F432362

General Info

Members Datasets Scaffolds Average Seq Length
392 208 784 177

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_1473993|Ga0395901_1473993_32_565
Length 177
Sequence MRAHNLADLYDLPLLDWADVTARLDRGITLVPGTGGPDRHSCWLTTLDPDGAPHTTGIGAAWLDGIWWFETGRGTRKGRNLARDPRCTLAVGVKEFDLVVDGTAQIVTDPATVARLAEHWAAADGWPCRVDESGTALTADFSAPSAGKPPWHVYRITTRSATALATVDPGGATRWTW

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
90 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
91 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
94 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.67
Nodule 0
Rhizoplane 5.61
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 10.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_1473993 3300038443 Unclassified 637
2 Ga0070660_101020585 3300005339 Bacteria 699
3 Ga0070667_100021049 3300005367 Bacteria 5418
4 Ga0070709_10000330 3300005434 Bacteria 29846
5 Ga0070709_10141169 3300005434 Bacteria 1655
6 Ga0070709_10201595 3300005434 Bacteria 1409
7 Ga0070709_10289801 3300005434 Bacteria 1192
8 Ga0070714_100002493 3300005435 Bacteria 13584
9 Ga0070714_100058711 3300005435 Bacteria 3297
10 Ga0070714_100066644 3300005435 Bacteria 3103
11 Ga0070714_100200249 3300005435 Bacteria 1826
12 Ga0070714_100262919 3300005435 Bacteria 1598
13 Ga0070714_100575096 3300005435 Bacteria 1080
14 Ga0070714_100820175 3300005435 Unclassified 901
15 Ga0070713_100002647 3300005436 Bacteria 11662
16 Ga0070713_100024579 3300005436 Bacteria 4695
17 Ga0070713_100032649 3300005436 Bacteria 4161
18 Ga0070713_100043140 3300005436 Bacteria 3686
19 Ga0070713_100256038 3300005436 Bacteria 1598
20 Ga0070713_100599459 3300005436 Bacteria 1046
21 Ga0070713_100736545 3300005436 Bacteria 942
22 Ga0070713_101070358 3300005436 Bacteria 779
23 Ga0070710_10000116 3300005437 Bacteria 37907
24 Ga0070710_10014348 3300005437 Bacteria 3987
25 Ga0070710_10115695 3300005437 Bacteria 1616
26 Ga0070710_10247560 3300005437 Bacteria 1144
27 Ga0070711_100000342 3300005439 Bacteria 23911
28 Ga0070711_100010876 3300005439 Bacteria 5641
29 Ga0070711_100038314 3300005439 Bacteria 3223
30 Ga0070711_100122231 3300005439 Bacteria 1927
31 Ga0070711_100171190 3300005439 Bacteria 1655
32 Ga0070711_100378226 3300005439 Bacteria 1144
33 Ga0070705_100333586 3300005440 Unclassified 1099
34 Ga0070708_100126415 3300005445 Bacteria 2363
35 Ga0070681_10329473 3300005458 Bacteria 1436
36 Ga0068867_100326355 3300005459 Bacteria 1273
37 Ga0070685_10200725 3300005466 Bacteria 1296
38 Ga0070706_100003067 3300005467 Bacteria 16546
39 Ga0070706_101414480 3300005467 Unclassified 636
40 Ga0070707_100558813 3300005468 Bacteria 1106
41 Ga0070698_100127078 3300005471 Bacteria 2506
42 Ga0070698_100221726 3300005471 Bacteria 1824
43 Ga0070698_100722831 3300005471 Bacteria 938
44 Ga0070699_100033618 3300005518 Unclassified 4430
45 Ga0070684_100117714 3300005535 Bacteria 2388
46 Ga0070684_100137943 3300005535 Bacteria 2204
47 Ga0070697_100047396 3300005536 Bacteria 3484
48 Ga0068855_100262655 3300005563 Bacteria 1923
49 Ga0070664_101387260 3300005564 Unclassified 664
50 Ga0068857_100169907 3300005577 Bacteria 1981
51 Ga0068857_100911361 3300005577 Bacteria 843
52 Ga0068852_100944661 3300005616 Unclassified 880
53 Ga0068858_100162148 3300005842 Bacteria 2105
54 Ga0068858_101159488 3300005842 Bacteria 759
55 Ga0068860_100000169 3300005843 Bacteria 107281
56 Ga0081540_1000458 3300005983 Bacteria 40511
57 Ga0070717_10102775 3300006028 Bacteria 2428
58 Ga0070717_10126641 3300006028 Bacteria 2193
59 Ga0070717_10287834 3300006028 Bacteria 1458
60 Ga0070717_10381817 3300006028 Bacteria 1263
61 Ga0070717_10642069 3300006028 Bacteria 963
62 Ga0075365_10011500 3300006038 Bacteria 5206
63 Ga0075365_10035803 3300006038 Bacteria 3213
64 Ga0075365_10082787 3300006038 Unclassified 2176
65 Ga0075365_10157153 3300006038 Bacteria 1583
66 Ga0075365_10191578 3300006038 Bacteria 1431
67 Ga0075365_10293000 3300006038 Bacteria 1145
68 Ga0075365_10462330 3300006038 Bacteria 896
69 Ga0075365_10462847 3300006038 Unclassified 896
70 Ga0075368_10006208 3300006042 Bacteria 4163
71 Ga0075363_100020352 3300006048 Bacteria 3327
72 Ga0075364_10007189 3300006051 Bacteria 6592
73 Ga0075364_10027039 3300006051 Bacteria 3662
74 Ga0075364_10047664 3300006051 Bacteria 2792
75 Ga0075364_10320833 3300006051 Bacteria 1055
76 Ga0070715_10039071 3300006163 Bacteria 1974
77 Ga0070715_10362808 3300006163 Bacteria 795
78 Ga0070716_100000140 3300006173 Bacteria 28728
79 Ga0070716_100009992 3300006173 Bacteria 4745
80 Ga0070716_100075540 3300006173 Bacteria 1994
81 Ga0070716_100101965 3300006173 Bacteria 1761
82 Ga0070712_100017899 3300006175 Bacteria 4591
83 Ga0070712_100274172 3300006175 Bacteria 1356
84 Ga0070712_100301834 3300006175 Bacteria 1296
85 Ga0075367_10049166 3300006178 Bacteria 2485
86 Ga0075367_10571424 3300006178 Bacteria 718
87 Ga0097621_100371361 3300006237 Unclassified 1276
88 Ga0097621_100512591 3300006237 Bacteria 1088
89 Ga0075370_10002621 3300006353 Bacteria 8391
90 Ga0075370_10475316 3300006353 Bacteria 753
91 Ga0068871_100443719 3300006358 Bacteria 1162
92 Ga0075428_100009228 3300006844 Bacteria 10943
93 Ga0075430_100036522 3300006846 Bacteria 4166
94 Ga0075431_100009627 3300006847 Bacteria 9705
95 Ga0075431_100116173 3300006847 Bacteria 2762
96 Ga0075431_101291101 3300006847 Bacteria 691
97 Ga0075429_100001744 3300006880 Bacteria 17999
98 Ga0068865_100300706 3300006881 Bacteria 1284
99 Ga0068865_100563877 3300006881 Unclassified 958
100 Ga0075435_100009833 3300007076 Bacteria 6960
101 Ga0075435_100067094 3300007076 Bacteria 2920
102 Ga0105245_10143481 3300009098 Bacteria 2251
103 Ga0105245_10252023 3300009098 Unclassified 1715
104 Ga0105245_10601894 3300009098 Bacteria 1126
105 Ga0105245_10754707 3300009098 Bacteria 1009
106 Ga0105247_10000575 3300009101 Bacteria 29833
107 Ga0114129_10051496 3300009147 Bacteria 5780
108 Ga0114129_11439271 3300009147 Bacteria 849
109 Ga0105243_11452803 3300009148 Bacteria 708
110 Ga0105241_10089835 3300009174 Bacteria 2421
111 Ga0105248_10000111 3300009177 Bacteria 91627
112 Ga0105237_10867574 3300009545 Bacteria 909
113 Ga0099796_10046525 3300010159 Bacteria 1490
114 Ga0105239_10003004 3300010375 Bacteria 21030
115 Ga0105239_10659682 3300010375 Bacteria 1195
116 Ga0157370_10390642 3300013104 Bacteria 1281
117 Ga0157369_10294364 3300013105 Bacteria 1689
118 Ga0157374_10044060 3300013296 Bacteria 4124
119 Ga0157378_10155641 3300013297 Bacteria 2133
120 Ga0157372_11883283 3300013307 Bacteria 687
121 Ga0157375_10233100 3300013308 Bacteria 2000
122 Ga0157375_10321660 3300013308 Bacteria 1712
123 Ga0157375_10445635 3300013308 Bacteria 1460
124 Ga0157375_11729054 3300013308 Unclassified 741
125 Ga0157379_10000288 3300014968 Bacteria 39832
126 Ga0157379_10276319 3300014968 Bacteria 1528
127 Ga0157379_11221360 3300014968 Bacteria 724
128 Ga0207653_10315887 3300025885 Bacteria 607
129 Ga0207692_10000063 3300025898 Bacteria 32014
130 Ga0207692_10011043 3300025898 Bacteria 3825
131 Ga0207692_10098682 3300025898 Bacteria 1599
132 Ga0207685_10001427 3300025905 Bacteria 4996
133 Ga0207685_10069246 3300025905 Bacteria 1424
134 Ga0207699_10001581 3300025906 Bacteria 10804
135 Ga0207699_10015669 3300025906 Bacteria 3943
136 Ga0207699_10078592 3300025906 Bacteria 2038
137 Ga0207699_10116449 3300025906 Bacteria 1721
138 Ga0207645_10171161 3300025907 Bacteria 1423
139 Ga0207684_10484635 3300025910 Bacteria 1060
140 Ga0207654_10174336 3300025911 Bacteria 1399
141 Ga0207707_10417131 3300025912 Unclassified 1151
142 Ga0207671_10047879 3300025914 Bacteria 3164
143 Ga0207671_10762530 3300025914 Bacteria 768
144 Ga0207693_10002066 3300025915 Bacteria 17552
145 Ga0207693_10062986 3300025915 Bacteria 2905
146 Ga0207663_10000587 3300025916 Bacteria 16104
147 Ga0207663_10006284 3300025916 Bacteria 6066
148 Ga0207663_10028790 3300025916 Bacteria 3256
149 Ga0207663_10037366 3300025916 Bacteria 2927
150 Ga0207663_10088502 3300025916 Bacteria 2048
151 Ga0207663_10234251 3300025916 Bacteria 1343
152 Ga0207646_11065313 3300025922 Bacteria 712
153 Ga0207681_10149478 3300025923 Bacteria 1749
154 Ga0207700_10000185 3300025928 Bacteria 37466
155 Ga0207700_10018880 3300025928 Bacteria 4645
156 Ga0207700_10029782 3300025928 Bacteria 3856
157 Ga0207700_10193051 3300025928 Bacteria 1712
158 Ga0207700_10202050 3300025928 Bacteria 1675
159 Ga0207700_10235690 3300025928 Bacteria 1558
160 Ga0207700_10465880 3300025928 Bacteria 1115
161 Ga0207664_10000342 3300025929 Bacteria 34339
162 Ga0207664_10127353 3300025929 Bacteria 2139
163 Ga0207664_10193672 3300025929 Bacteria 1751
164 Ga0207664_10229762 3300025929 Bacteria 1612
165 Ga0207664_10246264 3300025929 Unclassified 1558
166 Ga0207665_10000272 3300025939 Bacteria 35767
167 Ga0207665_10018228 3300025939 Bacteria 4613
168 Ga0207691_10782803 3300025940 Bacteria 802
169 Ga0207711_10000605 3300025941 Bacteria 36233
170 Ga0207667_10315608 3300025949 Bacteria 1596
171 Ga0207658_10041499 3300025986 Bacteria 3332
172 Ga0207703_10756986 3300026035 Bacteria 926
173 Ga0207708_10312188 3300026075 Bacteria 1281
174 Ga0207702_10072354 3300026078 Bacteria 2971
175 Ga0207702_10088522 3300026078 Bacteria 2705
176 Ga0207641_10082542 3300026088 Bacteria 2793
177 Ga0207674_10182609 3300026116 Bacteria 2049
178 Ga0207674_10589476 3300026116 Bacteria 1074
179 Ga0268264_10000791 3300028381 Bacteria 34364
180 Ga0265327_10000940 3300031251 Bacteria 42631
181 Ga0307415_100177971 3300032126 Bacteria 1666
182 Ga0373958_0007965 3300034819 Bacteria 1704
183 Ga0373938_0094550 3300034957 Bacteria 743
184 Ga0373929_0007982 3300035085 Bacteria 1945
185 Ga0373934_0283422 3300035086 Bacteria 686
186 Ga0373940_0030007 3300035088 Bacteria 1444
187 Ga0373951_0026764 3300035091 Bacteria 1345
188 Ga0373923_0049865 3300035111 Bacteria 1752
189 Ga0373923_0092540 3300035111 Bacteria 1324
190 Ga0373936_0021112 3300035113 Bacteria 2532
191 Ga0373939_0002021 3300035114 Bacteria 4844
192 Ga0373953_0068223 3300035117 Bacteria 1463
193 Ga0373954_0102706 3300035118 Unclassified 1380
194 Ga0373956_0511690 3300035119 Bacteria 573
195 Ga0373957_0053267 3300035120 Unclassified 1552
196 Ga0373960_0001690 3300035121 Bacteria 4943
197 Ga0373946_0040024 3300035171 Bacteria 1916
198 Ga0373924_0009871 3300035410 Bacteria 3510
199 Ga0373931_0004267 3300035691 Bacteria 6508
200 Ga0373935_0109322 3300035692 Bacteria 1833
201 Ga0373935_0261706 3300035692 Bacteria 1213
202 Ga0373927_0147754 3300035695 Bacteria 1539
203 Ga0373927_0227294 3300035695 Bacteria 1226
204 Ga0373933_0013703 3300035724 Bacteria 4497
205 Ga0373947_0051500 3300035725 Bacteria 2477
206 Ga0373947_0063142 3300035725 Bacteria 2256
207 Ga0373947_0081908 3300035725 Bacteria 1999
208 Ga0373947_0284758 3300035725 Bacteria 1099
209 Ga0373937_0002635 3300036401 Bacteria 14957
210 Ga0373937_0059511 3300036401 Bacteria 3511
211 Ga0373925_0045178 3300037068 Bacteria 3272
212 Ga0373925_0216935 3300037068 Unclassified 1526
213 Ga0373925_0516225 3300037068 Bacteria 981
214 Ga0395898_0138437 3300037466 Bacteria 2331
215 Ga0395901_0069575 3300038443 Bacteria 3666
216 Ga0436363_0369882 3300039450 Bacteria 793
217 Ga0466972_0385851 3300044658 Bacteria 656
218 Ga0466961_0009513 3300044693 Bacteria 6189
219 Ga0466957_0791010 3300044842 Bacteria 673
220 Ga0466958_0001217 3300045836 Bacteria 12017
221 Ga0466967_0788157 3300045976 Bacteria 943
222 Ga0495592_0000397 3300046454 Bacteria 33962
223 Ga0495592_0016360 3300046454 Bacteria 5627
224 Ga0495592_0337143 3300046454 Unclassified 970
225 Ga0495603_0117701 3300046455 Bacteria 1549
226 Ga0495629_0063844 3300046459 Unclassified 2571
227 Ga0495641_0022552 3300046461 Unclassified 3147
228 Ga0495641_0045835 3300046461 Bacteria 2012
229 Ga0495641_0060808 3300046461 Bacteria 1706
230 Ga0495651_0058485 3300046462 Bacteria 2958
231 Ga0495651_0223146 3300046462 Unclassified 1303
232 Ga0495653_0017085 3300046463 Bacteria 5902
233 Ga0495653_0031919 3300046463 Bacteria 4185
234 Ga0495653_0098970 3300046463 Bacteria 2117
235 Ga0495653_0256461 3300046463 Unclassified 1158
236 Ga0495580_0072696 3300046472 Bacteria 2401
237 Ga0495582_0108401 3300046473 Unclassified 1559
238 Ga0495582_0138656 3300046473 Bacteria 1377
239 Ga0495662_0096677 3300046476 Bacteria 1443
240 Ga0495662_0301941 3300046476 Unclassified 787
241 Ga0495664_0026743 3300046477 Bacteria 3361
242 Ga0495664_0116185 3300046477 Bacteria 1617
243 Ga0495608_0060652 3300046511 Bacteria 2488
244 Ga0495608_0063473 3300046511 Bacteria 2423
245 Ga0495618_0057745 3300046514 Bacteria 2457
246 Ga0495618_0402046 3300046514 Bacteria 837
247 Ga0495628_0025150 3300046516 Bacteria 4865
248 Ga0495628_0093650 3300046516 Bacteria 2323
249 Ga0495630_0058685 3300046517 Unclassified 2885
250 Ga0495630_0688671 3300046517 Bacteria 782
251 Ga0495666_0061390 3300046526 Bacteria 1796
252 Ga0495652_0089177 3300046529 Bacteria 2525
253 Ga0495652_0194198 3300046529 Bacteria 1546
254 Ga0495665_0046747 3300046531 Unclassified 2297
255 Ga0495640_0012413 3300046533 Bacteria 6507
256 Ga0495640_0030033 3300046533 Unclassified 3895
257 Ga0495640_0244841 3300046533 Bacteria 1124
258 Ga0495587_0002185 3300046536 Bacteria 13084
259 Ga0495587_0029581 3300046536 Bacteria 3325
260 Ga0495587_0109843 3300046536 Bacteria 1584
261 Ga0495621_0002643 3300046539 Bacteria 4845
262 Ga0495645_0116220 3300046543 Bacteria 1888
263 Ga0495645_0276680 3300046543 Bacteria 1105
264 Ga0495645_0424249 3300046543 Bacteria 843
265 Ga0495667_0022052 3300046559 Bacteria 4292
266 Ga0495667_0035072 3300046559 Bacteria 3354
267 Ga0495667_0035565 3300046559 Unclassified 3328
268 Ga0495667_0182715 3300046559 Bacteria 1345
269 Ga0495634_0040674 3300046642 Bacteria 3159
270 Ga0495634_0387392 3300046642 Bacteria 832
271 Ga0495635_0017957 3300046663 Bacteria 4940
272 Ga0495635_0038448 3300046663 Bacteria 3313
273 Ga0495635_0359954 3300046663 Bacteria 970
274 Ga0495588_0452338 3300046674 Bacteria 674
275 Ga0495657_0002699 3300046675 Bacteria 14825
276 Ga0495657_0007475 3300046675 Bacteria 8443
277 Ga0495657_0149415 3300046675 Bacteria 1451
278 Ga0495599_0011017 3300046678 Bacteria 5549
279 Ga0495599_0092275 3300046678 Bacteria 1889
280 Ga0495623_0015250 3300046679 Bacteria 4965
281 Ga0495646_0031782 3300046680 Bacteria 3288
282 Ga0495646_0077139 3300046680 Bacteria 1949
283 Ga0495646_0337911 3300046680 Bacteria 791
284 Ga0495647_0114264 3300046681 Bacteria 1130
285 Ga0495658_0014008 3300046683 Bacteria 4088
286 Ga0495613_0057590 3300046689 Bacteria 2853
287 Ga0495624_0328420 3300046690 Unclassified 921
288 Ga0495624_0429436 3300046690 Bacteria 792
289 Ga0495649_0242926 3300046694 Bacteria 927
290 Ga0495581_0051541 3300047315 Bacteria 2376
291 Ga0495581_0289292 3300047315 Bacteria 958
292 Ga0495604_0008417 3300047317 Bacteria 8150
293 Ga0495604_0492107 3300047317 Bacteria 796
294 Ga0495674_0018676 3300047319 Bacteria 6452
295 Ga0495674_0587507 3300047319 Unclassified 883
296 Ga0495676_0027216 3300047321 Bacteria 4907
297 Ga0495676_0109388 3300047321 Bacteria 2031
298 Ga0495676_0677155 3300047321 Bacteria 668
299 Ga0495680_0003722 3300047322 Bacteria 14871
300 Ga0495680_0013418 3300047322 Bacteria 7151
301 Ga0495680_0067964 3300047322 Unclassified 2723
302 Ga0495680_0147924 3300047322 Bacteria 1714
303 Ga0495680_0354290 3300047322 Unclassified 1021
304 Ga0495680_0377135 3300047322 Bacteria 983
305 Ga0495675_0015379 3300047444 Bacteria 4839
306 Ga0495675_0081812 3300047444 Bacteria 2033
307 Ga0495684_0022861 3300047471 Bacteria 4809
308 Ga0495684_0043198 3300047471 Bacteria 3450
309 Ga0495684_0208390 3300047471 Unclassified 1438
310 Ga0495684_0257050 3300047471 Bacteria 1268
311 Ga0495593_0004614 3300047673 Bacteria 8192
312 Ga0495593_0159197 3300047673 Bacteria 1140
313 Ga0495602_0013477 3300048088 Bacteria 8356
314 Ga0495602_0035669 3300048088 Bacteria 4635
315 Ga0495602_0405403 3300048088 Bacteria 971
316 Ga0495614_0186627 3300048089 Bacteria 934
317 Ga0496100_0333884 3300048903 Bacteria 1141
318 Ga0496101_0191338 3300048904 Bacteria 1579
319 Ga0496102_0685942 3300048905 Unclassified 947
320 Ga0496103_0225043 3300048906 Unclassified 1206
321 Ga0496104_0099047 3300048907 Bacteria 2790
322 Ga0496105_0232840 3300048908 Bacteria 1496
323 Ga0496105_0254512 3300048908 Bacteria 1422
324 Ga0496106_0026289 3300048909 Bacteria 4333
325 Ga0496107_0029894 3300048910 Bacteria 3880
326 Ga0496108_0492702 3300048911 Bacteria 1070
327 Ga0496109_0025640 3300048912 Bacteria 5255
328 Ga0496110_0422012 3300048913 Bacteria 1216
329 Ga0496110_0615146 3300048913 Bacteria 985
330 Ga0496111_0014307 3300048914 Bacteria 5418
331 Ga0496112_0214912 3300048915 Bacteria 1879
332 Ga0496112_0325728 3300048915 Bacteria 1480
333 Ga0496113_0049646 3300048916 Bacteria 3125
334 Ga0496114_0020581 3300048917 Bacteria 5355
335 Ga0496114_0722207 3300048917 Bacteria 872
336 Ga0496115_0081333 3300048918 Bacteria 2638
337 Ga0496115_0212034 3300048918 Bacteria 1599
338 Ga0496115_0669505 3300048918 Bacteria 819
339 Ga0496117_0020352 3300048920 Bacteria 5411
340 Ga0496121_0033548 3300048924 Bacteria 4643
341 Ga0496124_0178298 3300048927 Bacteria 1638
342 Ga0501031_0277679 3300049568 Bacteria 1087
343 Ga0501038_0324773 3300049574 Bacteria 1203
344 Ga0501042_0292842 3300049578 Bacteria 1176
345 Ga0501067_0157711 3300049583 Bacteria 1264
346 Ga0501068_0101718 3300049584 Bacteria 1782
347 Ga0501071_0089281 3300049587 Bacteria 2262
348 Ga0501072_0786183 3300049588 Bacteria 746
349 Ga0501075_0150372 3300049591 Bacteria 1775
350 Ga0501076_0192600 3300049592 Bacteria 1664
351 nmdc:mga03n38_34328_c1 3300050490 Bacteria 2166
352 nmdc:mga00v17_1519_c1 3300050491 Bacteria 12117
353 nmdc:mga00v17_327579_c1 3300050491 Bacteria 995
354 nmdc:mga00v17_67493_c1 3300050491 Bacteria 2210
355 nmdc:mga00v17_7165_c1 3300050491 Bacteria 5942
356 nmdc:mga0yw44_121088_c1 3300050492 Bacteria 1685
357 nmdc:mga0yw44_133969_c1 3300050492 Bacteria 1606
358 nmdc:mga0yw44_16468_c1 3300050492 Bacteria 3994
359 nmdc:mga0yw44_17689_c1 3300050492 Bacteria 3886
360 nmdc:mga0yw44_259584_c1 3300050492 Bacteria 1158
361 nmdc:mga0yw44_321123_c1 3300050492 Bacteria 1040
362 nmdc:mga0yw44_41107_c1 3300050492 Bacteria 2750
363 nmdc:mga0yw44_726083_c1 3300050492 Unclassified 675
364 nmdc:mga07m45_65429_c1 3300050496 Bacteria 2064
365 nmdc:mga05p37_24693_c2 3300050507 Bacteria 1216
366 nmdc:mga09592_14825_c1 3300050508 Bacteria 6362
367 nmdc:mga09592_525252_c1 3300050508 Bacteria 1018
368 nmdc:mga0qj67_1112_c1 3300050509 Bacteria 18655
369 nmdc:mga06r32_45152_c1 3300050510 Bacteria 4199
370 nmdc:mga06r32_47404_c1 3300050510 Bacteria 4105
371 nmdc:mga0n895_1046421_c1 3300050512 Bacteria 795
372 nmdc:mga0n895_140560_c1 3300050512 Bacteria 2443
373 nmdc:mga0n895_365129_c1 3300050512 Bacteria 1462
374 nmdc:mga0rr50_418712_c1 3300050513 Bacteria 1133
375 nmdc:mga0rr50_61434_c1 3300050513 Bacteria 2831
376 nmdc:mga0rr50_76752_c1 3300050513 Unclassified 2566
377 nmdc:mga08x19_40013_c1 3300050514 Bacteria 2982
378 nmdc:mga0a205_100601_c1 3300050515 Bacteria 2789
379 nmdc:mga0a205_367947_c1 3300050515 Bacteria 1304
380 Ga0495601_0066999 3300053077 Bacteria 2286
381 Ga0495595_0002306 3300053084 Bacteria 7439
382 Ga0495595_0011973 3300053084 Bacteria 3637
383 Ga0495595_0077617 3300053084 Bacteria 1578
384 Ga0495595_0204876 3300053084 Bacteria 982
385 Ga0495595_0306179 3300053084 Bacteria 799
386 Ga0495619_0005238 3300053085 Bacteria 8219
387 Ga0495619_0056351 3300053085 Bacteria 2605
388 Ga0495619_0260709 3300053085 Unclassified 1201
389 Ga0495619_0492370 3300053085 Unclassified 843
390 Ga0500641_0005974 3300053096 Bacteria 4310
391 Ga0500554_004521 3300053102 Bacteria 2955
392 Ga0501084_0379281 3300054114 Unclassified 1195
393 Ga0395901_1473993
394 Ga0070660_101020585
395 Ga0070667_100021049
396 Ga0070709_10000330
397 Ga0070709_10141169
398 Ga0070709_10201595
399 Ga0070709_10289801
400 Ga0070714_100002493
401 Ga0070714_100058711
402 Ga0070714_100066644
403 Ga0070714_100200249
404 Ga0070714_100262919
405 Ga0070714_100575096
406 Ga0070714_100820175
407 Ga0070713_100002647
408 Ga0070713_100024579
409 Ga0070713_100032649
410 Ga0070713_100043140
411 Ga0070713_100256038
412 Ga0070713_100599459
413 Ga0070713_100736545
414 Ga0070713_101070358
415 Ga0070710_10000116
416 Ga0070710_10014348
417 Ga0070710_10115695
418 Ga0070710_10247560
419 Ga0070711_100000342
420 Ga0070711_100010876
421 Ga0070711_100038314
422 Ga0070711_100122231
423 Ga0070711_100171190
424 Ga0070711_100378226
425 Ga0070705_100333586
426 Ga0070708_100126415
427 Ga0070681_10329473
428 Ga0068867_100326355
429 Ga0070685_10200725
430 Ga0070706_100003067
431 Ga0070706_101414480
432 Ga0070707_100558813
433 Ga0070698_100127078
434 Ga0070698_100221726
435 Ga0070698_100722831
436 Ga0070699_100033618
437 Ga0070684_100117714
438 Ga0070684_100137943
439 Ga0070697_100047396
440 Ga0068855_100262655
441 Ga0070664_101387260
442 Ga0068857_100169907
443 Ga0068857_100911361
444 Ga0068852_100944661
445 Ga0068858_100162148
446 Ga0068858_101159488
447 Ga0068860_100000169
448 Ga0081540_1000458
449 Ga0070717_10102775
450 Ga0070717_10126641
451 Ga0070717_10287834
452 Ga0070717_10381817
453 Ga0070717_10642069
454 Ga0075365_10011500
455 Ga0075365_10035803
456 Ga0075365_10082787
457 Ga0075365_10157153
458 Ga0075365_10191578
459 Ga0075365_10293000
460 Ga0075365_10462330
461 Ga0075365_10462847
462 Ga0075368_10006208
463 Ga0075363_100020352
464 Ga0075364_10007189
465 Ga0075364_10027039
466 Ga0075364_10047664
467 Ga0075364_10320833
468 Ga0070715_10039071
469 Ga0070715_10362808
470 Ga0070716_100000140
471 Ga0070716_100009992
472 Ga0070716_100075540
473 Ga0070716_100101965
474 Ga0070712_100017899
475 Ga0070712_100274172
476 Ga0070712_100301834
477 Ga0075367_10049166
478 Ga0075367_10571424
479 Ga0097621_100371361
480 Ga0097621_100512591
481 Ga0075370_10002621
482 Ga0075370_10475316
483 Ga0068871_100443719
484 Ga0075428_100009228
485 Ga0075430_100036522
486 Ga0075431_100009627
487 Ga0075431_100116173
488 Ga0075431_101291101
489 Ga0075429_100001744
490 Ga0068865_100300706
491 Ga0068865_100563877
492 Ga0075435_100009833
493 Ga0075435_100067094
494 Ga0105245_10143481
495 Ga0105245_10252023
496 Ga0105245_10601894
497 Ga0105245_10754707
498 Ga0105247_10000575
499 Ga0114129_10051496
500 Ga0114129_11439271
501 Ga0105243_11452803
502 Ga0105241_10089835
503 Ga0105248_10000111
504 Ga0105237_10867574
505 Ga0099796_10046525
506 Ga0105239_10003004
507 Ga0105239_10659682
508 Ga0157370_10390642
509 Ga0157369_10294364
510 Ga0157374_10044060
511 Ga0157378_10155641
512 Ga0157372_11883283
513 Ga0157375_10233100
514 Ga0157375_10321660
515 Ga0157375_10445635
516 Ga0157375_11729054
517 Ga0157379_10000288
518 Ga0157379_10276319
519 Ga0157379_11221360
520 Ga0207653_10315887
521 Ga0207692_10000063
522 Ga0207692_10011043
523 Ga0207692_10098682
524 Ga0207685_10001427
525 Ga0207685_10069246
526 Ga0207699_10001581
527 Ga0207699_10015669
528 Ga0207699_10078592
529 Ga0207699_10116449
530 Ga0207645_10171161
531 Ga0207684_10484635
532 Ga0207654_10174336
533 Ga0207707_10417131
534 Ga0207671_10047879
535 Ga0207671_10762530
536 Ga0207693_10002066
537 Ga0207693_10062986
538 Ga0207663_10000587
539 Ga0207663_10006284
540 Ga0207663_10028790
541 Ga0207663_10037366
542 Ga0207663_10088502
543 Ga0207663_10234251
544 Ga0207646_11065313
545 Ga0207681_10149478
546 Ga0207700_10000185
547 Ga0207700_10018880
548 Ga0207700_10029782
549 Ga0207700_10193051
550 Ga0207700_10202050
551 Ga0207700_10235690
552 Ga0207700_10465880
553 Ga0207664_10000342
554 Ga0207664_10127353
555 Ga0207664_10193672
556 Ga0207664_10229762
557 Ga0207664_10246264
558 Ga0207665_10000272
559 Ga0207665_10018228
560 Ga0207691_10782803
561 Ga0207711_10000605
562 Ga0207667_10315608
563 Ga0207658_10041499
564 Ga0207703_10756986
565 Ga0207708_10312188
566 Ga0207702_10072354
567 Ga0207702_10088522
568 Ga0207641_10082542
569 Ga0207674_10182609
570 Ga0207674_10589476
571 Ga0268264_10000791
572 Ga0265327_10000940
573 Ga0307415_100177971
574 Ga0373958_0007965
575 Ga0373938_0094550
576 Ga0373929_0007982
577 Ga0373934_0283422
578 Ga0373940_0030007
579 Ga0373951_0026764
580 Ga0373923_0049865
581 Ga0373923_0092540
582 Ga0373936_0021112
583 Ga0373939_0002021
584 Ga0373953_0068223
585 Ga0373954_0102706
586 Ga0373956_0511690
587 Ga0373957_0053267
588 Ga0373960_0001690
589 Ga0373946_0040024
590 Ga0373924_0009871
591 Ga0373931_0004267
592 Ga0373935_0109322
593 Ga0373935_0261706
594 Ga0373927_0147754
595 Ga0373927_0227294
596 Ga0373933_0013703
597 Ga0373947_0051500
598 Ga0373947_0063142
599 Ga0373947_0081908
600 Ga0373947_0284758
601 Ga0373937_0002635
602 Ga0373937_0059511
603 Ga0373925_0045178
604 Ga0373925_0216935
605 Ga0373925_0516225
606 Ga0395898_0138437
607 Ga0395901_0069575
608 Ga0436363_0369882
609 Ga0466972_0385851
610 Ga0466961_0009513
611 Ga0466957_0791010
612 Ga0466958_0001217
613 Ga0466967_0788157
614 Ga0495592_0000397
615 Ga0495592_0016360
616 Ga0495592_0337143
617 Ga0495603_0117701
618 Ga0495629_0063844
619 Ga0495641_0022552
620 Ga0495641_0045835
621 Ga0495641_0060808
622 Ga0495651_0058485
623 Ga0495651_0223146
624 Ga0495653_0017085
625 Ga0495653_0031919
626 Ga0495653_0098970
627 Ga0495653_0256461
628 Ga0495580_0072696
629 Ga0495582_0108401
630 Ga0495582_0138656
631 Ga0495662_0096677
632 Ga0495662_0301941
633 Ga0495664_0026743
634 Ga0495664_0116185
635 Ga0495608_0060652
636 Ga0495608_0063473
637 Ga0495618_0057745
638 Ga0495618_0402046
639 Ga0495628_0025150
640 Ga0495628_0093650
641 Ga0495630_0058685
642 Ga0495630_0688671
643 Ga0495666_0061390
644 Ga0495652_0089177
645 Ga0495652_0194198
646 Ga0495665_0046747
647 Ga0495640_0012413
648 Ga0495640_0030033
649 Ga0495640_0244841
650 Ga0495587_0002185
651 Ga0495587_0029581
652 Ga0495587_0109843
653 Ga0495621_0002643
654 Ga0495645_0116220
655 Ga0495645_0276680
656 Ga0495645_0424249
657 Ga0495667_0022052
658 Ga0495667_0035072
659 Ga0495667_0035565
660 Ga0495667_0182715
661 Ga0495634_0040674
662 Ga0495634_0387392
663 Ga0495635_0017957
664 Ga0495635_0038448
665 Ga0495635_0359954
666 Ga0495588_0452338
667 Ga0495657_0002699
668 Ga0495657_0007475
669 Ga0495657_0149415
670 Ga0495599_0011017
671 Ga0495599_0092275
672 Ga0495623_0015250
673 Ga0495646_0031782
674 Ga0495646_0077139
675 Ga0495646_0337911
676 Ga0495647_0114264
677 Ga0495658_0014008
678 Ga0495613_0057590
679 Ga0495624_0328420
680 Ga0495624_0429436
681 Ga0495649_0242926
682 Ga0495581_0051541
683 Ga0495581_0289292
684 Ga0495604_0008417
685 Ga0495604_0492107
686 Ga0495674_0018676
687 Ga0495674_0587507
688 Ga0495676_0027216
689 Ga0495676_0109388
690 Ga0495676_0677155
691 Ga0495680_0003722
692 Ga0495680_0013418
693 Ga0495680_0067964
694 Ga0495680_0147924
695 Ga0495680_0354290
696 Ga0495680_0377135
697 Ga0495675_0015379
698 Ga0495675_0081812
699 Ga0495684_0022861
700 Ga0495684_0043198
701 Ga0495684_0208390
702 Ga0495684_0257050
703 Ga0495593_0004614
704 Ga0495593_0159197
705 Ga0495602_0013477
706 Ga0495602_0035669
707 Ga0495602_0405403
708 Ga0495614_0186627
709 Ga0496100_0333884
710 Ga0496101_0191338
711 Ga0496102_0685942
712 Ga0496103_0225043
713 Ga0496104_0099047
714 Ga0496105_0232840
715 Ga0496105_0254512
716 Ga0496106_0026289
717 Ga0496107_0029894
718 Ga0496108_0492702
719 Ga0496109_0025640
720 Ga0496110_0422012
721 Ga0496110_0615146
722 Ga0496111_0014307
723 Ga0496112_0214912
724 Ga0496112_0325728
725 Ga0496113_0049646
726 Ga0496114_0020581
727 Ga0496114_0722207
728 Ga0496115_0081333
729 Ga0496115_0212034
730 Ga0496115_0669505
731 Ga0496117_0020352
732 Ga0496121_0033548
733 Ga0496124_0178298
734 Ga0501031_0277679
735 Ga0501038_0324773
736 Ga0501042_0292842
737 Ga0501067_0157711
738 Ga0501068_0101718
739 Ga0501071_0089281
740 Ga0501072_0786183
741 Ga0501075_0150372
742 Ga0501076_0192600
743 nmdc:mga03n38_34328_c1
744 nmdc:mga00v17_1519_c1
745 nmdc:mga00v17_327579_c1
746 nmdc:mga00v17_67493_c1
747 nmdc:mga00v17_7165_c1
748 nmdc:mga0yw44_121088_c1
749 nmdc:mga0yw44_133969_c1
750 nmdc:mga0yw44_16468_c1
751 nmdc:mga0yw44_17689_c1
752 nmdc:mga0yw44_259584_c1
753 nmdc:mga0yw44_321123_c1
754 nmdc:mga0yw44_41107_c1
755 nmdc:mga0yw44_726083_c1
756 nmdc:mga07m45_65429_c1
757 nmdc:mga05p37_24693_c2
758 nmdc:mga09592_14825_c1
759 nmdc:mga09592_525252_c1
760 nmdc:mga0qj67_1112_c1
761 nmdc:mga06r32_45152_c1
762 nmdc:mga06r32_47404_c1
763 nmdc:mga0n895_1046421_c1
764 nmdc:mga0n895_140560_c1
765 nmdc:mga0n895_365129_c1
766 nmdc:mga0rr50_418712_c1
767 nmdc:mga0rr50_61434_c1
768 nmdc:mga0rr50_76752_c1
769 nmdc:mga08x19_40013_c1
770 nmdc:mga0a205_100601_c1
771 nmdc:mga0a205_367947_c1
772 Ga0495601_0066999
773 Ga0495595_0002306
774 Ga0495595_0011973
775 Ga0495595_0077617
776 Ga0495595_0204876
777 Ga0495595_0306179
778 Ga0495619_0005238
779 Ga0495619_0056351
780 Ga0495619_0260709
781 Ga0495619_0492370
782 Ga0500641_0005974
783 Ga0500554_004521
784 Ga0501084_0379281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

37

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.8165 15 162
3db0-assembly1.cif.gz_B crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.8044 41 160
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7996 38 162
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.779 38 167
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.7755 20 162
ID Description Score Start End Superfamily
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8148 15 161 2.30.110.10
2iabB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7988 41 162 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7875 42 162 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7775 41 160 2.30.110.10
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.761 15 161 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A536BI56-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9738 36 176 GO:0005829
GO:0016627
GO:0070967
AF-A0A7W4VRL3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.968 1 176 GO:0005829
GO:0016627
GO:0070967
AF-A0A536BI56-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9669 36 176 GO:0005829
GO:0016627
GO:0070967
AF-A0A231H9R3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9625 2 176 GO:0005829
GO:0016627
GO:0070967
AF-A0A1G6RE56-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.957 1 176 GO:0005829
GO:0016627
GO:0070967

Map