F432443
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 392 | 279 | 390 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300053096|Ga0500641_0003285|Ga0500641_0003285_542_1024 |
| Length | 160 |
| Sequence | MADGRRPTNRIHSIRSQETDMRFMMLMIPKGYENAAPGTMPDAKAVEAMMAYNTSLQQAGVLLALDGLHPPSMGARVSFEGGKPKVTDGPFAEAKEIVGGYWMIQVKSREEAIEWASRCPGSGNEVIEVRQVQEIAEFPADVQAAAAGFVEMQKTTGHTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 2 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 180 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 194 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 195 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 196 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 197 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 198 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 199 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 200 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 201 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 275 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 276 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 278 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0.26 |
| Isolates | 0.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.81 |
| Nodule | 0 |
| Rhizoplane | 7.14 |
| Rhizosphere | 88.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1042978 | 3300001977 | Bacteria | 630 |
| 2 | JGI24738J21930_10023665 | 3300002075 | Bacteria | 1264 |
| 3 | JGI24751J29686_10029448 | 3300002459 | Bacteria | 1140 |
| 4 | JGI25165J46597_1042313 | 3300003214 | Bacteria | 584 |
| 5 | Ga0065715_10384517 | 3300005293 | Bacteria | 888 |
| 6 | Ga0070658_10126911 | 3300005327 | Bacteria | 2124 |
| 7 | Ga0070676_10011459 | 3300005328 | Bacteria | 4821 |
| 8 | Ga0070676_10151766 | 3300005328 | Bacteria | 1484 |
| 9 | Ga0070683_100175726 | 3300005329 | Bacteria | 2033 |
| 10 | Ga0070690_100000828 | 3300005330 | Bacteria | 15680 |
| 11 | Ga0070690_100003208 | 3300005330 | Bacteria | 8917 |
| 12 | Ga0070690_100342641 | 3300005330 | Bacteria | 1083 |
| 13 | Ga0070670_100009649 | 3300005331 | Bacteria | 8238 |
| 14 | Ga0070670_101520238 | 3300005331 | Bacteria | 615 |
| 15 | Ga0070677_10021235 | 3300005333 | Bacteria | 2380 |
| 16 | Ga0068869_100043947 | 3300005334 | Bacteria | 3211 |
| 17 | Ga0068869_100058766 | 3300005334 | Bacteria | 2813 |
| 18 | Ga0070666_10003149 | 3300005335 | Bacteria | 10017 |
| 19 | Ga0070680_100011329 | 3300005336 | Bacteria | 6896 |
| 20 | Ga0070682_100007406 | 3300005337 | Bacteria | 6192 |
| 21 | Ga0068868_100077813 | 3300005338 | Bacteria | 2654 |
| 22 | Ga0070689_100002488 | 3300005340 | Bacteria | 12048 |
| 23 | Ga0070689_100012584 | 3300005340 | Bacteria | 6102 |
| 24 | Ga0070691_10000310 | 3300005341 | Bacteria | 17151 |
| 25 | Ga0070687_100331583 | 3300005343 | Bacteria | 976 |
| 26 | Ga0070687_100377090 | 3300005343 | Bacteria | 923 |
| 27 | Ga0070661_100001241 | 3300005344 | Bacteria | 17916 |
| 28 | Ga0070692_10000736 | 3300005345 | Bacteria | 10640 |
| 29 | Ga0070668_100000234 | 3300005347 | Bacteria | 36207 |
| 30 | Ga0070669_100203262 | 3300005353 | Bacteria | 1560 |
| 31 | Ga0070675_100002384 | 3300005354 | Bacteria | 13994 |
| 32 | Ga0070675_100009972 | 3300005354 | Bacteria | 7409 |
| 33 | Ga0070675_101027452 | 3300005354 | Bacteria | 757 |
| 34 | Ga0070671_100004504 | 3300005355 | Bacteria | 11031 |
| 35 | Ga0070671_100025325 | 3300005355 | Bacteria | 4867 |
| 36 | Ga0070674_100001018 | 3300005356 | Bacteria | 14617 |
| 37 | Ga0070674_100309948 | 3300005356 | Bacteria | 1261 |
| 38 | Ga0070673_100000403 | 3300005364 | Bacteria | 22935 |
| 39 | Ga0070673_100007250 | 3300005364 | Bacteria | 7297 |
| 40 | Ga0070688_100009268 | 3300005365 | Bacteria | 5374 |
| 41 | Ga0070659_100024047 | 3300005366 | Bacteria | 4668 |
| 42 | Ga0070659_100432034 | 3300005366 | Bacteria | 1115 |
| 43 | Ga0070667_100003240 | 3300005367 | Bacteria | 13920 |
| 44 | Ga0070667_100104221 | 3300005367 | Bacteria | 2453 |
| 45 | Ga0070709_10011069 | 3300005434 | Bacteria | 5016 |
| 46 | Ga0070714_100022290 | 3300005435 | Bacteria | 5193 |
| 47 | Ga0070713_100063928 | 3300005436 | Bacteria | 3087 |
| 48 | Ga0070713_100550927 | 3300005436 | Bacteria | 1092 |
| 49 | Ga0070710_10008768 | 3300005437 | Bacteria | 4932 |
| 50 | Ga0070701_10058240 | 3300005438 | Bacteria | 2027 |
| 51 | Ga0070711_100010291 | 3300005439 | Bacteria | 5785 |
| 52 | Ga0070705_100001109 | 3300005440 | Bacteria | 14913 |
| 53 | Ga0070700_100000966 | 3300005441 | Bacteria | 14202 |
| 54 | Ga0070694_100006898 | 3300005444 | Bacteria | 6901 |
| 55 | Ga0070663_100163610 | 3300005455 | Bacteria | 1714 |
| 56 | Ga0070678_100042334 | 3300005456 | Bacteria | 3236 |
| 57 | Ga0070662_100828174 | 3300005457 | Bacteria | 787 |
| 58 | Ga0070681_10020522 | 3300005458 | Bacteria | 6622 |
| 59 | Ga0070681_10077911 | 3300005458 | Bacteria | 3271 |
| 60 | Ga0068867_100503295 | 3300005459 | Bacteria | 1041 |
| 61 | Ga0070685_10024005 | 3300005466 | Bacteria | 3345 |
| 62 | Ga0070685_10100485 | 3300005466 | Bacteria | 1766 |
| 63 | Ga0070679_100001877 | 3300005530 | Bacteria | 18910 |
| 64 | Ga0070679_100233313 | 3300005530 | Bacteria | 1799 |
| 65 | Ga0070679_100257295 | 3300005530 | Bacteria | 1701 |
| 66 | Ga0070679_100622933 | 3300005530 | Bacteria | 1022 |
| 67 | Ga0070684_100342168 | 3300005535 | Bacteria | 1375 |
| 68 | Ga0070684_100391570 | 3300005535 | Bacteria | 1281 |
| 69 | Ga0070697_100014153 | 3300005536 | Bacteria | 6266 |
| 70 | Ga0068853_100002553 | 3300005539 | Bacteria | 13675 |
| 71 | Ga0068853_100613020 | 3300005539 | Bacteria | 1034 |
| 72 | Ga0070672_100006711 | 3300005543 | Bacteria | 7760 |
| 73 | Ga0070672_100214399 | 3300005543 | Bacteria | 1613 |
| 74 | Ga0070686_100001906 | 3300005544 | Bacteria | 11609 |
| 75 | Ga0070695_100001397 | 3300005545 | Bacteria | 13379 |
| 76 | Ga0070695_100049326 | 3300005545 | Bacteria | 2696 |
| 77 | Ga0070696_100002930 | 3300005546 | Bacteria | 11340 |
| 78 | Ga0070665_100010067 | 3300005548 | Bacteria | 9570 |
| 79 | Ga0070704_100001520 | 3300005549 | Bacteria | 12505 |
| 80 | Ga0068855_100003598 | 3300005563 | Bacteria | 18933 |
| 81 | Ga0068855_100006487 | 3300005563 | Bacteria | 14229 |
| 82 | Ga0068855_100303815 | 3300005563 | Bacteria | 1767 |
| 83 | Ga0070664_100002217 | 3300005564 | Bacteria | 15619 |
| 84 | Ga0068857_100193128 | 3300005577 | Bacteria | 1854 |
| 85 | Ga0068854_100006266 | 3300005578 | Bacteria | 7559 |
| 86 | Ga0068856_100007771 | 3300005614 | Bacteria | 10474 |
| 87 | Ga0068856_100258744 | 3300005614 | Bacteria | 1756 |
| 88 | Ga0070702_100001629 | 3300005615 | Bacteria | 9294 |
| 89 | Ga0068852_100036803 | 3300005616 | Bacteria | 4099 |
| 90 | Ga0068852_100120530 | 3300005616 | Bacteria | 2400 |
| 91 | Ga0068859_100015690 | 3300005617 | Bacteria | 7612 |
| 92 | Ga0068859_100939207 | 3300005617 | Bacteria | 949 |
| 93 | Ga0068864_100005692 | 3300005618 | Bacteria | 10216 |
| 94 | Ga0068864_100006229 | 3300005618 | Bacteria | 9784 |
| 95 | Ga0068861_100001266 | 3300005719 | Bacteria | 15769 |
| 96 | Ga0068870_10247951 | 3300005840 | Bacteria | 1103 |
| 97 | Ga0068863_100001254 | 3300005841 | Bacteria | 25284 |
| 98 | Ga0068858_100005485 | 3300005842 | Bacteria | 12419 |
| 99 | Ga0068858_100006919 | 3300005842 | Bacteria | 11021 |
| 100 | Ga0068860_100011677 | 3300005843 | Bacteria | 8659 |
| 101 | Ga0068860_100186032 | 3300005843 | Bacteria | 2009 |
| 102 | Ga0075364_10698491 | 3300006051 | Bacteria | 692 |
| 103 | Ga0070715_10003841 | 3300006163 | Bacteria | 4848 |
| 104 | Ga0070716_100002741 | 3300006173 | Bacteria | 8175 |
| 105 | Ga0070712_100016557 | 3300006175 | Bacteria | 4762 |
| 106 | Ga0075367_10344652 | 3300006178 | Bacteria | 940 |
| 107 | Ga0097621_100076934 | 3300006237 | Bacteria | 2769 |
| 108 | Ga0097621_100731957 | 3300006237 | Bacteria | 912 |
| 109 | Ga0075428_100018307 | 3300006844 | Bacteria | 7743 |
| 110 | Ga0075430_100074137 | 3300006846 | Bacteria | 2853 |
| 111 | Ga0075430_100078215 | 3300006846 | Bacteria | 2773 |
| 112 | Ga0075431_100403697 | 3300006847 | Bacteria | 1367 |
| 113 | Ga0075429_100019110 | 3300006880 | Bacteria | 5935 |
| 114 | Ga0075429_100241956 | 3300006880 | Bacteria | 1581 |
| 115 | Ga0068865_100107443 | 3300006881 | Bacteria | 2052 |
| 116 | Ga0097620_100015690 | 3300006931 | Bacteria | 7612 |
| 117 | Ga0097620_100939178 | 3300006931 | Bacteria | 949 |
| 118 | Ga0099794_10232377 | 3300007265 | Bacteria | 949 |
| 119 | Ga0105250_10308492 | 3300009092 | Bacteria | 686 |
| 120 | Ga0105240_10004115 | 3300009093 | Bacteria | 22328 |
| 121 | Ga0105240_10014853 | 3300009093 | Bacteria | 10615 |
| 122 | Ga0105240_10051181 | 3300009093 | Bacteria | 5200 |
| 123 | Ga0105240_10220554 | 3300009093 | Bacteria | 2210 |
| 124 | Ga0111539_10516037 | 3300009094 | Bacteria | 1392 |
| 125 | Ga0111539_10852069 | 3300009094 | Bacteria | 1060 |
| 126 | Ga0105245_10004081 | 3300009098 | Bacteria | 12962 |
| 127 | Ga0105245_10677907 | 3300009098 | Bacteria | 1063 |
| 128 | Ga0114129_10056554 | 3300009147 | Bacteria | 5494 |
| 129 | Ga0114129_10320688 | 3300009147 | Bacteria | 2060 |
| 130 | Ga0105243_10005218 | 3300009148 | Bacteria | 10164 |
| 131 | Ga0105241_10001143 | 3300009174 | Bacteria | 20210 |
| 132 | Ga0105241_10291522 | 3300009174 | Bacteria | 1397 |
| 133 | Ga0105248_10002357 | 3300009177 | Bacteria | 20976 |
| 134 | Ga0105237_10013591 | 3300009545 | Bacteria | 8530 |
| 135 | Ga0105237_10013913 | 3300009545 | Bacteria | 8420 |
| 136 | Ga0105237_10139454 | 3300009545 | Bacteria | 2419 |
| 137 | Ga0105238_10001355 | 3300009551 | Bacteria | 24579 |
| 138 | Ga0105238_10324779 | 3300009551 | Bacteria | 1525 |
| 139 | Ga0105238_10714401 | 3300009551 | Bacteria | 1015 |
| 140 | Ga0105238_11676367 | 3300009551 | Bacteria | 666 |
| 141 | Ga0105249_10004381 | 3300009553 | Bacteria | 12209 |
| 142 | Ga0105249_12186102 | 3300009553 | Bacteria | 626 |
| 143 | Ga0099796_10035473 | 3300010159 | Bacteria | 1655 |
| 144 | Ga0105239_10888805 | 3300010375 | Bacteria | 1022 |
| 145 | Ga0157373_11231908 | 3300013100 | Bacteria | 565 |
| 146 | Ga0157371_10013293 | 3300013102 | Bacteria | 6260 |
| 147 | Ga0157370_10000298 | 3300013104 | Bacteria | 62940 |
| 148 | Ga0157370_10419884 | 3300013104 | Bacteria | 1230 |
| 149 | Ga0157369_10007117 | 3300013105 | Bacteria | 12901 |
| 150 | Ga0157369_10014687 | 3300013105 | Bacteria | 8836 |
| 151 | Ga0157369_10105199 | 3300013105 | Bacteria | 3005 |
| 152 | Ga0157374_10856391 | 3300013296 | Bacteria | 926 |
| 153 | Ga0157374_11837372 | 3300013296 | Bacteria | 631 |
| 154 | Ga0157378_10023886 | 3300013297 | Bacteria | 5377 |
| 155 | Ga0163162_10014240 | 3300013306 | Bacteria | 7769 |
| 156 | Ga0163162_10851620 | 3300013306 | Bacteria | 1027 |
| 157 | Ga0157372_10004863 | 3300013307 | Bacteria | 14274 |
| 158 | Ga0157372_10286603 | 3300013307 | Bacteria | 1915 |
| 159 | Ga0157375_10262727 | 3300013308 | Bacteria | 1888 |
| 160 | Ga0157375_10296228 | 3300013308 | Bacteria | 1781 |
| 161 | Ga0163163_10006733 | 3300014325 | Bacteria | 10069 |
| 162 | Ga0163163_10007543 | 3300014325 | Bacteria | 9605 |
| 163 | Ga0182008_10102803 | 3300014497 | Bacteria | 1413 |
| 164 | Ga0157377_10011806 | 3300014745 | Bacteria | 4371 |
| 165 | Ga0157377_10318284 | 3300014745 | Bacteria | 1033 |
| 166 | Ga0157379_10035601 | 3300014968 | Bacteria | 4439 |
| 167 | Ga0157379_10221628 | 3300014968 | Bacteria | 1714 |
| 168 | Ga0157379_10273063 | 3300014968 | Bacteria | 1538 |
| 169 | Ga0157379_11899748 | 3300014968 | Bacteria | 587 |
| 170 | Ga0157376_10001343 | 3300014969 | Bacteria | 16214 |
| 171 | Ga0157376_10003346 | 3300014969 | Bacteria | 11026 |
| 172 | Ga0157376_10112123 | 3300014969 | Bacteria | 2402 |
| 173 | Ga0163161_10002609 | 3300017792 | Bacteria | 12840 |
| 174 | Ga0163161_10482983 | 3300017792 | Bacteria | 1006 |
| 175 | Ga0224712_10569934 | 3300022467 | Bacteria | 551 |
| 176 | Ga0209233_1003344 | 3300025261 | Bacteria | 5672 |
| 177 | Ga0207673_1006726 | 3300025290 | Bacteria | 1428 |
| 178 | Ga0207692_10775329 | 3300025898 | Bacteria | 626 |
| 179 | Ga0207688_10002165 | 3300025901 | Bacteria | 10566 |
| 180 | Ga0207680_10651060 | 3300025903 | Bacteria | 754 |
| 181 | Ga0207647_10002823 | 3300025904 | Bacteria | 13108 |
| 182 | Ga0207699_10011678 | 3300025906 | Bacteria | 4445 |
| 183 | Ga0207645_10011062 | 3300025907 | Bacteria | 6174 |
| 184 | Ga0207654_10357521 | 3300025911 | Bacteria | 1007 |
| 185 | Ga0207707_10000470 | 3300025912 | Bacteria | 41691 |
| 186 | Ga0207707_10006510 | 3300025912 | Bacteria | 10199 |
| 187 | Ga0207695_10001758 | 3300025913 | Bacteria | 34365 |
| 188 | Ga0207695_10216094 | 3300025913 | Bacteria | 1826 |
| 189 | Ga0207695_10240779 | 3300025913 | Bacteria | 1710 |
| 190 | Ga0207695_10332890 | 3300025913 | Bacteria | 1407 |
| 191 | Ga0207671_10009117 | 3300025914 | Bacteria | 8334 |
| 192 | Ga0207693_10002297 | 3300025915 | Bacteria | 16613 |
| 193 | Ga0207663_10000540 | 3300025916 | Bacteria | 16619 |
| 194 | Ga0207660_10003113 | 3300025917 | Bacteria | 10849 |
| 195 | Ga0207662_10350645 | 3300025918 | Bacteria | 991 |
| 196 | Ga0207657_10000793 | 3300025919 | Bacteria | 33507 |
| 197 | Ga0207649_10234455 | 3300025920 | Bacteria | 1314 |
| 198 | Ga0207652_10000795 | 3300025921 | Bacteria | 30149 |
| 199 | Ga0207652_10059616 | 3300025921 | Bacteria | 3290 |
| 200 | Ga0207652_10152593 | 3300025921 | Bacteria | 2069 |
| 201 | Ga0207681_10042900 | 3300025923 | Bacteria | 3024 |
| 202 | Ga0207659_10004929 | 3300025926 | Bacteria | 8088 |
| 203 | Ga0207659_10037091 | 3300025926 | Bacteria | 3382 |
| 204 | Ga0207659_10790317 | 3300025926 | Bacteria | 815 |
| 205 | Ga0207659_10908401 | 3300025926 | Bacteria | 757 |
| 206 | Ga0207687_10283531 | 3300025927 | Bacteria | 1329 |
| 207 | Ga0207700_10094858 | 3300025928 | Bacteria | 2365 |
| 208 | Ga0207700_10338597 | 3300025928 | Bacteria | 1307 |
| 209 | Ga0207644_10030866 | 3300025931 | Bacteria | 3730 |
| 210 | Ga0207644_10487582 | 3300025931 | Bacteria | 1016 |
| 211 | Ga0207690_10004925 | 3300025932 | Bacteria | 7878 |
| 212 | Ga0207690_11401937 | 3300025932 | Bacteria | 584 |
| 213 | Ga0207706_10000771 | 3300025933 | Bacteria | 33246 |
| 214 | Ga0207706_10859336 | 3300025933 | Bacteria | 768 |
| 215 | Ga0207686_10022152 | 3300025934 | Bacteria | 3656 |
| 216 | Ga0207709_10290244 | 3300025935 | Bacteria | 1212 |
| 217 | Ga0207670_10023798 | 3300025936 | Bacteria | 3817 |
| 218 | Ga0207669_10240558 | 3300025937 | Bacteria | 1341 |
| 219 | Ga0207704_10129485 | 3300025938 | Bacteria | 1744 |
| 220 | Ga0207665_10006767 | 3300025939 | Bacteria | 7594 |
| 221 | Ga0207691_10013656 | 3300025940 | Bacteria | 7760 |
| 222 | Ga0207691_10089984 | 3300025940 | Bacteria | 2752 |
| 223 | Ga0207711_10066762 | 3300025941 | Bacteria | 3111 |
| 224 | Ga0207689_10030996 | 3300025942 | Bacteria | 4455 |
| 225 | Ga0207689_10159023 | 3300025942 | Bacteria | 1862 |
| 226 | Ga0207679_10039243 | 3300025945 | Bacteria | 3380 |
| 227 | Ga0207679_10175159 | 3300025945 | Bacteria | 1770 |
| 228 | Ga0207679_11045919 | 3300025945 | Bacteria | 749 |
| 229 | Ga0207667_10006758 | 3300025949 | Bacteria | 13848 |
| 230 | Ga0207667_10178435 | 3300025949 | Bacteria | 2181 |
| 231 | Ga0207651_10002140 | 3300025960 | Bacteria | 9340 |
| 232 | Ga0207651_10014546 | 3300025960 | Bacteria | 4548 |
| 233 | Ga0207712_10012704 | 3300025961 | Bacteria | 5381 |
| 234 | Ga0207668_10109742 | 3300025972 | Bacteria | 2067 |
| 235 | Ga0207640_10317299 | 3300025981 | Bacteria | 1239 |
| 236 | Ga0207658_10019372 | 3300025986 | Bacteria | 4706 |
| 237 | Ga0207677_10007544 | 3300026023 | Bacteria | 6031 |
| 238 | Ga0207677_10116548 | 3300026023 | Bacteria | 2000 |
| 239 | Ga0207703_10009675 | 3300026035 | Bacteria | 7566 |
| 240 | Ga0207703_10050351 | 3300026035 | Bacteria | 3371 |
| 241 | Ga0207639_10124939 | 3300026041 | Bacteria | 2120 |
| 242 | Ga0207678_10001022 | 3300026067 | Bacteria | 25519 |
| 243 | Ga0207678_11226350 | 3300026067 | Bacteria | 664 |
| 244 | Ga0207708_10008196 | 3300026075 | Bacteria | 7742 |
| 245 | Ga0207702_10010968 | 3300026078 | Bacteria | 7560 |
| 246 | Ga0207702_10346541 | 3300026078 | Bacteria | 1420 |
| 247 | Ga0207641_10009356 | 3300026088 | Bacteria | 8082 |
| 248 | Ga0207648_10560526 | 3300026089 | Bacteria | 1050 |
| 249 | Ga0207676_10005096 | 3300026095 | Bacteria | 9300 |
| 250 | Ga0207676_10184361 | 3300026095 | Bacteria | 1830 |
| 251 | Ga0207674_10004073 | 3300026116 | Bacteria | 17710 |
| 252 | Ga0207675_100000706 | 3300026118 | Bacteria | 33090 |
| 253 | Ga0207683_10005141 | 3300026121 | Bacteria | 11234 |
| 254 | Ga0207683_10033494 | 3300026121 | Bacteria | 4462 |
| 255 | Ga0207683_11319486 | 3300026121 | Bacteria | 668 |
| 256 | Ga0207698_10130885 | 3300026142 | Bacteria | 2144 |
| 257 | Ga0207428_10052400 | 3300027907 | Bacteria | 3259 |
| 258 | Ga0268266_10137454 | 3300028379 | Bacteria | 2190 |
| 259 | Ga0268265_11619796 | 3300028380 | Bacteria | 652 |
| 260 | Ga0268264_11169520 | 3300028381 | Bacteria | 778 |
| 261 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 262 | Ga0307513_10083109 | 3300031456 | Bacteria | 3294 |
| 263 | Ga0307408_100178704 | 3300031548 | Bacteria | 1700 |
| 264 | Ga0307416_100554332 | 3300032002 | Bacteria | 1223 |
| 265 | Ga0307411_12333034 | 3300032005 | Bacteria | 503 |
| 266 | Ga0307415_100151202 | 3300032126 | Bacteria | 1787 |
| 267 | Ga0307507_10035394 | 3300033179 | Bacteria | 5131 |
| 268 | Ga0373950_0031733 | 3300034818 | Bacteria | 981 |
| 269 | Ga0373928_0009529 | 3300035084 | Bacteria | 1897 |
| 270 | Ga0373949_0020588 | 3300035090 | Bacteria | 1511 |
| 271 | Ga0373949_0153115 | 3300035090 | Bacteria | 668 |
| 272 | Ga0373952_0088765 | 3300035092 | Bacteria | 800 |
| 273 | Ga0373932_0160774 | 3300035112 | Bacteria | 777 |
| 274 | Ga0373939_0306191 | 3300035114 | Bacteria | 635 |
| 275 | Ga0373941_0120594 | 3300035115 | Bacteria | 934 |
| 276 | Ga0373961_0033944 | 3300035241 | Bacteria | 1440 |
| 277 | Ga0373961_0177659 | 3300035241 | Bacteria | 740 |
| 278 | Ga0373931_0002027 | 3300035691 | Bacteria | 8918 |
| 279 | Ga0395905_1360146 | 3300037471 | Bacteria | 614 |
| 280 | Ga0436365_0614938 | 3300039437 | Bacteria | 4152 |
| 281 | Ga0439439_0262283 | 3300041406 | Bacteria | 514 |
| 282 | Ga0451804_0905642 | 3300041463 | Bacteria | 887 |
| 283 | Ga0439431_0059738 | 3300041997 | Bacteria | 1001 |
| 284 | Ga0439445_0086199 | 3300042004 | Bacteria | 881 |
| 285 | Ga0439449_0005070 | 3300042007 | Bacteria | 5065 |
| 286 | Ga0439450_050995 | 3300042008 | Bacteria | 983 |
| 287 | Ga0439455_0052363 | 3300042012 | Bacteria | 1069 |
| 288 | Ga0439464_0019506 | 3300042439 | Bacteria | 1851 |
| 289 | Ga0439460_0020276 | 3300042461 | Bacteria | 1807 |
| 290 | Ga0439460_0034897 | 3300042461 | Bacteria | 1452 |
| 291 | Ga0439440_0025663 | 3300042993 | Bacteria | 1359 |
| 292 | Ga0453683_0673825 | 3300044673 | Bacteria | 677 |
| 293 | Ga0466963_0222452 | 3300044694 | Bacteria | 1322 |
| 294 | Ga0466957_0327202 | 3300044842 | Bacteria | 1035 |
| 295 | Ga0466959_0181852 | 3300045049 | Bacteria | 1470 |
| 296 | Ga0466958_0175508 | 3300045836 | Bacteria | 1358 |
| 297 | Ga0495603_0000540 | 3300046455 | Bacteria | 21072 |
| 298 | Ga0495591_001016 | 3300046458 | Bacteria | 18989 |
| 299 | Ga0495629_0001758 | 3300046459 | Bacteria | 16997 |
| 300 | Ga0495650_0000819 | 3300046471 | Bacteria | 37873 |
| 301 | Ga0495580_0004007 | 3300046472 | Bacteria | 12434 |
| 302 | Ga0495582_0063478 | 3300046473 | Bacteria | 2040 |
| 303 | Ga0495605_0406662 | 3300046474 | Bacteria | 565 |
| 304 | Ga0495662_0037765 | 3300046476 | Bacteria | 2333 |
| 305 | Ga0495594_0236862 | 3300046499 | Bacteria | 1040 |
| 306 | Ga0495606_0003946 | 3300046507 | Bacteria | 15249 |
| 307 | Ga0495608_0193102 | 3300046511 | Bacteria | 1285 |
| 308 | Ga0495642_0003166 | 3300046528 | Bacteria | 6527 |
| 309 | Ga0495652_0163567 | 3300046529 | Bacteria | 1725 |
| 310 | Ga0495654_0081606 | 3300046530 | Bacteria | 1515 |
| 311 | Ga0495665_0004612 | 3300046531 | Bacteria | 7434 |
| 312 | Ga0495586_0028175 | 3300046535 | Bacteria | 3007 |
| 313 | Ga0495645_0000309 | 3300046543 | Bacteria | 35183 |
| 314 | Ga0495667_0055184 | 3300046559 | Bacteria | 2613 |
| 315 | Ga0495656_0386804 | 3300046615 | Bacteria | 730 |
| 316 | Ga0495588_0103217 | 3300046674 | Bacteria | 1499 |
| 317 | Ga0495623_0317607 | 3300046679 | Bacteria | 856 |
| 318 | Ga0495646_0152682 | 3300046680 | Bacteria | 1283 |
| 319 | Ga0495669_0269733 | 3300046684 | Bacteria | 818 |
| 320 | Ga0495669_0489146 | 3300046684 | Bacteria | 598 |
| 321 | Ga0495613_0066649 | 3300046689 | Bacteria | 2629 |
| 322 | Ga0495624_0682530 | 3300046690 | Bacteria | 610 |
| 323 | Ga0495670_0097625 | 3300046691 | Bacteria | 1510 |
| 324 | Ga0495649_0417477 | 3300046694 | Bacteria | 672 |
| 325 | Ga0495589_0065661 | 3300046794 | Bacteria | 1778 |
| 326 | Ga0495600_0134507 | 3300046809 | Bacteria | 1606 |
| 327 | Ga0495581_0008637 | 3300047315 | Bacteria | 5900 |
| 328 | Ga0495672_0116593 | 3300047320 | Bacteria | 1426 |
| 329 | Ga0495680_0055815 | 3300047322 | Bacteria | 3062 |
| 330 | Ga0495687_009200 | 3300047443 | Bacteria | 5555 |
| 331 | Ga0495675_0043300 | 3300047444 | Bacteria | 2868 |
| 332 | Ga0495681_0040686 | 3300047470 | Bacteria | 2262 |
| 333 | Ga0495593_0409261 | 3300047673 | Bacteria | 678 |
| 334 | Ga0495614_0041485 | 3300048089 | Bacteria | 1974 |
| 335 | Ga0496100_0079217 | 3300048903 | Bacteria | 2213 |
| 336 | Ga0496101_0007137 | 3300048904 | Bacteria | 7224 |
| 337 | Ga0496101_0189805 | 3300048904 | Bacteria | 1585 |
| 338 | Ga0496101_0279223 | 3300048904 | Bacteria | 1305 |
| 339 | Ga0496102_0238066 | 3300048905 | Bacteria | 1717 |
| 340 | Ga0496102_0803195 | 3300048905 | Bacteria | 863 |
| 341 | Ga0496102_1006287 | 3300048905 | Bacteria | 754 |
| 342 | Ga0496102_1358826 | 3300048905 | Bacteria | 629 |
| 343 | Ga0496104_0853499 | 3300048907 | Bacteria | 816 |
| 344 | Ga0496106_0045535 | 3300048909 | Bacteria | 3295 |
| 345 | Ga0496107_0024805 | 3300048910 | Bacteria | 4243 |
| 346 | Ga0496107_1220416 | 3300048910 | Bacteria | 540 |
| 347 | Ga0496108_0118107 | 3300048911 | Bacteria | 2273 |
| 348 | Ga0496108_0389757 | 3300048911 | Bacteria | 1216 |
| 349 | Ga0496108_0996507 | 3300048911 | Bacteria | 716 |
| 350 | Ga0496109_1037054 | 3300048912 | Bacteria | 757 |
| 351 | Ga0496109_1081907 | 3300048912 | Bacteria | 739 |
| 352 | Ga0496110_0312727 | 3300048913 | Bacteria | 1430 |
| 353 | Ga0496110_1494065 | 3300048913 | Bacteria | 585 |
| 354 | Ga0496110_1665677 | 3300048913 | Bacteria | 548 |
| 355 | Ga0496111_0153663 | 3300048914 | Bacteria | 1707 |
| 356 | Ga0496112_0025435 | 3300048915 | Bacteria | 5684 |
| 357 | Ga0496113_0101298 | 3300048916 | Bacteria | 2232 |
| 358 | Ga0496114_0003644 | 3300048917 | Bacteria | 11845 |
| 359 | Ga0496114_0021087 | 3300048917 | Bacteria | 5296 |
| 360 | Ga0496115_0024293 | 3300048918 | Bacteria | 4709 |
| 361 | Ga0496115_0147147 | 3300048918 | Bacteria | 1944 |
| 362 | Ga0496121_0038130 | 3300048924 | Bacteria | 4261 |
| 363 | Ga0496124_0036169 | 3300048927 | Bacteria | 4311 |
| 364 | Ga0496126_0459322 | 3300048929 | Bacteria | 1024 |
| 365 | Ga0501039_0812289 | 3300049575 | Bacteria | 729 |
| 366 | Ga0501041_0164231 | 3300049577 | Bacteria | 1389 |
| 367 | Ga0501041_0270572 | 3300049577 | Bacteria | 1069 |
| 368 | Ga0501047_0094721 | 3300049581 | Bacteria | 2865 |
| 369 | Ga0501072_0932268 | 3300049588 | Bacteria | 678 |
| 370 | Ga0501072_0947755 | 3300049588 | Bacteria | 672 |
| 371 | Ga0501249_138283 | 3300049679 | Bacteria | 605 |
| 372 | Ga0501083_0002831 | 3300049744 | Bacteria | 11986 |
| 373 | nmdc:mga00v17_153017_c1 | 3300050491 | Bacteria | 1482 |
| 374 | nmdc:mga06z11_325755_c1 | 3300050494 | Bacteria | 917 |
| 375 | nmdc:mga05p37_443220_c1 | 3300050507 | Bacteria | 1505 |
| 376 | nmdc:mga09592_138150_c1 | 3300050508 | Bacteria | 2100 |
| 377 | nmdc:mga09592_54371_c1 | 3300050508 | Bacteria | 3382 |
| 378 | nmdc:mga0qj67_48870_c1 | 3300050509 | Bacteria | 3343 |
| 379 | nmdc:mga06r32_109024_c1 | 3300050510 | Bacteria | 2723 |
| 380 | nmdc:mga06r32_521482_c1 | 3300050510 | Bacteria | 1164 |
| 381 | nmdc:mga06r32_85416_c1 | 3300050510 | Bacteria | 3077 |
| 382 | nmdc:mga08y16_312081_c1 | 3300050511 | Bacteria | 1620 |
| 383 | nmdc:mga0a205_5596_c1 | 3300050515 | Bacteria | 11322 |
| 384 | Ga0500583_0200318 | 3300053092 | Bacteria | 992 |
| 385 | Ga0500641_0003285 | 3300053096 | Bacteria | 5717 |
| 386 | Ga0500658_0096283 | 3300053134 | Bacteria | 1286 |
| 387 | Ga0500588_0002343 | 3300053146 | Bacteria | 3833 |
| 388 | Ga0500656_014293 | 3300053732 | Bacteria | 918 |
| 389 | Ga0501082_0005125 | 3300060353 | Bacteria | 11405 |
| 390 | Ga0501082_1760359 | 3300060353 | Bacteria | 540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026121 | Ga0207683_11319486 | Ga0207683_113194861 | 126 |
| 2 | 3300047320 | Ga0495672_0116593 | Ga0495672_0116593_971_1360 | 129 |
| 3 | iso_pu_bacteria | 2885192300 | 2885196279 | 131 |
| 4 | 3300041406 | Ga0439439_0262283 | Ga0439439_0262283_59_457 | 132 |
| 5 | 3300042007 | Ga0439449_0005070 | Ga0439449_0005070_3462_3860 | 132 |
| 6 | 3300007265 | Ga0099794_10232377 | Ga0099794_102323771 | 133 |
| 7 | 3300013100 | Ga0157373_11231908 | Ga0157373_112319082 | 133 |
| 8 | 3300046529 | Ga0495652_0163567 | Ga0495652_0163567_402_803 | 133 |
| 9 | 3300009545 | Ga0105237_10013913 | Ga0105237_100139136 | 134 |
| 10 | 3300014968 | Ga0157379_10035601 | Ga0157379_100356015 | 134 |
| 11 | 3300046684 | Ga0495669_0269733 | Ga0495669_0269733_206_610 | 134 |
| 12 | 3300046694 | Ga0495649_0417477 | Ga0495649_0417477_155_559 | 134 |
| 13 | 3300047443 | Ga0495687_009200 | Ga0495687_009200_4473_4877 | 134 |
| 14 | 3300048929 | Ga0496126_0459322 | Ga0496126_0459322_584_988 | 134 |
| 15 | 3300049575 | Ga0501039_0812289 | Ga0501039_0812289_47_451 | 134 |
| 16 | 3300028794 | Ga0307515_10000028 | Ga0307515_1000002813 | 135 |
| 17 | 3300031456 | Ga0307513_10083109 | Ga0307513_100831093 | 135 |
| 18 | 3300041997 | Ga0439431_0059738 | Ga0439431_0059738_570_980 | 135 |
| 19 | 3300042004 | Ga0439445_0086199 | Ga0439445_0086199_85_495 | 135 |
| 20 | 3300049581 | Ga0501047_0094721 | Ga0501047_0094721_1588_1995 | 135 |
| 21 | 3300049588 | Ga0501072_0932268 | Ga0501072_0932268_230_637 | 135 |
| 22 | 3300049744 | Ga0501083_0002831 | Ga0501083_0002831_676_1083 | 135 |
| 23 | 3300060353 | Ga0501082_0005125 | Ga0501082_0005125_84_491 | 135 |
| 24 | 3300060353 | Ga0501082_1760359 | Ga0501082_1760359_55_462 | 135 |
| 25 | 3300009551 | Ga0105238_11676367 | Ga0105238_116763671 | 136 |
| 26 | 3300033179 | Ga0307507_10035394 | Ga0307507_100353942 | 136 |
| 27 | 3300039437 | Ga0436365_0614938 | Ga0436365_0614938_2239_2652 | 136 |
| 28 | 3300041463 | Ga0451804_0905642 | Ga0451804_0905642_160_573 | 136 |
| 29 | 3300042461 | Ga0439460_0020276 | Ga0439460_0020276_1064_1477 | 136 |
| 30 | 3300046455 | Ga0495603_0000540 | Ga0495603_0000540_7832_8242 | 136 |
| 31 | 3300046458 | Ga0495591_001016 | Ga0495591_001016_15135_15548 | 136 |
| 32 | 3300046459 | Ga0495629_0001758 | Ga0495629_0001758_10512_10922 | 136 |
| 33 | 3300046471 | Ga0495650_0000819 | Ga0495650_0000819_29282_29692 | 136 |
| 34 | 3300046472 | Ga0495580_0004007 | Ga0495580_0004007_3744_4154 | 136 |
| 35 | 3300046473 | Ga0495582_0063478 | Ga0495582_0063478_253_663 | 136 |
| 36 | 3300046474 | Ga0495605_0406662 | Ga0495605_0406662_81_491 | 136 |
| 37 | 3300046476 | Ga0495662_0037765 | Ga0495662_0037765_261_671 | 136 |
| 38 | 3300046499 | Ga0495594_0236862 | Ga0495594_0236862_312_722 | 136 |
| 39 | 3300046511 | Ga0495608_0193102 | Ga0495608_0193102_741_1151 | 136 |
| 40 | 3300046528 | Ga0495642_0003166 | Ga0495642_0003166_1250_1660 | 136 |
| 41 | 3300046530 | Ga0495654_0081606 | Ga0495654_0081606_927_1337 | 136 |
| 42 | 3300046531 | Ga0495665_0004612 | Ga0495665_0004612_1415_1825 | 136 |
| 43 | 3300046535 | Ga0495586_0028175 | Ga0495586_0028175_2046_2456 | 136 |
| 44 | 3300046543 | Ga0495645_0000309 | Ga0495645_0000309_15767_16177 | 136 |
| 45 | 3300046559 | Ga0495667_0055184 | Ga0495667_0055184_2165_2575 | 136 |
| 46 | 3300046615 | Ga0495656_0386804 | Ga0495656_0386804_196_606 | 136 |
| 47 | 3300046674 | Ga0495588_0103217 | Ga0495588_0103217_873_1283 | 136 |
| 48 | 3300046679 | Ga0495623_0317607 | Ga0495623_0317607_370_780 | 136 |
| 49 | 3300046680 | Ga0495646_0152682 | Ga0495646_0152682_314_724 | 136 |
| 50 | 3300046689 | Ga0495613_0066649 | Ga0495613_0066649_1299_1709 | 136 |
| 51 | 3300046690 | Ga0495624_0682530 | Ga0495624_0682530_70_480 | 136 |
| 52 | 3300046691 | Ga0495670_0097625 | Ga0495670_0097625_125_535 | 136 |
| 53 | 3300046794 | Ga0495589_0065661 | Ga0495589_0065661_1322_1732 | 136 |
| 54 | 3300046809 | Ga0495600_0134507 | Ga0495600_0134507_187_597 | 136 |
| 55 | 3300047315 | Ga0495581_0008637 | Ga0495581_0008637_4220_4630 | 136 |
| 56 | 3300047322 | Ga0495680_0055815 | Ga0495680_0055815_1408_1818 | 136 |
| 57 | 3300047444 | Ga0495675_0043300 | Ga0495675_0043300_1673_2083 | 136 |
| 58 | 3300047470 | Ga0495681_0040686 | Ga0495681_0040686_63_473 | 136 |
| 59 | 3300047673 | Ga0495593_0409261 | Ga0495593_0409261_186_596 | 136 |
| 60 | 3300048089 | Ga0495614_0041485 | Ga0495614_0041485_497_907 | 136 |
| 61 | 3300048903 | Ga0496100_0079217 | Ga0496100_0079217_1170_1580 | 136 |
| 62 | 3300048904 | Ga0496101_0189805 | Ga0496101_0189805_516_926 | 136 |
| 63 | 3300048905 | Ga0496102_0238066 | Ga0496102_0238066_239_652 | 136 |
| 64 | 3300048911 | Ga0496108_0118107 | Ga0496108_0118107_1421_1831 | 136 |
| 65 | 3300048913 | Ga0496110_1665677 | Ga0496110_1665677_119_532 | 136 |
| 66 | 3300048917 | Ga0496114_0003644 | Ga0496114_0003644_2638_3048 | 136 |
| 67 | 3300048918 | Ga0496115_0024293 | Ga0496115_0024293_2185_2595 | 136 |
| 68 | 3300048924 | Ga0496121_0038130 | Ga0496121_0038130_3035_3448 | 136 |
| 69 | 3300048927 | Ga0496124_0036169 | Ga0496124_0036169_3150_3563 | 136 |
| 70 | iso_pu_bacteria | 2929160207 | 2929162008 | 136 |
| 71 | 3300009551 | Ga0105238_10714401 | Ga0105238_107144011 | 137 |
| 72 | 3300013296 | Ga0157374_10856391 | Ga0157374_108563912 | 137 |
| 73 | 3300013306 | Ga0163162_10014240 | Ga0163162_100142401 | 137 |
| 74 | 3300014325 | Ga0163163_10007543 | Ga0163163_100075435 | 137 |
| 75 | 3300014745 | Ga0157377_10318284 | Ga0157377_103182842 | 137 |
| 76 | 3300025898 | Ga0207692_10775329 | Ga0207692_107753291 | 137 |
| 77 | 3300044694 | Ga0466963_0222452 | Ga0466963_0222452_618_1031 | 137 |
| 78 | 3300044842 | Ga0466957_0327202 | Ga0466957_0327202_366_779 | 137 |
| 79 | 3300045049 | Ga0466959_0181852 | Ga0466959_0181852_889_1302 | 137 |
| 80 | 3300045836 | Ga0466958_0175508 | Ga0466958_0175508_282_695 | 137 |
| 81 | 3300005436 | Ga0070713_100550927 | Ga0070713_1005509271 | 138 |
| 82 | 3300005458 | Ga0070681_10077911 | Ga0070681_100779113 | 138 |
| 83 | 3300006051 | Ga0075364_10698491 | Ga0075364_106984912 | 138 |
| 84 | 3300006178 | Ga0075367_10344652 | Ga0075367_103446522 | 138 |
| 85 | 3300009093 | Ga0105240_10051181 | Ga0105240_100511814 | 138 |
| 86 | 3300009174 | Ga0105241_10291522 | Ga0105241_102915223 | 138 |
| 87 | 3300009545 | Ga0105237_10139454 | Ga0105237_101394544 | 138 |
| 88 | 3300009551 | Ga0105238_10001355 | Ga0105238_100013559 | 138 |
| 89 | 3300009551 | Ga0105238_10324779 | Ga0105238_103247792 | 138 |
| 90 | 3300013104 | Ga0157370_10000298 | Ga0157370_1000029825 | 138 |
| 91 | 3300013104 | Ga0157370_10419884 | Ga0157370_104198842 | 138 |
| 92 | 3300013105 | Ga0157369_10105199 | Ga0157369_101051992 | 138 |
| 93 | 3300013307 | Ga0157372_10286603 | Ga0157372_102866033 | 138 |
| 94 | 3300013308 | Ga0157375_10296228 | Ga0157375_102962283 | 138 |
| 95 | 3300014969 | Ga0157376_10003346 | Ga0157376_100033464 | 138 |
| 96 | 3300025928 | Ga0207700_10338597 | Ga0207700_103385972 | 138 |
| 97 | 3300035115 | Ga0373941_0120594 | Ga0373941_0120594_199_618 | 138 |
| 98 | 3300037471 | Ga0395905_1360146 | Ga0395905_1360146_97_516 | 138 |
| 99 | 3300042461 | Ga0439460_0034897 | Ga0439460_0034897_200_625 | 138 |
| 100 | 3300046684 | Ga0495669_0489146 | Ga0495669_0489146_66_485 | 138 |
| 101 | 3300048904 | Ga0496101_0279223 | Ga0496101_0279223_476_895 | 138 |
| 102 | 3300048905 | Ga0496102_0803195 | Ga0496102_0803195_379_798 | 138 |
| 103 | 3300048909 | Ga0496106_0045535 | Ga0496106_0045535_291_710 | 138 |
| 104 | 3300048912 | Ga0496109_1081907 | Ga0496109_1081907_107_526 | 138 |
| 105 | 3300048913 | Ga0496110_1494065 | Ga0496110_1494065_33_449 | 138 |
| 106 | 3300050491 | nmdc:mga00v17_153017_c1 | nmdc:mga00v17_153017_c1_40_456 | 138 |
| 107 | 3300050494 | nmdc:mga06z11_325755_c1 | nmdc:mga06z11_325755_c1_336_752 | 138 |
| 108 | 3300050507 | nmdc:mga05p37_443220_c1 | nmdc:mga05p37_443220_c1_702_1118 | 138 |
| 109 | 3300050508 | nmdc:mga09592_138150_c1 | nmdc:mga09592_138150_c1_697_1113 | 138 |
| 110 | 3300050509 | nmdc:mga0qj67_48870_c1 | nmdc:mga0qj67_48870_c1_1899_2318 | 138 |
| 111 | 3300050510 | nmdc:mga06r32_521482_c1 | nmdc:mga06r32_521482_c1_27_443 | 138 |
| 112 | 3300050510 | nmdc:mga06r32_85416_c1 | nmdc:mga06r32_85416_c1_2591_3007 | 138 |
| 113 | 3300053092 | Ga0500583_0200318 | Ga0500583_0200318_125_544 | 138 |
| 114 | 3300005330 | Ga0070690_100342641 | Ga0070690_1003426412 | 139 |
| 115 | 3300014497 | Ga0182008_10102803 | Ga0182008_101028032 | 139 |
| 116 | 3300014968 | Ga0157379_11899748 | Ga0157379_118997481 | 139 |
| 117 | 3300048905 | Ga0496102_1006287 | Ga0496102_1006287_90_515 | 139 |
| 118 | 3300048910 | Ga0496107_1220416 | Ga0496107_1220416_42_467 | 139 |
| 119 | 3300049577 | Ga0501041_0164231 | Ga0501041_0164231_253_672 | 139 |
| 120 | 3300005330 | Ga0070690_100003208 | Ga0070690_1000032085 | 140 |
| 121 | 3300005333 | Ga0070677_10021235 | Ga0070677_100212351 | 140 |
| 122 | 3300005334 | Ga0068869_100043947 | Ga0068869_1000439473 | 140 |
| 123 | 3300005338 | Ga0068868_100077813 | Ga0068868_1000778132 | 140 |
| 124 | 3300005340 | Ga0070689_100012584 | Ga0070689_1000125844 | 140 |
| 125 | 3300005343 | Ga0070687_100331583 | Ga0070687_1003315832 | 140 |
| 126 | 3300005354 | Ga0070675_100002384 | Ga0070675_1000023844 | 140 |
| 127 | 3300005355 | Ga0070671_100004504 | Ga0070671_1000045043 | 140 |
| 128 | 3300005356 | Ga0070674_100309948 | Ga0070674_1003099481 | 140 |
| 129 | 3300005364 | Ga0070673_100007250 | Ga0070673_1000072506 | 140 |
| 130 | 3300005366 | Ga0070659_100432034 | Ga0070659_1004320342 | 140 |
| 131 | 3300005367 | Ga0070667_100104221 | Ga0070667_1001042213 | 140 |
| 132 | 3300005459 | Ga0068867_100503295 | Ga0068867_1005032952 | 140 |
| 133 | 3300005466 | Ga0070685_10100485 | Ga0070685_101004853 | 140 |
| 134 | 3300005535 | Ga0070684_100342168 | Ga0070684_1003421681 | 140 |
| 135 | 3300005543 | Ga0070672_100214399 | Ga0070672_1002143993 | 140 |
| 136 | 3300005616 | Ga0068852_100120530 | Ga0068852_1001205302 | 140 |
| 137 | 3300005617 | Ga0068859_100015690 | Ga0068859_1000156905 | 140 |
| 138 | 3300005618 | Ga0068864_100005692 | Ga0068864_1000056928 | 140 |
| 139 | 3300005842 | Ga0068858_100006919 | Ga0068858_1000069198 | 140 |
| 140 | 3300005843 | Ga0068860_100186032 | Ga0068860_1001860322 | 140 |
| 141 | 3300006237 | Ga0097621_100076934 | Ga0097621_1000769345 | 140 |
| 142 | 3300006237 | Ga0097621_100731957 | Ga0097621_1007319572 | 140 |
| 143 | 3300006931 | Ga0097620_100015690 | Ga0097620_1000156905 | 140 |
| 144 | 3300009098 | Ga0105245_10677907 | Ga0105245_106779072 | 140 |
| 145 | 3300014968 | Ga0157379_10221628 | Ga0157379_102216283 | 140 |
| 146 | 3300014969 | Ga0157376_10112123 | Ga0157376_101121233 | 140 |
| 147 | 3300017792 | Ga0163161_10482983 | Ga0163161_104829832 | 140 |
| 148 | 3300025290 | Ga0207673_1006726 | Ga0207673_10067262 | 140 |
| 149 | 3300025903 | Ga0207680_10651060 | Ga0207680_106510602 | 140 |
| 150 | 3300025926 | Ga0207659_10004929 | Ga0207659_100049293 | 140 |
| 151 | 3300025932 | Ga0207690_11401937 | Ga0207690_114019371 | 140 |
| 152 | 3300025933 | Ga0207706_10859336 | Ga0207706_108593362 | 140 |
| 153 | 3300025936 | Ga0207670_10023798 | Ga0207670_100237983 | 140 |
| 154 | 3300025940 | Ga0207691_10089984 | Ga0207691_100899843 | 140 |
| 155 | 3300025942 | Ga0207689_10030996 | Ga0207689_100309963 | 140 |
| 156 | 3300025960 | Ga0207651_10014546 | Ga0207651_100145464 | 140 |
| 157 | 3300026023 | Ga0207677_10007544 | Ga0207677_100075445 | 140 |
| 158 | 3300026035 | Ga0207703_10009675 | Ga0207703_100096755 | 140 |
| 159 | 3300026088 | Ga0207641_10009356 | Ga0207641_100093564 | 140 |
| 160 | 3300026089 | Ga0207648_10560526 | Ga0207648_105605262 | 140 |
| 161 | 3300026095 | Ga0207676_10005096 | Ga0207676_100050962 | 140 |
| 162 | 3300026121 | Ga0207683_10033494 | Ga0207683_100334944 | 140 |
| 163 | 3300026142 | Ga0207698_10130885 | Ga0207698_101308853 | 140 |
| 164 | 3300028381 | Ga0268264_11169520 | Ga0268264_111695202 | 140 |
| 165 | 3300032002 | Ga0307416_100554332 | Ga0307416_1005543322 | 140 |
| 166 | 3300032126 | Ga0307415_100151202 | Ga0307415_1001512022 | 140 |
| 167 | 3300048911 | Ga0496108_0996507 | Ga0496108_0996507_40_468 | 140 |
| 168 | 3300053096 | Ga0500641_0003285 | Ga0500641_0003285_542_1024 | 140 |
| 169 | 3300001977 | JGI24746J21847_1042978 | JGI24746J21847_10429782 | 141 |
| 170 | 3300002075 | JGI24738J21930_10023665 | JGI24738J21930_100236653 | 141 |
| 171 | 3300002459 | JGI24751J29686_10029448 | JGI24751J29686_100294482 | 141 |
| 172 | 3300003214 | JGI25165J46597_1042313 | JGI25165J46597_10423131 | 141 |
| 173 | 3300005293 | Ga0065715_10384517 | Ga0065715_103845171 | 141 |
| 174 | 3300005327 | Ga0070658_10126911 | Ga0070658_101269113 | 141 |
| 175 | 3300005328 | Ga0070676_10011459 | Ga0070676_100114593 | 141 |
| 176 | 3300005328 | Ga0070676_10151766 | Ga0070676_101517663 | 141 |
| 177 | 3300005329 | Ga0070683_100175726 | Ga0070683_1001757262 | 141 |
| 178 | 3300005330 | Ga0070690_100000828 | Ga0070690_1000008283 | 141 |
| 179 | 3300005331 | Ga0070670_100009649 | Ga0070670_10000964911 | 141 |
| 180 | 3300005331 | Ga0070670_101520238 | Ga0070670_1015202381 | 141 |
| 181 | 3300005334 | Ga0068869_100058766 | Ga0068869_1000587662 | 141 |
| 182 | 3300005335 | Ga0070666_10003149 | Ga0070666_100031499 | 141 |
| 183 | 3300005336 | Ga0070680_100011329 | Ga0070680_1000113297 | 141 |
| 184 | 3300005337 | Ga0070682_100007406 | Ga0070682_1000074068 | 141 |
| 185 | 3300005340 | Ga0070689_100002488 | Ga0070689_10000248810 | 141 |
| 186 | 3300005341 | Ga0070691_10000310 | Ga0070691_1000031019 | 141 |
| 187 | 3300005343 | Ga0070687_100377090 | Ga0070687_1003770902 | 141 |
| 188 | 3300005344 | Ga0070661_100001241 | Ga0070661_10000124120 | 141 |
| 189 | 3300005345 | Ga0070692_10000736 | Ga0070692_100007363 | 141 |
| 190 | 3300005347 | Ga0070668_100000234 | Ga0070668_10000023416 | 141 |
| 191 | 3300005353 | Ga0070669_100203262 | Ga0070669_1002032621 | 141 |
| 192 | 3300005354 | Ga0070675_100009972 | Ga0070675_1000099726 | 141 |
| 193 | 3300005354 | Ga0070675_101027452 | Ga0070675_1010274521 | 141 |
| 194 | 3300005355 | Ga0070671_100025325 | Ga0070671_1000253252 | 141 |
| 195 | 3300005356 | Ga0070674_100001018 | Ga0070674_10000101811 | 141 |
| 196 | 3300005364 | Ga0070673_100000403 | Ga0070673_10000040310 | 141 |
| 197 | 3300005365 | Ga0070688_100009268 | Ga0070688_1000092688 | 141 |
| 198 | 3300005366 | Ga0070659_100024047 | Ga0070659_1000240472 | 141 |
| 199 | 3300005367 | Ga0070667_100003240 | Ga0070667_1000032402 | 141 |
| 200 | 3300005434 | Ga0070709_10011069 | Ga0070709_100110696 | 141 |
| 201 | 3300005435 | Ga0070714_100022290 | Ga0070714_1000222906 | 141 |
| 202 | 3300005436 | Ga0070713_100063928 | Ga0070713_1000639285 | 141 |
| 203 | 3300005437 | Ga0070710_10008768 | Ga0070710_100087681 | 141 |
| 204 | 3300005438 | Ga0070701_10058240 | Ga0070701_100582401 | 141 |
| 205 | 3300005439 | Ga0070711_100010291 | Ga0070711_1000102912 | 141 |
| 206 | 3300005440 | Ga0070705_100001109 | Ga0070705_10000110916 | 141 |
| 207 | 3300005441 | Ga0070700_100000966 | Ga0070700_1000009668 | 141 |
| 208 | 3300005444 | Ga0070694_100006898 | Ga0070694_1000068987 | 141 |
| 209 | 3300005455 | Ga0070663_100163610 | Ga0070663_1001636102 | 141 |
| 210 | 3300005456 | Ga0070678_100042334 | Ga0070678_1000423342 | 141 |
| 211 | 3300005457 | Ga0070662_100828174 | Ga0070662_1008281741 | 141 |
| 212 | 3300005458 | Ga0070681_10020522 | Ga0070681_100205222 | 141 |
| 213 | 3300005466 | Ga0070685_10024005 | Ga0070685_100240052 | 141 |
| 214 | 3300005530 | Ga0070679_100001877 | Ga0070679_1000018779 | 141 |
| 215 | 3300005530 | Ga0070679_100233313 | Ga0070679_1002333132 | 141 |
| 216 | 3300005530 | Ga0070679_100257295 | Ga0070679_1002572952 | 141 |
| 217 | 3300005530 | Ga0070679_100622933 | Ga0070679_1006229331 | 141 |
| 218 | 3300005535 | Ga0070684_100391570 | Ga0070684_1003915702 | 141 |
| 219 | 3300005536 | Ga0070697_100014153 | Ga0070697_1000141538 | 141 |
| 220 | 3300005539 | Ga0068853_100002553 | Ga0068853_1000025532 | 141 |
| 221 | 3300005539 | Ga0068853_100613020 | Ga0068853_1006130202 | 141 |
| 222 | 3300005543 | Ga0070672_100006711 | Ga0070672_1000067116 | 141 |
| 223 | 3300005544 | Ga0070686_100001906 | Ga0070686_1000019062 | 141 |
| 224 | 3300005545 | Ga0070695_100001397 | Ga0070695_1000013972 | 141 |
| 225 | 3300005545 | Ga0070695_100049326 | Ga0070695_1000493262 | 141 |
| 226 | 3300005546 | Ga0070696_100002930 | Ga0070696_10000293012 | 141 |
| 227 | 3300005548 | Ga0070665_100010067 | Ga0070665_10001006713 | 141 |
| 228 | 3300005549 | Ga0070704_100001520 | Ga0070704_10000152012 | 141 |
| 229 | 3300005563 | Ga0068855_100003598 | Ga0068855_10000359810 | 141 |
| 230 | 3300005563 | Ga0068855_100006487 | Ga0068855_10000648712 | 141 |
| 231 | 3300005563 | Ga0068855_100303815 | Ga0068855_1003038155 | 141 |
| 232 | 3300005564 | Ga0070664_100002217 | Ga0070664_1000022179 | 141 |
| 233 | 3300005577 | Ga0068857_100193128 | Ga0068857_1001931282 | 141 |
| 234 | 3300005578 | Ga0068854_100006266 | Ga0068854_1000062664 | 141 |
| 235 | 3300005614 | Ga0068856_100007771 | Ga0068856_1000077716 | 141 |
| 236 | 3300005614 | Ga0068856_100258744 | Ga0068856_1002587441 | 141 |
| 237 | 3300005615 | Ga0070702_100001629 | Ga0070702_1000016295 | 141 |
| 238 | 3300005616 | Ga0068852_100036803 | Ga0068852_1000368036 | 141 |
| 239 | 3300005617 | Ga0068859_100939207 | Ga0068859_1009392072 | 141 |
| 240 | 3300005618 | Ga0068864_100006229 | Ga0068864_1000062292 | 141 |
| 241 | 3300005719 | Ga0068861_100001266 | Ga0068861_10000126612 | 141 |
| 242 | 3300005840 | Ga0068870_10247951 | Ga0068870_102479512 | 141 |
| 243 | 3300005841 | Ga0068863_100001254 | Ga0068863_10000125428 | 141 |
| 244 | 3300005842 | Ga0068858_100005485 | Ga0068858_1000054852 | 141 |
| 245 | 3300005843 | Ga0068860_100011677 | Ga0068860_1000116776 | 141 |
| 246 | 3300006163 | Ga0070715_10003841 | Ga0070715_100038411 | 141 |
| 247 | 3300006173 | Ga0070716_100002741 | Ga0070716_1000027412 | 141 |
| 248 | 3300006175 | Ga0070712_100016557 | Ga0070712_1000165572 | 141 |
| 249 | 3300006844 | Ga0075428_100018307 | Ga0075428_10001830710 | 141 |
| 250 | 3300006846 | Ga0075430_100074137 | Ga0075430_1000741373 | 141 |
| 251 | 3300006846 | Ga0075430_100078215 | Ga0075430_1000782153 | 141 |
| 252 | 3300006847 | Ga0075431_100403697 | Ga0075431_1004036973 | 141 |
| 253 | 3300006880 | Ga0075429_100019110 | Ga0075429_1000191102 | 141 |
| 254 | 3300006880 | Ga0075429_100241956 | Ga0075429_1002419562 | 141 |
| 255 | 3300006881 | Ga0068865_100107443 | Ga0068865_1001074433 | 141 |
| 256 | 3300006931 | Ga0097620_100939178 | Ga0097620_1009391782 | 141 |
| 257 | 3300009092 | Ga0105250_10308492 | Ga0105250_103084921 | 141 |
| 258 | 3300009093 | Ga0105240_10004115 | Ga0105240_1000411516 | 141 |
| 259 | 3300009093 | Ga0105240_10014853 | Ga0105240_100148534 | 141 |
| 260 | 3300009093 | Ga0105240_10220554 | Ga0105240_102205543 | 141 |
| 261 | 3300009094 | Ga0111539_10516037 | Ga0111539_105160372 | 141 |
| 262 | 3300009094 | Ga0111539_10852069 | Ga0111539_108520692 | 141 |
| 263 | 3300009098 | Ga0105245_10004081 | Ga0105245_100040816 | 141 |
| 264 | 3300009147 | Ga0114129_10056554 | Ga0114129_100565543 | 141 |
| 265 | 3300009147 | Ga0114129_10320688 | Ga0114129_103206883 | 141 |
| 266 | 3300009148 | Ga0105243_10005218 | Ga0105243_100052186 | 141 |
| 267 | 3300009174 | Ga0105241_10001143 | Ga0105241_1000114319 | 141 |
| 268 | 3300009177 | Ga0105248_10002357 | Ga0105248_100023578 | 141 |
| 269 | 3300009545 | Ga0105237_10013591 | Ga0105237_100135916 | 141 |
| 270 | 3300009553 | Ga0105249_10004381 | Ga0105249_1000438112 | 141 |
| 271 | 3300009553 | Ga0105249_12186102 | Ga0105249_121861021 | 141 |
| 272 | 3300010159 | Ga0099796_10035473 | Ga0099796_100354732 | 141 |
| 273 | 3300010375 | Ga0105239_10888805 | Ga0105239_108888052 | 141 |
| 274 | 3300013102 | Ga0157371_10013293 | Ga0157371_100132931 | 141 |
| 275 | 3300013105 | Ga0157369_10007117 | Ga0157369_100071174 | 141 |
| 276 | 3300013105 | Ga0157369_10014687 | Ga0157369_100146878 | 141 |
| 277 | 3300013296 | Ga0157374_11837372 | Ga0157374_118373721 | 141 |
| 278 | 3300013297 | Ga0157378_10023886 | Ga0157378_100238866 | 141 |
| 279 | 3300013306 | Ga0163162_10851620 | Ga0163162_108516202 | 141 |
| 280 | 3300013307 | Ga0157372_10004863 | Ga0157372_100048638 | 141 |
| 281 | 3300013308 | Ga0157375_10262727 | Ga0157375_102627271 | 141 |
| 282 | 3300014325 | Ga0163163_10006733 | Ga0163163_100067337 | 141 |
| 283 | 3300014745 | Ga0157377_10011806 | Ga0157377_100118063 | 141 |
| 284 | 3300014968 | Ga0157379_10273063 | Ga0157379_102730631 | 141 |
| 285 | 3300014969 | Ga0157376_10001343 | Ga0157376_1000134313 | 141 |
| 286 | 3300017792 | Ga0163161_10002609 | Ga0163161_100026091 | 141 |
| 287 | 3300022467 | Ga0224712_10569934 | Ga0224712_105699341 | 141 |
| 288 | 3300025261 | Ga0209233_1003344 | Ga0209233_10033443 | 141 |
| 289 | 3300025901 | Ga0207688_10002165 | Ga0207688_100021656 | 141 |
| 290 | 3300025904 | Ga0207647_10002823 | Ga0207647_100028238 | 141 |
| 291 | 3300025906 | Ga0207699_10011678 | Ga0207699_100116781 | 141 |
| 292 | 3300025907 | Ga0207645_10011062 | Ga0207645_100110622 | 141 |
| 293 | 3300025911 | Ga0207654_10357521 | Ga0207654_103575211 | 141 |
| 294 | 3300025912 | Ga0207707_10000470 | Ga0207707_1000047017 | 141 |
| 295 | 3300025912 | Ga0207707_10006510 | Ga0207707_1000651010 | 141 |
| 296 | 3300025913 | Ga0207695_10001758 | Ga0207695_100017583 | 141 |
| 297 | 3300025913 | Ga0207695_10216094 | Ga0207695_102160943 | 141 |
| 298 | 3300025913 | Ga0207695_10240779 | Ga0207695_102407793 | 141 |
| 299 | 3300025913 | Ga0207695_10332890 | Ga0207695_103328903 | 141 |
| 300 | 3300025914 | Ga0207671_10009117 | Ga0207671_100091176 | 141 |
| 301 | 3300025915 | Ga0207693_10002297 | Ga0207693_100022971 | 141 |
| 302 | 3300025916 | Ga0207663_10000540 | Ga0207663_100005403 | 141 |
| 303 | 3300025917 | Ga0207660_10003113 | Ga0207660_100031133 | 141 |
| 304 | 3300025918 | Ga0207662_10350645 | Ga0207662_103506451 | 141 |
| 305 | 3300025919 | Ga0207657_10000793 | Ga0207657_100007938 | 141 |
| 306 | 3300025920 | Ga0207649_10234455 | Ga0207649_102344553 | 141 |
| 307 | 3300025921 | Ga0207652_10000795 | Ga0207652_1000079516 | 141 |
| 308 | 3300025921 | Ga0207652_10059616 | Ga0207652_100596163 | 141 |
| 309 | 3300025921 | Ga0207652_10152593 | Ga0207652_101525931 | 141 |
| 310 | 3300025923 | Ga0207681_10042900 | Ga0207681_100429001 | 141 |
| 311 | 3300025926 | Ga0207659_10037091 | Ga0207659_100370911 | 141 |
| 312 | 3300025926 | Ga0207659_10790317 | Ga0207659_107903172 | 141 |
| 313 | 3300025926 | Ga0207659_10908401 | Ga0207659_109084012 | 141 |
| 314 | 3300025927 | Ga0207687_10283531 | Ga0207687_102835311 | 141 |
| 315 | 3300025928 | Ga0207700_10094858 | Ga0207700_100948585 | 141 |
| 316 | 3300025931 | Ga0207644_10030866 | Ga0207644_100308666 | 141 |
| 317 | 3300025931 | Ga0207644_10487582 | Ga0207644_104875822 | 141 |
| 318 | 3300025932 | Ga0207690_10004925 | Ga0207690_100049251 | 141 |
| 319 | 3300025933 | Ga0207706_10000771 | Ga0207706_1000077134 | 141 |
| 320 | 3300025934 | Ga0207686_10022152 | Ga0207686_100221525 | 141 |
| 321 | 3300025935 | Ga0207709_10290244 | Ga0207709_102902441 | 141 |
| 322 | 3300025937 | Ga0207669_10240558 | Ga0207669_102405583 | 141 |
| 323 | 3300025938 | Ga0207704_10129485 | Ga0207704_101294851 | 141 |
| 324 | 3300025939 | Ga0207665_10006767 | Ga0207665_100067679 | 141 |
| 325 | 3300025940 | Ga0207691_10013656 | Ga0207691_100136566 | 141 |
| 326 | 3300025941 | Ga0207711_10066762 | Ga0207711_100667625 | 141 |
| 327 | 3300025942 | Ga0207689_10159023 | Ga0207689_101590233 | 141 |
| 328 | 3300025945 | Ga0207679_10039243 | Ga0207679_100392431 | 141 |
| 329 | 3300025945 | Ga0207679_10175159 | Ga0207679_101751593 | 141 |
| 330 | 3300025945 | Ga0207679_11045919 | Ga0207679_110459192 | 141 |
| 331 | 3300025949 | Ga0207667_10006758 | Ga0207667_100067588 | 141 |
| 332 | 3300025949 | Ga0207667_10178435 | Ga0207667_101784351 | 141 |
| 333 | 3300025960 | Ga0207651_10002140 | Ga0207651_100021402 | 141 |
| 334 | 3300025961 | Ga0207712_10012704 | Ga0207712_100127046 | 141 |
| 335 | 3300025972 | Ga0207668_10109742 | Ga0207668_101097424 | 141 |
| 336 | 3300025981 | Ga0207640_10317299 | Ga0207640_103172993 | 141 |
| 337 | 3300025986 | Ga0207658_10019372 | Ga0207658_100193727 | 141 |
| 338 | 3300026023 | Ga0207677_10116548 | Ga0207677_101165482 | 141 |
| 339 | 3300026035 | Ga0207703_10050351 | Ga0207703_100503516 | 141 |
| 340 | 3300026041 | Ga0207639_10124939 | Ga0207639_101249392 | 141 |
| 341 | 3300026067 | Ga0207678_10001022 | Ga0207678_1000102219 | 141 |
| 342 | 3300026067 | Ga0207678_11226350 | Ga0207678_112263502 | 141 |
| 343 | 3300026075 | Ga0207708_10008196 | Ga0207708_100081969 | 141 |
| 344 | 3300026078 | Ga0207702_10010968 | Ga0207702_1001096810 | 141 |
| 345 | 3300026078 | Ga0207702_10346541 | Ga0207702_103465411 | 141 |
| 346 | 3300026095 | Ga0207676_10184361 | Ga0207676_101843612 | 141 |
| 347 | 3300026116 | Ga0207674_10004073 | Ga0207674_1000407315 | 141 |
| 348 | 3300026118 | Ga0207675_100000706 | Ga0207675_10000070631 | 141 |
| 349 | 3300026121 | Ga0207683_10005141 | Ga0207683_100051416 | 141 |
| 350 | 3300027907 | Ga0207428_10052400 | Ga0207428_100524003 | 141 |
| 351 | 3300028379 | Ga0268266_10137454 | Ga0268266_101374543 | 141 |
| 352 | 3300028380 | Ga0268265_11619796 | Ga0268265_116197961 | 141 |
| 353 | 3300031548 | Ga0307408_100178704 | Ga0307408_1001787042 | 141 |
| 354 | 3300032005 | Ga0307411_12333034 | Ga0307411_123330341 | 141 |
| 355 | 3300034818 | Ga0373950_0031733 | Ga0373950_0031733_223_648 | 141 |
| 356 | 3300035084 | Ga0373928_0009529 | Ga0373928_0009529_1151_1576 | 141 |
| 357 | 3300035090 | Ga0373949_0020588 | Ga0373949_0020588_401_826 | 141 |
| 358 | 3300035090 | Ga0373949_0153115 | Ga0373949_0153115_128_556 | 141 |
| 359 | 3300035092 | Ga0373952_0088765 | Ga0373952_0088765_286_714 | 141 |
| 360 | 3300035112 | Ga0373932_0160774 | Ga0373932_0160774_112_537 | 141 |
| 361 | 3300035114 | Ga0373939_0306191 | Ga0373939_0306191_34_459 | 141 |
| 362 | 3300035241 | Ga0373961_0033944 | Ga0373961_0033944_216_641 | 141 |
| 363 | 3300035241 | Ga0373961_0177659 | Ga0373961_0177659_63_491 | 141 |
| 364 | 3300035691 | Ga0373931_0002027 | Ga0373931_0002027_129_554 | 141 |
| 365 | 3300042008 | Ga0439450_050995 | Ga0439450_050995_333_767 | 141 |
| 366 | 3300042012 | Ga0439455_0052363 | Ga0439455_0052363_611_1045 | 141 |
| 367 | 3300042439 | Ga0439464_0019506 | Ga0439464_0019506_377_811 | 141 |
| 368 | 3300042993 | Ga0439440_0025663 | Ga0439440_0025663_637_1071 | 141 |
| 369 | 3300044673 | Ga0453683_0673825 | Ga0453683_0673825_214_642 | 141 |
| 370 | 3300046507 | Ga0495606_0003946 | Ga0495606_0003946_5003_5440 | 141 |
| 371 | 3300048904 | Ga0496101_0007137 | Ga0496101_0007137_6579_7004 | 141 |
| 372 | 3300048905 | Ga0496102_1358826 | Ga0496102_1358826_92_517 | 141 |
| 373 | 3300048907 | Ga0496104_0853499 | Ga0496104_0853499_84_512 | 141 |
| 374 | 3300048910 | Ga0496107_0024805 | Ga0496107_0024805_3706_4131 | 141 |
| 375 | 3300048911 | Ga0496108_0389757 | Ga0496108_0389757_221_646 | 141 |
| 376 | 3300048912 | Ga0496109_1037054 | Ga0496109_1037054_113_538 | 141 |
| 377 | 3300048913 | Ga0496110_0312727 | Ga0496110_0312727_785_1210 | 141 |
| 378 | 3300048914 | Ga0496111_0153663 | Ga0496111_0153663_712_1137 | 141 |
| 379 | 3300048915 | Ga0496112_0025435 | Ga0496112_0025435_1427_1852 | 141 |
| 380 | 3300048916 | Ga0496113_0101298 | Ga0496113_0101298_1546_1971 | 141 |
| 381 | 3300048917 | Ga0496114_0021087 | Ga0496114_0021087_849_1274 | 141 |
| 382 | 3300048918 | Ga0496115_0147147 | Ga0496115_0147147_221_646 | 141 |
| 383 | 3300049577 | Ga0501041_0270572 | Ga0501041_0270572_274_702 | 141 |
| 384 | 3300049588 | Ga0501072_0947755 | Ga0501072_0947755_62_490 | 141 |
| 385 | 3300049679 | Ga0501249_138283 | Ga0501249_138283_82_510 | 141 |
| 386 | 3300050508 | nmdc:mga09592_54371_c1 | nmdc:mga09592_54371_c1_2879_3304 | 141 |
| 387 | 3300050510 | nmdc:mga06r32_109024_c1 | nmdc:mga06r32_109024_c1_2058_2486 | 141 |
| 388 | 3300050511 | nmdc:mga08y16_312081_c1 | nmdc:mga08y16_312081_c1_318_743 | 141 |
| 389 | 3300050515 | nmdc:mga0a205_5596_c1 | nmdc:mga0a205_5596_c1_9926_10351 | 141 |
| 390 | 3300053134 | Ga0500658_0096283 | Ga0500658_0096283_484_912 | 141 |
| 391 | 3300053146 | Ga0500588_0002343 | Ga0500588_0002343_69_497 | 141 |
| 392 | 3300053732 | Ga0500656_014293 | Ga0500656_014293_183_611 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8002 | 1 | 114 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7357 | 1 | 114 |
| 4fpi-assembly1.cif.gz_E | crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp | 0.7197 | 1 | 120 |
| 3zo7-assembly1.cif.gz_E | crystal structure of clcfe27a with substrate | 0.7068 | 1 | 120 |
| 3zo7-assembly1.cif.gz_F | crystal structure of clcfe27a with substrate | 0.6885 | 1 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8002 | 1 | 114 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7357 | 1 | 114 | 3.30.70.1060 |
| 3znj100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6834 | 1 | 120 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6803 | 1 | 119 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6609 | 1 | 119 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7RXR3-F1-model_v4 | Transcription initiation protein | 0.9261 | 1 | 127 |
|
| AF-A0A1M7TH95-F1-model_v4 | Uncharacterized conserved protein | 0.9234 | 1 | 134 |
|
| AF-A0A7W1B6H1-F1-model_v4 | YciI family protein | 0.9204 | 1 | 126 |
|
| AF-A0A1F8UAQ9-F1-model_v4 | Transcription initiation protein | 0.9198 | 1 | 134 |
|
| AF-A0A2V7RCP6-F1-model_v4 | Transcription initiation protein | 0.9176 | 1 | 127 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar