_0055184 Ga0495667_0055184_2165_2575 136
46 3300046615 Ga0495656_0386804 Ga0495656_0386804_196_606 136
47 3300046674 Ga0495588_0103217 Ga0495588_0103217_873_1283 136
48 3300046679 Ga0495623_0317607 Ga0495623_0317607_370_780 136
49 3300046680 Ga0495646_0152682 Ga0495646_0152682_314_724 136
50 3300046689 Ga0495613_0066649 Ga0495613_0066649_1299_1709 136
51 3300046690 Ga0495624_0682530 Ga0495624_0682530_70_480 136
52 3300046691 Ga0495670_0097625 Ga0495670_0097625_125_535 136
53 3300046794 Ga0495589_0065661 Ga0495589_0065661_1322_1732 136
54 3300046809 Ga0495600_0134507 Ga0495600_0134507_187_597 136
55 3300047315 Ga0495581_0008637 Ga0495581_0008637_4220_4630 136
56 3300047322 Ga0495680_0055815 Ga0495680_0055815_1408_1818 136
57 3300047444 Ga0495675_0043300 Ga0495675_0043300_1673_2083 136
58 3300047470 Ga0495681_0040686 Ga0495681_0040686_63_473 136
59 3300047673 Ga0495593_0409261 Ga0495593_0409261_186_596 136
60 3300048089 Ga0495614_0041485 Ga0495614_0041485_497_907 136
61 3300048903 Ga0496100_0079217 Ga0496100_0079217_1170_1580 136
62 3300048904 Ga0496101_0189805 Ga0496101_0189805_516_926 136
63 3300048905 Ga0496102_0238066 Ga0496102_0238066_239_652 136
64 3300048911 Ga0496108_0118107 Ga0496108_0118107_1421_1831 136
65 3300048913 Ga0496110_1665677 Ga0496110_1665677_119_532 136
66 3300048917 Ga0496114_0003644 Ga0496114_0003644_2638_3048 136
67 3300048918 Ga0496115_0024293 Ga0496115_0024293_2185_2595 136
68 3300048924 Ga0496121_0038130 Ga0496121_0038130_3035_3448 136
69 3300048927 Ga0496124_0036169 Ga0496124_0036169_3150_3563 136
70 iso_pu_bacteria 2929160207 2929162008 136
71 3300009551 Ga0105238_10714401 Ga0105238_107144011 137
72 3300013296 Ga0157374_10856391 Ga0157374_108563912 137
73 3300013306 Ga0163162_10014240 Ga0163162_100142401 137
74 3300014325 Ga0163163_10007543 Ga0163163_100075435 137
75 3300014745 Ga0157377_10318284 Ga0157377_103182842 137
76 3300025898 Ga0207692_10775329 Ga0207692_107753291 137
77 3300044694 Ga0466963_0222452 Ga0466963_0222452_618_1031 137
78 3300044842 Ga0466957_0327202 Ga0466957_0327202_366_779 137
79 3300045049 Ga0466959_0181852 Ga0466959_0181852_889_1302 137
80 3300045836 Ga0466958_0175508 Ga0466958_0175508_282_695 137
81 3300005436 Ga0070713_100550927 Ga0070713_1005509271 138
82 3300005458 Ga0070681_10077911 Ga0070681_100779113 138
83 3300006051 Ga0075364_10698491 Ga0075364_106984912 138
84 3300006178 Ga0075367_10344652 Ga0075367_103446522 138
85 3300009093 Ga0105240_10051181 Ga0105240_100511814 138
86 3300009174 Ga0105241_10291522 Ga0105241_102915223 138
87 3300009545 Ga0105237_10139454 Ga0105237_101394544 138
88 3300009551 Ga0105238_10001355 Ga0105238_100013559 138
89 3300009551 Ga0105238_10324779 Ga0105238_103247792 138
90 3300013104 Ga0157370_10000298 Ga0157370_1000029825 138
91 3300013104 Ga0157370_10419884 Ga0157370_104198842 138
92 3300013105 Ga0157369_10105199 Ga0157369_101051992 138
93 3300013307 Ga0157372_10286603 Ga0157372_102866033 138
94 3300013308 Ga0157375_10296228 Ga0157375_102962283 138
95 3300014969 Ga0157376_10003346 Ga0157376_100033464 138
96 3300025928 Ga0207700_10338597 Ga0207700_103385972 138
97 3300035115 Ga0373941_0120594 Ga0373941_0120594_199_618 138
98 3300037471 Ga0395905_1360146 Ga0395905_1360146_97_516 138
99 3300042461 Ga0439460_0034897 Ga0439460_0034897_200_625 138
100 3300046684 Ga0495669_0489146 Ga0495669_0489146_66_485 138
101 3300048904 Ga0496101_0279223 Ga0496101_0279223_476_895 138
102 3300048905 Ga0496102_0803195 Ga0496102_0803195_379_798 138
103 3300048909 Ga0496106_0045535 Ga0496106_0045535_291_710 138
104 3300048912 Ga0496109_1081907 Ga0496109_1081907_107_526 138
105 3300048913 Ga0496110_1494065 Ga0496110_1494065_33_449 138
106 3300050491 nmdc:mga00v17_153017_c1 nmdc:mga00v17_153017_c1_40_456 138
107 3300050494 nmdc:mga06z11_325755_c1 nmdc:mga06z11_325755_c1_336_752 138
108 3300050507 nmdc:mga05p37_443220_c1 nmdc:mga05p37_443220_c1_702_1118 138
109 3300050508 nmdc:mga09592_138150_c1 nmdc:mga09592_138150_c1_697_1113 138
110 3300050509 nmdc:mga0qj67_48870_c1 nmdc:mga0qj67_48870_c1_1899_2318 138
111 3300050510 nmdc:mga06r32_521482_c1 nmdc:mga06r32_521482_c1_27_443 138
112 3300050510 nmdc:mga06r32_85416_c1 nmdc:mga06r32_85416_c1_2591_3007 138
113 3300053092 Ga0500583_0200318 Ga0500583_0200318_125_544 138
114 3300005330 Ga0070690_100342641 Ga0070690_1003426412 139
115 3300014497 Ga0182008_10102803 Ga0182008_101028032 139
116 3300014968 Ga0157379_11899748 Ga0157379_118997481 139
117 3300048905 Ga0496102_1006287 Ga0496102_1006287_90_515 139
118 3300048910 Ga0496107_1220416 Ga0496107_1220416_42_467 139
119 3300049577 Ga0501041_0164231 Ga0501041_0164231_253_672 139
120 3300005330 Ga0070690_100003208 Ga0070690_1000032085 140
121 3300005333 Ga0070677_10021235 Ga0070677_100212351 140
122 3300005334 Ga0068869_100043947 Ga0068869_1000439473 140
123 3300005338 Ga0068868_100077813 Ga0068868_1000778132 140
124 3300005340 Ga0070689_100012584 Ga0070689_1000125844 140
125 3300005343 Ga0070687_100331583 Ga0070687_1003315832 140
126 3300005354 Ga0070675_100002384 Ga0070675_1000023844 140
127 3300005355 Ga0070671_100004504 Ga0070671_1000045043 140
128 3300005356 Ga0070674_100309948 Ga0070674_1003099481 140
129 3300005364 Ga0070673_100007250 Ga0070673_1000072506 140
130 3300005366 Ga0070659_100432034 Ga0070659_1004320342 140
131 3300005367 Ga0070667_100104221 Ga0070667_1001042213 140
132 3300005459 Ga0068867_100503295 Ga0068867_1005032952 140
133 3300005466 Ga0070685_10100485 Ga0070685_101004853 140
134 3300005535 Ga0070684_100342168 Ga0070684_1003421681 140
135 3300005543 Ga0070672_100214399 Ga0070672_1002143993 140
136 3300005616 Ga0068852_100120530 Ga0068852_1001205302 140
137 3300005617 Ga0068859_100015690 Ga0068859_1000156905 140
138 3300005618 Ga0068864_100005692 Ga0068864_1000056928 140
139 3300005842 Ga0068858_100006919 Ga0068858_1000069198 140
140 3300005843 Ga0068860_100186032 Ga0068860_1001860322 140
141 3300006237 Ga0097621_100076934 Ga0097621_1000769345 140
142 3300006237 Ga0097621_100731957 Ga0097621_1007319572 140
143 3300006931 Ga0097620_100015690 Ga0097620_1000156905 140
144 3300009098 Ga0105245_10677907 Ga0105245_106779072 140
145 3300014968 Ga0157379_10221628 Ga0157379_102216283 140
146 3300014969 Ga0157376_10112123 Ga0157376_101121233 140
147 3300017792 Ga0163161_10482983 Ga0163161_104829832 140
148 3300025290 Ga0207673_1006726 Ga0207673_10067262 140
149 3300025903 Ga0207680_10651060 Ga0207680_106510602 140
150 3300025926 Ga0207659_10004929 Ga0207659_100049293 140
151 3300025932 Ga0207690_11401937 Ga0207690_114019371 140
152 3300025933 Ga0207706_10859336 Ga0207706_108593362 140
153 3300025936 Ga0207670_10023798 Ga0207670_100237983 140
154 3300025940 Ga0207691_10089984 Ga0207691_100899843 140
155 3300025942 Ga0207689_10030996 Ga0207689_100309963 140
156 3300025960 Ga0207651_10014546 Ga0207651_100145464 140
157 3300026023 Ga0207677_10007544 Ga0207677_100075445 140
158 3300026035 Ga0207703_10009675 Ga0207703_100096755 140
159 3300026088 Ga0207641_10009356 Ga0207641_100093564 140
160 3300026089 Ga0207648_10560526 Ga0207648_105605262 140
161 3300026095 Ga0207676_10005096 Ga0207676_100050962 140
162 3300026121 Ga0207683_10033494 Ga0207683_100334944 140
163 3300026142 Ga0207698_10130885 Ga0207698_101308853 140
164 3300028381 Ga0268264_11169520 Ga0268264_111695202 140
165 3300032002 Ga0307416_100554332 Ga0307416_1005543322 140
166 3300032126 Ga0307415_100151202 Ga0307415_1001512022 140
167 3300048911 Ga0496108_0996507 Ga0496108_0996507_40_468 140
168 3300053096 Ga0500641_0003285 Ga0500641_0003285_542_1024 140
169 3300001977 JGI24746J21847_1042978 JGI24746J21847_10429782 141
170 3300002075 JGI24738J21930_10023665 JGI24738J21930_100236653 141
171 3300002459 JGI24751J29686_10029448 JGI24751J29686_100294482 141
172 3300003214 JGI25165J46597_1042313 JGI25165J46597_10423131 141
173 3300005293 Ga0065715_10384517 Ga0065715_103845171 141
174 3300005327 Ga0070658_10126911 Ga0070658_101269113 141
175 3300005328 Ga0070676_10011459 Ga0070676_100114593 141
176 3300005328 Ga0070676_10151766 Ga0070676_101517663 141
177 3300005329 Ga0070683_100175726 Ga0070683_1001757262 141
178 3300005330 Ga0070690_100000828 Ga0070690_1000008283 141
179 3300005331 Ga0070670_100009649 Ga0070670_10000964911 141
180 3300005331 Ga0070670_101520238 Ga0070670_1015202381 141
181 3300005334 Ga0068869_100058766 Ga0068869_1000587662 141
182 3300005335 Ga0070666_10003149 Ga0070666_100031499 141
183 3300005336 Ga0070680_100011329 Ga0070680_1000113297 141
184 3300005337 Ga0070682_100007406 Ga0070682_1000074068 141
185 3300005340 Ga0070689_100002488 Ga0070689_10000248810 141
186 3300005341 Ga0070691_10000310 Ga0070691_1000031019 141
187 3300005343 Ga0070687_100377090 Ga0070687_1003770902 141
188 3300005344 Ga0070661_100001241 Ga0070661_10000124120 141
189 3300005345 Ga0070692_10000736 Ga0070692_100007363 141
190 3300005347 Ga0070668_100000234 Ga0070668_10000023416 141
191 3300005353 Ga0070669_100203262 Ga0070669_1002032621 141
192 3300005354 Ga0070675_100009972 Ga0070675_1000099726 141
193 3300005354 Ga0070675_101027452 Ga0070675_1010274521 141
194 3300005355 Ga0070671_100025325 Ga0070671_1000253252 141
195 3300005356 Ga0070674_100001018 Ga0070674_10000101811 141
196 3300005364 Ga0070673_100000403 Ga0070673_10000040310 141
197 3300005365 Ga0070688_100009268 Ga0070688_1000092688 141
198 3300005366 Ga0070659_100024047 Ga0070659_1000240472 141
199 3300005367 Ga0070667_100003240 Ga0070667_1000032402 141
200 3300005434 Ga0070709_10011069 Ga0070709_100110696 141
201 3300005435 Ga0070714_100022290 Ga0070714_1000222906 141
202 3300005436 Ga0070713_100063928 Ga0070713_1000639285 141
203 3300005437 Ga0070710_10008768 Ga0070710_100087681 141
204 3300005438 Ga0070701_10058240 Ga0070701_100582401 141
205 3300005439 Ga0070711_100010291 Ga0070711_1000102912 141
206 3300005440 Ga0070705_100001109 Ga0070705_10000110916 141
207 3300005441 Ga0070700_100000966 Ga0070700_1000009668 141
208 3300005444 Ga0070694_100006898 Ga0070694_1000068987 141
209 3300005455 Ga0070663_100163610 Ga0070663_1001636102 141
210 3300005456 Ga0070678_100042334 Ga0070678_1000423342 141
211 3300005457 Ga0070662_100828174 Ga0070662_1008281741 141
212 3300005458 Ga0070681_10020522 Ga0070681_100205222 141
213 3300005466 Ga0070685_10024005 Ga0070685_100240052 141
214 3300005530 Ga0070679_100001877 Ga0070679_1000018779 141
215 3300005530 Ga0070679_100233313 Ga0070679_1002333132 141
216 3300005530 Ga0070679_100257295 Ga0070679_1002572952 141
217 3300005530 Ga0070679_100622933 Ga0070679_1006229331 141
218 3300005535 Ga0070684_100391570 Ga0070684_1003915702 141
219 3300005536 Ga0070697_100014153 Ga0070697_1000141538 141
220 3300005539 Ga0068853_100002553 Ga0068853_1000025532 141
221 3300005539 Ga0068853_100613020 Ga0068853_1006130202 141
222 3300005543 Ga0070672_100006711 Ga0070672_1000067116 141
223 3300005544 Ga0070686_100001906 Ga0070686_1000019062 141
224 3300005545 Ga0070695_100001397 Ga0070695_1000013972 141
225 3300005545 Ga0070695_100049326 Ga0070695_1000493262 141
226 3300005546 Ga0070696_100002930 Ga0070696_10000293012 141
227 3300005548 Ga0070665_100010067 Ga0070665_10001006713 141
228 3300005549 Ga0070704_100001520 Ga0070704_10000152012 141
229 3300005563 Ga0068855_100003598 Ga0068855_10000359810 141
230 3300005563 Ga0068855_100006487 Ga0068855_10000648712 141
231 3300005563 Ga0068855_100303815 Ga0068855_1003038155 141
232 3300005564 Ga0070664_100002217 Ga0070664_1000022179 141
233 3300005577 Ga0068857_100193128 Ga0068857_1001931282 141
234 3300005578 Ga0068854_100006266 Ga0068854_1000062664 141
235 3300005614 Ga0068856_100007771 Ga0068856_1000077716 141
236 3300005614 Ga0068856_100258744 Ga0068856_1002587441 141
237 3300005615 Ga0070702_100001629 Ga0070702_1000016295 141
238 3300005616 Ga0068852_100036803 Ga0068852_1000368036 141
239 3300005617 Ga0068859_100939207 Ga0068859_1009392072 141
240 3300005618 Ga0068864_100006229 Ga0068864_1000062292 141
241 3300005719 Ga0068861_100001266 Ga0068861_10000126612 141
242 3300005840 Ga0068870_10247951 Ga0068870_102479512 141
243 3300005841 Ga0068863_100001254 Ga0068863_10000125428 141
244 3300005842 Ga0068858_100005485 Ga0068858_1000054852 141
245 3300005843 Ga0068860_100011677 Ga0068860_1000116776 141
246 3300006163 Ga0070715_10003841 Ga0070715_100038411 141
247 3300006173 Ga0070716_100002741 Ga0070716_1000027412 141
248 3300006175 Ga0070712_100016557 Ga0070712_1000165572 141
249 3300006844 Ga0075428_100018307 Ga0075428_10001830710 141
250 3300006846 Ga0075430_100074137 Ga0075430_1000741373 141
251 3300006846 Ga0075430_100078215 Ga0075430_1000782153 141
252 3300006847 Ga0075431_100403697 Ga0075431_1004036973 141
253 3300006880 Ga0075429_100019110 Ga0075429_1000191102 141
254 3300006880 Ga0075429_100241956 Ga0075429_1002419562 141
255 3300006881 Ga0068865_100107443 Ga0068865_1001074433 141
256 3300006931 Ga0097620_100939178 Ga0097620_1009391782 141
257 3300009092 Ga0105250_10308492 Ga0105250_103084921 141
258 3300009093 Ga0105240_10004115 Ga0105240_1000411516 141
259 3300009093 Ga0105240_10014853 Ga0105240_100148534 141
260 3300009093 Ga0105240_10220554 Ga0105240_102205543 141
261 3300009094 Ga0111539_10516037 Ga0111539_105160372 141
262 3300009094 Ga0111539_10852069 Ga0111539_108520692 141
263 3300009098 Ga0105245_10004081 Ga0105245_100040816 141
264 3300009147 Ga0114129_10056554 Ga0114129_100565543 141
265 3300009147 Ga0114129_10320688 Ga0114129_103206883 141
266 3300009148 Ga0105243_10005218 Ga0105243_100052186 141
267 3300009174 Ga0105241_10001143 Ga0105241_1000114319 141
268 3300009177 Ga0105248_10002357 Ga0105248_100023578 141
269 3300009545 Ga0105237_10013591 Ga0105237_100135916 141
270 3300009553 Ga0105249_10004381 Ga0105249_1000438112 141
271 3300009553 Ga0105249_12186102 Ga0105249_121861021 141
272 3300010159 Ga0099796_10035473 Ga0099796_100354732 141
273 3300010375 Ga0105239_10888805 Ga0105239_108888052 141
274 3300013102 Ga0157371_10013293 Ga0157371_100132931 141
275 3300013105 Ga0157369_10007117 Ga0157369_100071174 141
276 3300013105 Ga0157369_10014687 Ga0157369_100146878 141
277 3300013296 Ga0157374_11837372 Ga0157374_118373721 141
278 3300013297 Ga0157378_10023886 Ga0157378_100238866 141
279 3300013306 Ga0163162_10851620 Ga0163162_108516202 141
280 3300013307 Ga0157372_10004863 Ga0157372_100048638 141
281 3300013308 Ga0157375_10262727 Ga0157375_102627271 141
282 3300014325 Ga0163163_10006733 Ga0163163_100067337 141
283 3300014745 Ga0157377_10011806 Ga0157377_100118063 141
284 3300014968 Ga0157379_10273063 Ga0157379_102730631 141
285 3300014969 Ga0157376_10001343 Ga0157376_1000134313 141
286 3300017792 Ga0163161_10002609 Ga0163161_100026091 141
287 3300022467 Ga0224712_10569934 Ga0224712_105699341 141
288 3300025261 Ga0209233_1003344 Ga0209233_10033443 141
289 3300025901 Ga0207688_10002165 Ga0207688_100021656 141
290 3300025904 Ga0207647_10002823 Ga0207647_100028238 141
291 3300025906 Ga0207699_10011678 Ga0207699_100116781 141
292 3300025907 Ga0207645_10011062 Ga0207645_100110622 141
293 3300025911 Ga0207654_10357521 Ga0207654_103575211 141
294 3300025912 Ga0207707_10000470 Ga0207707_1000047017 141
295 3300025912 Ga0207707_10006510 Ga0207707_1000651010 141
296 3300025913 Ga0207695_10001758 Ga0207695_100017583 141
297 3300025913 Ga0207695_10216094 Ga0207695_102160943 141
298 3300025913 Ga0207695_10240779 Ga0207695_102407793 141
299 3300025913 Ga0207695_10332890 Ga0207695_103328903 141
300 3300025914 Ga0207671_10009117 Ga0207671_100091176 141
301 3300025915 Ga0207693_10002297 Ga0207693_100022971 141
302 3300025916 Ga0207663_10000540 Ga0207663_100005403 141
303 3300025917 Ga0207660_10003113 Ga0207660_100031133 141
304 3300025918 Ga0207662_10350645 Ga0207662_103506451 141
305 3300025919 Ga0207657_10000793 Ga0207657_100007938 141
306 3300025920 Ga0207649_10234455 Ga0207649_102344553 141
307 3300025921 Ga0207652_10000795 Ga0207652_1000079516 141
308 3300025921 Ga0207652_10059616 Ga0207652_100596163 141
309 3300025921 Ga0207652_10152593 Ga0207652_101525931 141
310 3300025923 Ga0207681_10042900 Ga0207681_100429001 141
311 3300025926 Ga0207659_10037091 Ga0207659_100370911 141
312 3300025926 Ga0207659_10790317 Ga0207659_107903172 141
313 3300025926 Ga0207659_10908401 Ga0207659_109084012 141
314 3300025927 Ga0207687_10283531 Ga0207687_102835311 141
315 3300025928 Ga0207700_10094858 Ga0207700_100948585 141
316 3300025931 Ga0207644_10030866 Ga0207644_100308666 141
317 3300025931 Ga0207644_10487582 Ga0207644_104875822 141
318 3300025932 Ga0207690_10004925 Ga0207690_100049251 141
319 3300025933 Ga0207706_10000771 Ga0207706_1000077134 141
320 3300025934 Ga0207686_10022152 Ga0207686_100221525 141
321 3300025935 Ga0207709_10290244 Ga0207709_102902441 141
322 3300025937 Ga0207669_10240558 Ga0207669_102405583 141
323 3300025938 Ga0207704_10129485 Ga0207704_101294851 141
324 3300025939 Ga0207665_10006767 Ga0207665_100067679 141
325 3300025940 Ga0207691_10013656 Ga0207691_100136566 141
326 3300025941 Ga0207711_10066762 Ga0207711_100667625 141
327 3300025942 Ga0207689_10159023 Ga0207689_101590233 141
328 3300025945 Ga0207679_10039243 Ga0207679_100392431 141
329 3300025945 Ga0207679_10175159 Ga0207679_101751593 141
330 3300025945 Ga0207679_11045919 Ga0207679_110459192 141
331 3300025949 Ga0207667_10006758 Ga0207667_100067588 141
332 3300025949 Ga0207667_10178435 Ga0207667_101784351 141
333 3300025960 Ga0207651_10002140 Ga0207651_100021402 141
334 3300025961 Ga0207712_10012704 Ga0207712_100127046 141
335 3300025972 Ga0207668_10109742 Ga0207668_101097424 141
336 3300025981 Ga0207640_10317299 Ga0207640_103172993 141
337 3300025986 Ga0207658_10019372 Ga0207658_100193727 141
338 3300026023 Ga0207677_10116548 Ga0207677_101165482 141
339 3300026035 Ga0207703_10050351 Ga0207703_100503516 141
340 3300026041 Ga0207639_10124939 Ga0207639_101249392 141
341 3300026067 Ga0207678_10001022 Ga0207678_1000102219 141
342 3300026067 Ga0207678_11226350 Ga0207678_112263502 141
343 3300026075 Ga0207708_10008196 Ga0207708_100081969 141
344 3300026078 Ga0207702_10010968 Ga0207702_1001096810 141
345 3300026078 Ga0207702_10346541 Ga0207702_103465411 141
346 3300026095 Ga0207676_10184361 Ga0207676_101843612 141
347 3300026116 Ga0207674_10004073 Ga0207674_1000407315 141
348 3300026118 Ga0207675_100000706 Ga0207675_10000070631 141
349 3300026121 Ga0207683_10005141 Ga0207683_100051416 141
350 3300027907 Ga0207428_10052400 Ga0207428_100524003 141
351 3300028379 Ga0268266_10137454 Ga0268266_101374543 141
352 3300028380 Ga0268265_11619796 Ga0268265_116197961 141
353 3300031548 Ga0307408_100178704 Ga0307408_1001787042 141
354 3300032005 Ga0307411_12333034 Ga0307411_123330341 141
355 3300034818 Ga0373950_0031733 Ga0373950_0031733_223_648 141
356 3300035084 Ga0373928_0009529 Ga0373928_0009529_1151_1576 141
357 3300035090 Ga0373949_0020588 Ga0373949_0020588_401_826 141
358 3300035090 Ga0373949_0153115 Ga0373949_0153115_128_556 141
359 3300035092 Ga0373952_0088765 Ga0373952_0088765_286_714 141
360 3300035112 Ga0373932_0160774 Ga0373932_0160774_112_537 141
361 3300035114 Ga0373939_0306191 Ga0373939_0306191_34_459 141
362 3300035241 Ga0373961_0033944 Ga0373961_0033944_216_641 141
363 3300035241 Ga0373961_0177659 Ga0373961_0177659_63_491 141
364 3300035691 Ga0373931_0002027 Ga0373931_0002027_129_554 141
365 3300042008 Ga0439450_050995 Ga0439450_050995_333_767 141
366 3300042012 Ga0439455_0052363 Ga0439455_0052363_611_1045 141
367 3300042439 Ga0439464_0019506 Ga0439464_0019506_377_811 141
368 3300042993 Ga0439440_0025663 Ga0439440_0025663_637_1071 141
369 3300044673 Ga0453683_0673825 Ga0453683_0673825_214_642 141
370 3300046507 Ga0495606_0003946 Ga0495606_0003946_5003_5440 141
371 3300048904 Ga0496101_0007137 Ga0496101_0007137_6579_7004 141
372 3300048905 Ga0496102_1358826 Ga0496102_1358826_92_517 141
373 3300048907 Ga0496104_0853499 Ga0496104_0853499_84_512 141
374 3300048910 Ga0496107_0024805 Ga0496107_0024805_3706_4131 141
375 3300048911 Ga0496108_0389757 Ga0496108_0389757_221_646 141
376 3300048912 Ga0496109_1037054 Ga0496109_1037054_113_538 141
377 3300048913 Ga0496110_0312727 Ga0496110_0312727_785_1210 141
378 3300048914 Ga0496111_0153663 Ga0496111_0153663_712_1137 141
379 3300048915 Ga0496112_0025435 Ga0496112_0025435_1427_1852 141
380 3300048916 Ga0496113_0101298 Ga0496113_0101298_1546_1971 141
381 3300048917 Ga0496114_0021087 Ga0496114_0021087_849_1274 141
382 3300048918 Ga0496115_0147147 Ga0496115_0147147_221_646 141
383 3300049577 Ga0501041_0270572 Ga0501041_0270572_274_702 141
384 3300049588 Ga0501072_0947755 Ga0501072_0947755_62_490 141
385 3300049679 Ga0501249_138283 Ga0501249_138283_82_510 141
386 3300050508 nmdc:mga09592_54371_c1 nmdc:mga09592_54371_c1_2879_3304 141
387 3300050510 nmdc:mga06r32_109024_c1 nmdc:mga06r32_109024_c1_2058_2486 141
388 3300050511 nmdc:mga08y16_312081_c1 nmdc:mga08y16_312081_c1_318_743 141
389 3300050515 nmdc:mga0a205_5596_c1 nmdc:mga0a205_5596_c1_9926_10351 141
390 3300053134 Ga0500658_0096283 Ga0500658_0096283_484_912 141
391 3300053146 Ga0500588_0002343 Ga0500588_0002343_69_497 141
392 3300053732 Ga0500656_014293 Ga0500656_014293_183_611 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

21

136

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8002 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7357 1 114
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7197 1 120
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7068 1 120
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6885 1 120
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8002 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7357 1 114 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6834 1 120 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6803 1 119 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6609 1 119 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A1Q7RXR3-F1-model_v4 Transcription initiation protein 0.9261 1 127
AF-A0A1M7TH95-F1-model_v4 Uncharacterized conserved protein 0.9234 1 134
AF-A0A7W1B6H1-F1-model_v4 YciI family protein 0.9204 1 126
AF-A0A1F8UAQ9-F1-model_v4 Transcription initiation protein 0.9198 1 134
AF-A0A2V7RCP6-F1-model_v4 Transcription initiation protein 0.9176 1 127

Feature Viewer

pLDDT pTM Quality
86.69 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map