F432346

General Info

Members Datasets Scaffolds Average Seq Length
392 164 357 160

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100033206|Ga0307408_1000332063
Length 178
Sequence MIRNFVPCLVRRTGTSMCLMPNHGASPETEILDEQECWRLLRGVSLGRLALWVENHPDIFPINYTVDHGSLVFRTGAGIKLRTLRAIEGDIPLALEADGVDAKAGIAWSVVLKGHASEIDVTDEFLDSVARVLFPWQPGRKDHFVRIVPSSVSGRRFAVVQPKAWWISLDEATRAGLE

Samples

Sample ID Description Type Environment
1 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
2 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
3 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
4 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
5 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
6 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
7 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
8 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
9 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
10 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
11 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
12 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
13 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
14 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
15 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
16 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
17 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
18 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
81 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
84 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
87 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
88 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
91 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
92 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
93 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.56
Metatranscriptomes 2.81
Isolates 6.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 13.27
Rhizosphere 79.59
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000098 3300002773 Bacteria 61029
2 JGI25150J39212_1036325 3300002774 Bacteria 654
3 JGI25151J46595_10047629 3300003187 Bacteria 1489
4 Ga0006562J51391_1036424 3300003578 Bacteria 2329
5 Ga0065714_10017356 3300005288 Bacteria 1952
6 Ga0065714_10073737 3300005288 Bacteria 3113
7 Ga0065714_10158129 3300005288 Bacteria 1066
8 Ga0065714_10235612 3300005288 Unclassified 806
9 Ga0070670_100019862 3300005331 Bacteria 5768
10 Ga0070670_101438219 3300005331 Bacteria 632
11 Ga0070666_10013580 3300005335 Bacteria 5172
12 Ga0070669_100022045 3300005353 Bacteria 4557
13 Ga0070675_100019926 3300005354 Bacteria 5351
14 Ga0070674_100053754 3300005356 Bacteria 2782
15 Ga0070674_101254536 3300005356 Bacteria 659
16 Ga0070667_100115022 3300005367 Bacteria 2336
17 Ga0070678_100071592 3300005456 Bacteria 2596
18 Ga0070678_100350325 3300005456 Bacteria 1269
19 Ga0070672_100032709 3300005543 Bacteria 3929
20 Ga0070672_100363057 3300005543 Bacteria 1236
21 Ga0075432_10001863 3300006058 Bacteria 6968
22 Ga0105244_10001344 3300009036 Bacteria 20068
23 Ga0105244_10001815 3300009036 Bacteria 16682
24 Ga0105244_10016309 3300009036 Bacteria 4235
25 Ga0105244_10037950 3300009036 Bacteria 2514
26 Ga0105244_10040090 3300009036 Bacteria 2434
27 Ga0105244_10079563 3300009036 Bacteria 1624
28 Ga0105245_10495424 3300009098 Bacteria 1237
29 Ga0105245_11233696 3300009098 Bacteria 796
30 Ga0105243_10087393 3300009148 Bacteria 2559
31 Ga0105243_10212708 3300009148 Bacteria 1703
32 Ga0105243_10280558 3300009148 Bacteria 1500
33 Ga0105242_10078776 3300009176 Bacteria 2751
34 Ga0105248_11458385 3300009177 Bacteria 774
35 Ga0105246_10002354 3300011119 Bacteria 11408
36 Ga0105246_10016154 3300011119 Bacteria 4723
37 Ga0105246_10021604 3300011119 Bacteria 4144
38 Ga0105246_10091734 3300011119 Bacteria 2191
39 Ga0105246_10593216 3300011119 Bacteria 956
40 Ga0105246_10633654 3300011119 Bacteria 928
41 Ga0105246_10658984 3300011119 Bacteria 912
42 Ga0157371_10298406 3300013102 Bacteria 1166
43 Ga0157369_10107513 3300013105 Bacteria 2967
44 Ga0157369_10177155 3300013105 Bacteria 2244
45 Ga0157369_10306982 3300013105 Bacteria 1650
46 Ga0157378_10271126 3300013297 Bacteria 1632
47 Ga0163162_10016308 3300013306 Bacteria 7263
48 Ga0163162_10045119 3300013306 Bacteria 4415
49 Ga0157375_10021937 3300013308 Bacteria 5869
50 Ga0157375_10430536 3300013308 Bacteria 1485
51 Ga0157375_10866277 3300013308 Bacteria 1049
52 Ga0157380_11642863 3300014326 Bacteria 699
53 Ga0207425_1002523 3300025245 Bacteria 6405
54 Ga0207425_1006627 3300025245 Bacteria 3144
55 Ga0209148_1001821 3300025254 Bacteria 8973
56 Ga0209148_1002210 3300025254 Bacteria 7158
57 Ga0209129_1000046 3300025258 Bacteria 271702
58 Ga0209129_1000079 3300025258 Bacteria 187308
59 Ga0209025_1000543 3300025294 Bacteria 70931
60 Ga0209025_1002178 3300025294 Bacteria 21751
61 Ga0209051_1002874 3300025303 Bacteria 11854
62 Ga0209051_1008710 3300025303 Bacteria 5337
63 Ga0207697_10424659 3300025315 Bacteria 590
64 Ga0207655_1002658 3300025728 Bacteria 14083
65 Ga0207655_1004717 3300025728 Bacteria 9538
66 Ga0207655_1009466 3300025728 Bacteria 6041
67 Ga0207655_1059150 3300025728 Bacteria 1493
68 Ga0207682_10267874 3300025893 Bacteria 797
69 Ga0207681_10448294 3300025923 Bacteria 1049
70 Ga0207650_10029187 3300025925 Bacteria 3962
71 Ga0207659_10434173 3300025926 Bacteria 1103
72 Ga0207709_10092556 3300025935 Bacteria 1980
73 Ga0207691_10000545 3300025940 Bacteria 37727
74 Ga0207651_10165841 3300025960 Bacteria 1737
75 Ga0207668_10089084 3300025972 Bacteria 2262
76 Ga0207683_10104046 3300026121 Bacteria 2537
77 Ga0207683_10365296 3300026121 Bacteria 1326
78 Ga0207683_10553688 3300026121 Bacteria 1063
79 Ga0207428_10039425 3300027907 Bacteria 3837
80 Ga0207428_10087205 3300027907 Bacteria 2428
81 Ga0268266_10929958 3300028379 Bacteria 841
82 Ga0307408_100002721 3300031548 Bacteria 12276
83 Ga0307408_100032205 3300031548 Bacteria 3654
84 Ga0307408_100033206 3300031548 Bacteria 3604
85 Ga0307408_100074543 3300031548 Bacteria 2518
86 Ga0307408_100097030 3300031548 Bacteria 2238
87 Ga0307408_100137712 3300031548 Bacteria 1912
88 Ga0307408_100173779 3300031548 Bacteria 1722
89 Ga0307408_100816528 3300031548 Bacteria 847
90 Ga0307408_100851218 3300031548 Bacteria 831
91 Ga0307405_10013061 3300031731 Unclassified 4418
92 Ga0307405_10029563 3300031731 Bacteria 3204
93 Ga0307405_10082144 3300031731 Bacteria 2108
94 Ga0307405_10315987 3300031731 Bacteria 1191
95 Ga0307405_10761191 3300031731 Bacteria 808
96 Ga0307405_11024152 3300031731 Bacteria 706
97 Ga0307413_10030057 3300031824 Bacteria 3047
98 Ga0307413_10080072 3300031824 Bacteria 2090
99 Ga0307413_10886371 3300031824 Bacteria 757
100 Ga0307413_11138658 3300031824 Bacteria 676
101 Ga0307410_10007034 3300031852 Bacteria 6127
102 Ga0307410_10007469 3300031852 Bacteria 5986
103 Ga0307410_10041459 3300031852 Bacteria 3036
104 Ga0307410_10192213 3300031852 Bacteria 1553
105 Ga0307410_10212346 3300031852 Bacteria 1484
106 Ga0307410_10249308 3300031852 Bacteria 1380
107 Ga0307410_10688797 3300031852 Unclassified 860
108 Ga0307410_11523423 3300031852 Bacteria 589
109 Ga0307406_10026432 3300031901 Bacteria 3486
110 Ga0307406_10043254 3300031901 Unclassified 2816
111 Ga0307406_10069876 3300031901 Bacteria 2297
112 Ga0307406_10186725 3300031901 Bacteria 1514
113 Ga0307406_10308544 3300031901 Bacteria 1219
114 Ga0307406_10436507 3300031901 Bacteria 1047
115 Ga0307407_10017914 3300031903 Unclassified 3568
116 Ga0307407_10041363 3300031903 Bacteria 2577
117 Ga0307407_10060119 3300031903 Bacteria 2216
118 Ga0307407_10060514 3300031903 Bacteria 2210
119 Ga0307407_10064591 3300031903 Bacteria 2152
120 Ga0307407_10177099 3300031903 Bacteria 1410
121 Ga0307407_10178419 3300031903 Bacteria 1405
122 Ga0307407_10227925 3300031903 Bacteria 1264
123 Ga0307407_10638627 3300031903 Bacteria 796
124 Ga0307412_10018388 3300031911 Bacteria 4204
125 Ga0307412_10026432 3300031911 Bacteria 3607
126 Ga0307412_10033296 3300031911 Unclassified 3274
127 Ga0307412_10033357 3300031911 Bacteria 3272
128 Ga0307412_10075711 3300031911 Bacteria 2309
129 Ga0307412_10101992 3300031911 Bacteria 2031
130 Ga0307412_10144924 3300031911 Bacteria 1744
131 Ga0307412_10367125 3300031911 Bacteria 1161
132 Ga0307412_10456984 3300031911 Bacteria 1053
133 Ga0307412_10551851 3300031911 Bacteria 968
134 Ga0307412_10552577 3300031911 Bacteria 967
135 Ga0307412_10660901 3300031911 Bacteria 892
136 Ga0307409_100008167 3300031995 Bacteria 6328
137 Ga0307409_100009695 3300031995 Bacteria 5937
138 Ga0307409_100013859 3300031995 Bacteria 5213
139 Ga0307409_100051932 3300031995 Bacteria 3140
140 Ga0307409_100318443 3300031995 Bacteria 1455
141 Ga0307409_100444043 3300031995 Bacteria 1250
142 Ga0307409_100937656 3300031995 Bacteria 881
143 Ga0307409_101895420 3300031995 Bacteria 625
144 Ga0307416_100008030 3300032002 Bacteria 6762
145 Ga0307416_100008263 3300032002 Bacteria 6697
146 Ga0307416_100011113 3300032002 Bacteria 5987
147 Ga0307416_100020261 3300032002 Unclassified 4740
148 Ga0307416_100045940 3300032002 Bacteria 3442
149 Ga0307416_100099030 3300032002 Bacteria 2530
150 Ga0307416_100116187 3300032002 Bacteria 2371
151 Ga0307416_100226896 3300032002 Bacteria 1797
152 Ga0307416_100426548 3300032002 Bacteria 1372
153 Ga0307416_100427040 3300032002 Bacteria 1371
154 Ga0307416_100433621 3300032002 Bacteria 1362
155 Ga0307416_100499569 3300032002 Bacteria 1280
156 Ga0307416_101637096 3300032002 Unclassified 749
157 Ga0307416_102190751 3300032002 Unclassified 654
158 Ga0307414_10037431 3300032004 Bacteria 3249
159 Ga0307414_10083175 3300032004 Bacteria 2350
160 Ga0307414_10178581 3300032004 Bacteria 1705
161 Ga0307414_10199496 3300032004 Bacteria 1626
162 Ga0307414_10700129 3300032004 Bacteria 917
163 Ga0307414_10954702 3300032004 Bacteria 788
164 Ga0307411_10049637 3300032005 Bacteria 2728
165 Ga0307415_100004993 3300032126 Bacteria 6982
166 Ga0307415_100142749 3300032126 Bacteria 1831
167 Ga0307415_100998834 3300032126 Bacteria 778
168 Ga0307415_102098612 3300032126 Bacteria 552
169 Ga0395899_0012250 3300037312 Bacteria 6568
170 Ga0395899_0017864 3300037312 Bacteria 5401
171 Ga0395899_0098300 3300037312 Bacteria 2115
172 Ga0395899_0136625 3300037312 Bacteria 1747
173 Ga0395900_0154936 3300037418 Bacteria 2340
174 Ga0395900_0159244 3300037418 Bacteria 2304
175 Ga0395900_1152898 3300037418 Bacteria 691
176 Ga0395898_0053846 3300037466 Bacteria 3928
177 Ga0395898_0168117 3300037466 Bacteria 2096
178 Ga0395898_0290202 3300037466 Bacteria 1560
179 Ga0395898_0463860 3300037466 Bacteria 1206
180 Ga0395905_0062416 3300037471 Bacteria 3486
181 Ga0395905_0487785 3300037471 Bacteria 1132
182 Ga0395901_0015383 3300038443 Bacteria 7789
183 Ga0395901_0125775 3300038443 Bacteria 2694
184 Ga0395901_0144886 3300038443 Bacteria 2497
185 Ga0395901_0198156 3300038443 Bacteria 2105
186 Ga0395901_0528687 3300038443 Bacteria 1197
187 Ga0439438_016239 3300041405 Bacteria 2168
188 Ga0439439_0209688 3300041406 Bacteria 568
189 Ga0439466_0009917 3300041411 Bacteria 3545
190 Ga0439466_0027880 3300041411 Bacteria 1953
191 Ga0439433_0000331 3300041999 Bacteria 8349
192 Ga0439433_0040508 3300041999 Bacteria 1083
193 Ga0439433_0100486 3300041999 Bacteria 717
194 Ga0439442_005250 3300042002 Bacteria 2597
195 Ga0439442_039327 3300042002 Bacteria 991
196 Ga0439442_098639 3300042002 Bacteria 631
197 Ga0439449_0000523 3300042007 Bacteria 14301
198 Ga0439449_0025444 3300042007 Bacteria 2212
199 Ga0439449_0064699 3300042007 Unclassified 1349
200 Ga0439452_042634 3300042010 Bacteria 1063
201 Ga0439457_000288 3300042014 Bacteria 13926
202 Ga0450919_002256 3300042121 Bacteria 2501
203 Ga0450919_002697 3300042121 Bacteria 2286
204 Ga0450920_000499 3300042122 Bacteria 6178
205 Ga0450920_013519 3300042122 Bacteria 1538
206 Ga0450897_033566 3300042128 Bacteria 588
207 Ga0450907_000059 3300042146 Bacteria 43871
208 Ga0450908_000450 3300042184 Bacteria 7949
209 Ga0450909_001149 3300042185 Bacteria 3661
210 Ga0439434_0006080 3300042435 Bacteria 3523
211 Ga0439434_0020550 3300042435 Bacteria 1983
212 Ga0439434_0186152 3300042435 Bacteria 696
213 Ga0450918_002515 3300042531 Bacteria 3463
214 Ga0450918_003682 3300042531 Bacteria 2838
215 Ga0495653_0016169 3300046463 Bacteria 6079
216 Ga0495580_0014941 3300046472 Bacteria 5879
217 Ga0495580_0019032 3300046472 Bacteria 5105
218 Ga0495580_0700206 3300046472 Bacteria 663
219 Ga0495582_0069020 3300046473 Bacteria 1954
220 Ga0495639_0034660 3300046475 Bacteria 2258
221 Ga0495662_0029048 3300046476 Bacteria 2670
222 Ga0495662_0452331 3300046476 Bacteria 630
223 Ga0495664_0069540 3300046477 Bacteria 2102
224 Ga0495642_0384194 3300046528 Bacteria 619
225 Ga0495642_0420059 3300046528 Bacteria 590
226 Ga0495665_0008063 3300046531 Bacteria 5711
227 Ga0495586_0004000 3300046535 Bacteria 7901
228 Ga0495586_0042950 3300046535 Bacteria 2434
229 Ga0495586_0221780 3300046535 Bacteria 1075
230 Ga0495586_0716626 3300046535 Bacteria 578
231 Ga0495587_0009542 3300046536 Bacteria 6213
232 Ga0495645_0016791 3300046543 Bacteria 5238
233 Ga0495645_0326803 3300046543 Bacteria 994
234 Ga0495622_0110571 3300046557 Bacteria 1258
235 Ga0495633_0019023 3300046558 Bacteria 3478
236 Ga0495633_0348199 3300046558 Bacteria 671
237 Ga0495633_0387546 3300046558 Bacteria 632
238 Ga0495667_0047436 3300046559 Bacteria 2838
239 Ga0495656_0002363 3300046615 Bacteria 6253
240 Ga0495656_0027928 3300046615 Bacteria 2258
241 Ga0495668_0322054 3300046616 Bacteria 848
242 Ga0495611_0395264 3300046648 Bacteria 632
243 Ga0495635_0276304 3300046663 Bacteria 1129
244 Ga0495659_0024943 3300046664 Bacteria 2043
245 Ga0495659_0066137 3300046664 Bacteria 1346
246 Ga0495588_0003350 3300046674 Bacteria 6962
247 Ga0495588_0046455 3300046674 Bacteria 2227
248 Ga0495588_0162151 3300046674 Bacteria 1182
249 Ga0495588_0598283 3300046674 Bacteria 578
250 Ga0495657_0148278 3300046675 Bacteria 1458
251 Ga0495670_0002186 3300046691 Bacteria 9673
252 Ga0495670_0006950 3300046691 Bacteria 5574
253 Ga0495670_0046943 3300046691 Bacteria 2158
254 Ga0495671_0091143 3300046692 Bacteria 1492
255 Ga0495600_0018579 3300046809 Bacteria 4430
256 Ga0495581_0005635 3300047315 Bacteria 7259
257 Ga0495581_0019025 3300047315 Bacteria 3985
258 Ga0495581_0053929 3300047315 Bacteria 2321
259 Ga0495636_0002578 3300047318 Bacteria 6969
260 Ga0495636_0192637 3300047318 Bacteria 928
261 Ga0495680_0137114 3300047322 Bacteria 1793
262 Ga0495680_0294541 3300047322 Bacteria 1141
263 Ga0495675_0394612 3300047444 Bacteria 807
264 Ga0495681_0038306 3300047470 Bacteria 2351
265 Ga0495681_0139318 3300047470 Bacteria 1026
266 Ga0495593_0155440 3300047673 Bacteria 1156
267 Ga0495615_0036671 3300048090 Bacteria 1204
268 Ga0496100_0042197 3300048903 Bacteria 2912
269 Ga0496100_0070740 3300048903 Bacteria 2327
270 Ga0496100_0087033 3300048903 Bacteria 2123
271 Ga0496100_0173780 3300048903 Bacteria 1553
272 Ga0496100_1366554 3300048903 Bacteria 559
273 Ga0496101_0003302 3300048904 Bacteria 10035
274 Ga0496101_0011775 3300048904 Bacteria 5816
275 Ga0496101_0372830 3300048904 Bacteria 1122
276 Ga0496102_0027524 3300048905 Bacteria 5077
277 Ga0496102_0032422 3300048905 Bacteria 4692
278 Ga0496102_0049204 3300048905 Bacteria 3834
279 Ga0496102_0058454 3300048905 Bacteria 3523
280 Ga0496102_0066854 3300048905 Bacteria 3295
281 Ga0496102_0539950 3300048905 Bacteria 1088
282 Ga0496102_0808789 3300048905 Bacteria 860
283 Ga0496103_0016598 3300048906 Bacteria 4394
284 Ga0496103_0046035 3300048906 Bacteria 2692
285 Ga0496103_0057741 3300048906 Bacteria 2410
286 Ga0496103_0073994 3300048906 Bacteria 2135
287 Ga0496103_0098987 3300048906 Bacteria 1844
288 Ga0496105_0015304 3300048908 Bacteria 6109
289 Ga0496105_0133024 3300048908 Bacteria 2049
290 Ga0496106_0006176 3300048909 Bacteria 8858
291 Ga0496106_0017566 3300048909 Bacteria 5292
292 Ga0496106_0132226 3300048909 Bacteria 1957
293 Ga0496106_0163934 3300048909 Bacteria 1759
294 Ga0496106_0280219 3300048909 Bacteria 1336
295 Ga0496107_0003194 3300048910 Bacteria 10892
296 Ga0496107_0043394 3300048910 Bacteria 3230
297 Ga0496107_0170981 3300048910 Bacteria 1612
298 Ga0496108_0019315 3300048911 Bacteria 5595
299 Ga0496108_0040240 3300048911 Bacteria 3895
300 Ga0496109_0085428 3300048912 Bacteria 2912
301 Ga0496109_0571729 3300048912 Bacteria 1065
302 Ga0496110_0021591 3300048913 Bacteria 5454
303 Ga0496110_0030824 3300048913 Bacteria 4624
304 Ga0496110_0495552 3300048913 Bacteria 1112
305 Ga0496111_0004720 3300048914 Bacteria 8645
306 Ga0496111_0014693 3300048914 Bacteria 5355
307 Ga0496111_0066967 3300048914 Bacteria 2608
308 Ga0496112_0011558 3300048915 Bacteria 8067
309 Ga0496112_0040442 3300048915 Bacteria 4558
310 Ga0496112_0053465 3300048915 Bacteria 3967
311 Ga0496112_0464306 3300048915 Bacteria 1203
312 Ga0496112_0560749 3300048915 Bacteria 1076
313 Ga0496112_1102074 3300048915 Bacteria 712
314 Ga0496112_1162449 3300048915 Bacteria 689
315 Ga0496112_1835018 3300048915 Bacteria 518
316 Ga0496113_0019677 3300048916 Bacteria 4728
317 Ga0496113_0093826 3300048916 Bacteria 2317
318 Ga0496114_0009435 3300048917 Bacteria 7746
319 Ga0496114_0174785 3300048917 Bacteria 1873
320 Ga0496125_0028095 3300048928 Bacteria 5087
321 Ga0496125_0419059 3300048928 Bacteria 777
322 Ga0501312_078775 3300049528 Bacteria 594
323 Ga0501318_056728 3300049534 Unclassified 593
324 Ga0501321_017083 3300049537 Bacteria 869
325 Ga0501323_037293 3300049539 Bacteria 702
326 Ga0501325_007165 3300049541 Bacteria 937
327 Ga0501032_0000595 3300049569 Bacteria 29193
328 Ga0501032_0010477 3300049569 Bacteria 6685
329 Ga0501032_0013294 3300049569 Bacteria 5860
330 Ga0501034_0000010 3300049571 Bacteria 312213
331 Ga0501034_0000488 3300049571 Bacteria 64385
332 Ga0501036_0649858 3300049572 Bacteria 873
333 Ga0501037_0002588 3300049573 Bacteria 13072
334 Ga0501037_0038292 3300049573 Bacteria 3533
335 Ga0501037_0053343 3300049573 Bacteria 2957
336 Ga0501037_0088897 3300049573 Bacteria 2236
337 Ga0501037_0192071 3300049573 Bacteria 1445
338 Ga0501038_0078817 3300049574 Bacteria 2779
339 Ga0501038_0124781 3300049574 Bacteria 2120
340 Ga0501038_0174523 3300049574 Bacteria 1738
341 Ga0501038_0615273 3300049574 Bacteria 820
342 Ga0501039_0019870 3300049575 Bacteria 5148
343 Ga0501043_0093367 3300049579 Bacteria 2366
344 Ga0501043_0184939 3300049579 Bacteria 1622
345 Ga0501043_0249856 3300049579 Bacteria 1366
346 Ga0501070_0249755 3300049586 Bacteria 1451
347 Ga0501070_1365268 3300049586 Bacteria 539
348 Ga0501071_0629786 3300049587 Bacteria 825
349 Ga0501279_012500 3300049775 Bacteria 1155
350 Ga0501044_0179598 3300049823 Bacteria 2084
351 Ga0501212_077463 3300049851 Unclassified 597
352 nmdc:mga00v17_835063_c1 3300050491 Bacteria 586
353 Ga0587090_000889 3300059510 Bacteria 2786
354 Ga0587128_032183 3300059630 Bacteria 875
355 Ga0587072_000443 3300059643 Bacteria 4152
356 Ga0587072_005159 3300059643 Bacteria 1939
357 Ga0587107_055159 3300059652 Bacteria 685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_1835018 Ga0496112_1835018_21_419 132
2 iso_pu_bacteria 2808606371 2808896981 142
3 3300031548 Ga0307408_100851218 Ga0307408_1008512182 143
4 iso_pu_bacteria 2945916053 2945918352 143
5 iso_pu_bacteria 2775506735 2775655130 144
6 iso_pu_bacteria 2811994871 2812320593 144
7 iso_pu_bacteria 2904776348 2904777753 144
8 iso_pu_bacteria 2919538618 2919539021 144
9 iso_pu_bacteria 2808606357 2808827619 145
10 iso_pu_bacteria 2808606360 2808852986 145
11 iso_pu_bacteria 2808606366 2808878565 145
12 iso_pu_bacteria 2946059875 2946062209 145
13 3300009036 Ga0105244_10001815 Ga0105244_1000181518 147
14 3300011119 Ga0105246_10091734 Ga0105246_100917342 147
15 3300025303 Ga0209051_1002874 Ga0209051_10028747 147
16 3300025728 Ga0207655_1002658 Ga0207655_10026584 147
17 3300046472 Ga0495580_0014941 Ga0495580_0014941_1567_2031 147
18 3300046543 Ga0495645_0326803 Ga0495645_0326803_332_796 147
19 3300048903 Ga0496100_1366554 Ga0496100_1366554_16_486 147
20 3300048915 Ga0496112_1102074 Ga0496112_1102074_207_671 147
21 3300049569 Ga0501032_0000595 Ga0501032_0000595_12080_12544 147
22 3300049571 Ga0501034_0000010 Ga0501034_0000010_122325_122789 147
23 3300049573 Ga0501037_0038292 Ga0501037_0038292_114_578 147
24 3300049574 Ga0501038_0124781 Ga0501038_0124781_1612_2076 147
25 3300049579 Ga0501043_0093367 Ga0501043_0093367_1090_1554 147
26 iso_pu_bacteria 2939598168 2939601301 147
27 3300013105 Ga0157369_10306982 Ga0157369_103069822 148
28 3300031548 Ga0307408_100816528 Ga0307408_1008165282 148
29 3300031995 Ga0307409_100318443 Ga0307409_1003184432 148
30 3300037312 Ga0395899_0017864 Ga0395899_0017864_3948_4415 148
31 3300037312 Ga0395899_0136625 Ga0395899_0136625_659_1126 148
32 3300037418 Ga0395900_0154936 Ga0395900_0154936_1247_1714 148
33 3300037418 Ga0395900_1152898 Ga0395900_1152898_125_592 148
34 3300037466 Ga0395898_0168117 Ga0395898_0168117_919_1386 148
35 3300038443 Ga0395901_0125775 Ga0395901_0125775_65_532 148
36 3300038443 Ga0395901_0528687 Ga0395901_0528687_635_1102 148
37 3300046535 Ga0495586_0221780 Ga0495586_0221780_527_991 148
38 3300048915 Ga0496112_0560749 Ga0496112_0560749_389_853 148
39 3300048915 Ga0496112_1162449 Ga0496112_1162449_142_606 148
40 iso_pu_bacteria 2904497146 2904498482 148
41 iso_pu_bacteria 2919034639 2919035174 148
42 iso_pu_bacteria 2932426870 2932430665 148
43 iso_pu_bacteria 2933418574 2933420199 148
44 3300031731 Ga0307405_11024152 Ga0307405_110241521 149
45 3300031903 Ga0307407_10227925 Ga0307407_102279252 149
46 3300032002 Ga0307416_100433621 Ga0307416_1004336212 149
47 3300032126 Ga0307415_100998834 Ga0307415_1009988342 149
48 iso_pu_bacteria 2904497146 2904498476 149
49 3300003578 Ga0006562J51391_1036424 Ga0006562J51391_10364244 150
50 3300009036 Ga0105244_10001815 Ga0105244_100018153 150
51 3300031731 Ga0307405_10082144 Ga0307405_100821442 150
52 3300031852 Ga0307410_10192213 Ga0307410_101922131 150
53 3300031901 Ga0307406_10436507 Ga0307406_104365071 150
54 3300031911 Ga0307412_10026432 Ga0307412_100264322 150
55 3300031911 Ga0307412_10033357 Ga0307412_100333573 150
56 3300031911 Ga0307412_10101992 Ga0307412_101019924 150
57 3300032004 Ga0307414_10954702 Ga0307414_109547021 150
58 3300049573 Ga0501037_0088897 Ga0501037_0088897_896_1378 150
59 iso_pu_bacteria 2857740372 2857741025 151
60 iso_pu_bacteria 2904497146 2904501429 151
61 iso_pu_bacteria 2904776348 2904780569 151
62 iso_pu_bacteria 2910809715 2910813378 151
63 iso_pu_bacteria 2919034639 2919035417 151
64 iso_pu_bacteria 2919538618 2919539371 151
65 3300005288 Ga0065714_10158129 Ga0065714_101581292 152
66 3300031548 Ga0307408_100002721 Ga0307408_1000027219 152
67 3300031548 Ga0307408_100097030 Ga0307408_1000970302 152
68 3300031548 Ga0307408_100137712 Ga0307408_1001377122 152
69 3300031548 Ga0307408_100173779 Ga0307408_1001737792 152
70 3300031731 Ga0307405_10315987 Ga0307405_103159872 152
71 3300031824 Ga0307413_10030057 Ga0307413_100300572 152
72 3300031852 Ga0307410_10212346 Ga0307410_102123462 152
73 3300031901 Ga0307406_10026432 Ga0307406_100264322 152
74 3300031901 Ga0307406_10069876 Ga0307406_100698762 152
75 3300031903 Ga0307407_10041363 Ga0307407_100413631 152
76 3300031903 Ga0307407_10060119 Ga0307407_100601193 152
77 3300031903 Ga0307407_10638627 Ga0307407_106386271 152
78 3300031911 Ga0307412_10018388 Ga0307412_100183882 152
79 3300031911 Ga0307412_10367125 Ga0307412_103671252 152
80 3300031911 Ga0307412_10456984 Ga0307412_104569842 152
81 3300031911 Ga0307412_10552577 Ga0307412_105525772 152
82 3300031911 Ga0307412_10660901 Ga0307412_106609012 152
83 3300031995 Ga0307409_100051932 Ga0307409_1000519322 152
84 3300031995 Ga0307409_101895420 Ga0307409_1018954201 152
85 3300032002 Ga0307416_100008030 Ga0307416_1000080303 152
86 3300032002 Ga0307416_100011113 Ga0307416_1000111135 152
87 3300032002 Ga0307416_100226896 Ga0307416_1002268962 152
88 3300032002 Ga0307416_100499569 Ga0307416_1004995692 152
89 3300032002 Ga0307416_101637096 Ga0307416_1016370961 152
90 3300032004 Ga0307414_10083175 Ga0307414_100831752 152
91 3300032004 Ga0307414_10178581 Ga0307414_101785812 152
92 3300032004 Ga0307414_10700129 Ga0307414_107001292 152
93 3300032005 Ga0307411_10049637 Ga0307411_100496372 152
94 3300032126 Ga0307415_100142749 Ga0307415_1001427492 152
95 3300049528 Ga0501312_078775 Ga0501312_078775_56_535 152
96 3300049534 Ga0501318_056728 Ga0501318_056728_89_568 152
97 3300049539 Ga0501323_037293 Ga0501323_037293_73_552 152
98 3300049569 Ga0501032_0000595 Ga0501032_0000595_11526_11993 152
99 3300049569 Ga0501032_0010477 Ga0501032_0010477_4517_4984 152
100 3300049571 Ga0501034_0000010 Ga0501034_0000010_122876_123343 152
101 3300049572 Ga0501036_0649858 Ga0501036_0649858_322_789 152
102 3300049573 Ga0501037_0002588 Ga0501037_0002588_1527_1994 152
103 3300049573 Ga0501037_0192071 Ga0501037_0192071_866_1333 152
104 3300049574 Ga0501038_0124781 Ga0501038_0124781_1058_1525 152
105 3300049574 Ga0501038_0174523 Ga0501038_0174523_404_883 152
106 3300049574 Ga0501038_0615273 Ga0501038_0615273_12_479 152
107 3300049575 Ga0501039_0019870 Ga0501039_0019870_11_478 152
108 3300049579 Ga0501043_0093367 Ga0501043_0093367_1659_2126 152
109 3300049579 Ga0501043_0184939 Ga0501043_0184939_342_809 152
110 3300049586 Ga0501070_0249755 Ga0501070_0249755_949_1416 152
111 3300049586 Ga0501070_1365268 Ga0501070_1365268_15_494 152
112 3300049587 Ga0501071_0629786 Ga0501071_0629786_251_718 152
113 3300049775 Ga0501279_012500 Ga0501279_012500_647_1126 152
114 3300049823 Ga0501044_0179598 Ga0501044_0179598_1363_1830 152
115 3300002773 JGI25152J39213_1000098 JGI25152J39213_10000985 153
116 3300002774 JGI25150J39212_1036325 JGI25150J39212_10363251 153
117 3300003187 JGI25151J46595_10047629 JGI25151J46595_100476292 153
118 3300005288 Ga0065714_10017356 Ga0065714_100173561 153
119 3300005288 Ga0065714_10073737 Ga0065714_100737373 153
120 3300005288 Ga0065714_10235612 Ga0065714_102356121 153
121 3300005331 Ga0070670_100019862 Ga0070670_1000198623 153
122 3300005331 Ga0070670_101438219 Ga0070670_1014382191 153
123 3300005335 Ga0070666_10013580 Ga0070666_100135801 153
124 3300005353 Ga0070669_100022045 Ga0070669_1000220455 153
125 3300005354 Ga0070675_100019926 Ga0070675_1000199264 153
126 3300005356 Ga0070674_100053754 Ga0070674_1000537542 153
127 3300005356 Ga0070674_101254536 Ga0070674_1012545362 153
128 3300005367 Ga0070667_100115022 Ga0070667_1001150222 153
129 3300005456 Ga0070678_100071592 Ga0070678_1000715922 153
130 3300005456 Ga0070678_100350325 Ga0070678_1003503252 153
131 3300005543 Ga0070672_100032709 Ga0070672_1000327094 153
132 3300005543 Ga0070672_100363057 Ga0070672_1003630572 153
133 3300006058 Ga0075432_10001863 Ga0075432_100018632 153
134 3300009036 Ga0105244_10001344 Ga0105244_100013446 153
135 3300009036 Ga0105244_10016309 Ga0105244_100163091 153
136 3300009036 Ga0105244_10037950 Ga0105244_100379503 153
137 3300009036 Ga0105244_10040090 Ga0105244_100400902 153
138 3300009036 Ga0105244_10079563 Ga0105244_100795632 153
139 3300009098 Ga0105245_10495424 Ga0105245_104954241 153
140 3300009098 Ga0105245_11233696 Ga0105245_112336961 153
141 3300009148 Ga0105243_10087393 Ga0105243_100873932 153
142 3300009148 Ga0105243_10212708 Ga0105243_102127081 153
143 3300009148 Ga0105243_10280558 Ga0105243_102805582 153
144 3300009176 Ga0105242_10078776 Ga0105242_100787762 153
145 3300009177 Ga0105248_11458385 Ga0105248_114583851 153
146 3300011119 Ga0105246_10002354 Ga0105246_1000235411 153
147 3300011119 Ga0105246_10016154 Ga0105246_100161543 153
148 3300011119 Ga0105246_10021604 Ga0105246_100216042 153
149 3300011119 Ga0105246_10091734 Ga0105246_100917343 153
150 3300011119 Ga0105246_10593216 Ga0105246_105932161 153
151 3300011119 Ga0105246_10633654 Ga0105246_106336542 153
152 3300011119 Ga0105246_10658984 Ga0105246_106589842 153
153 3300013102 Ga0157371_10298406 Ga0157371_102984061 153
154 3300013105 Ga0157369_10107513 Ga0157369_101075134 153
155 3300013105 Ga0157369_10177155 Ga0157369_101771551 153
156 3300013297 Ga0157378_10271126 Ga0157378_102711262 153
157 3300013306 Ga0163162_10016308 Ga0163162_100163082 153
158 3300013306 Ga0163162_10045119 Ga0163162_100451195 153
159 3300013308 Ga0157375_10021937 Ga0157375_100219374 153
160 3300013308 Ga0157375_10430536 Ga0157375_104305362 153
161 3300013308 Ga0157375_10866277 Ga0157375_108662772 153
162 3300014326 Ga0157380_11642863 Ga0157380_116428631 153
163 3300025245 Ga0207425_1002523 Ga0207425_10025232 153
164 3300025245 Ga0207425_1006627 Ga0207425_10066273 153
165 3300025254 Ga0209148_1001821 Ga0209148_10018212 153
166 3300025254 Ga0209148_1002210 Ga0209148_10022108 153
167 3300025258 Ga0209129_1000046 Ga0209129_100004686 153
168 3300025258 Ga0209129_1000079 Ga0209129_1000079173 153
169 3300025294 Ga0209025_1000543 Ga0209025_100054349 153
170 3300025294 Ga0209025_1002178 Ga0209025_10021786 153
171 3300025303 Ga0209051_1002874 Ga0209051_10028746 153
172 3300025303 Ga0209051_1008710 Ga0209051_10087105 153
173 3300025315 Ga0207697_10424659 Ga0207697_104246591 153
174 3300025728 Ga0207655_1002658 Ga0207655_10026585 153
175 3300025728 Ga0207655_1004717 Ga0207655_10047175 153
176 3300025728 Ga0207655_1009466 Ga0207655_10094663 153
177 3300025728 Ga0207655_1059150 Ga0207655_10591502 153
178 3300025893 Ga0207682_10267874 Ga0207682_102678741 153
179 3300025923 Ga0207681_10448294 Ga0207681_104482941 153
180 3300025925 Ga0207650_10029187 Ga0207650_100291874 153
181 3300025926 Ga0207659_10434173 Ga0207659_104341731 153
182 3300025935 Ga0207709_10092556 Ga0207709_100925562 153
183 3300025940 Ga0207691_10000545 Ga0207691_1000054526 153
184 3300025960 Ga0207651_10165841 Ga0207651_101658411 153
185 3300025972 Ga0207668_10089084 Ga0207668_100890842 153
186 3300026121 Ga0207683_10104046 Ga0207683_101040463 153
187 3300026121 Ga0207683_10365296 Ga0207683_103652962 153
188 3300026121 Ga0207683_10553688 Ga0207683_105536881 153
189 3300027907 Ga0207428_10039425 Ga0207428_100394253 153
190 3300027907 Ga0207428_10087205 Ga0207428_100872052 153
191 3300028379 Ga0268266_10929958 Ga0268266_109299581 153
192 3300031548 Ga0307408_100032205 Ga0307408_1000322054 153
193 3300031548 Ga0307408_100033206 Ga0307408_1000332063 153
194 3300031548 Ga0307408_100074543 Ga0307408_1000745432 153
195 3300031731 Ga0307405_10013061 Ga0307405_100130613 153
196 3300031731 Ga0307405_10029563 Ga0307405_100295632 153
197 3300031731 Ga0307405_10761191 Ga0307405_107611911 153
198 3300031824 Ga0307413_10080072 Ga0307413_100800722 153
199 3300031824 Ga0307413_10886371 Ga0307413_108863711 153
200 3300031824 Ga0307413_11138658 Ga0307413_111386581 153
201 3300031852 Ga0307410_10007034 Ga0307410_100070342 153
202 3300031852 Ga0307410_10007469 Ga0307410_100074694 153
203 3300031852 Ga0307410_10041459 Ga0307410_100414592 153
204 3300031852 Ga0307410_10249308 Ga0307410_102493082 153
205 3300031852 Ga0307410_10688797 Ga0307410_106887972 153
206 3300031852 Ga0307410_11523423 Ga0307410_115234231 153
207 3300031901 Ga0307406_10043254 Ga0307406_100432543 153
208 3300031901 Ga0307406_10186725 Ga0307406_101867251 153
209 3300031901 Ga0307406_10308544 Ga0307406_103085441 153
210 3300031903 Ga0307407_10017914 Ga0307407_100179142 153
211 3300031903 Ga0307407_10060514 Ga0307407_100605142 153
212 3300031903 Ga0307407_10064591 Ga0307407_100645912 153
213 3300031903 Ga0307407_10177099 Ga0307407_101770991 153
214 3300031903 Ga0307407_10178419 Ga0307407_101784192 153
215 3300031911 Ga0307412_10033296 Ga0307412_100332965 153
216 3300031911 Ga0307412_10075711 Ga0307412_100757113 153
217 3300031911 Ga0307412_10144924 Ga0307412_101449242 153
218 3300031911 Ga0307412_10551851 Ga0307412_105518512 153
219 3300031995 Ga0307409_100008167 Ga0307409_1000081676 153
220 3300031995 Ga0307409_100009695 Ga0307409_1000096954 153
221 3300031995 Ga0307409_100013859 Ga0307409_1000138594 153
222 3300031995 Ga0307409_100444043 Ga0307409_1004440432 153
223 3300031995 Ga0307409_100937656 Ga0307409_1009376562 153
224 3300032002 Ga0307416_100008263 Ga0307416_1000082635 153
225 3300032002 Ga0307416_100020261 Ga0307416_1000202617 153
226 3300032002 Ga0307416_100045940 Ga0307416_1000459403 153
227 3300032002 Ga0307416_100099030 Ga0307416_1000990303 153
228 3300032002 Ga0307416_100116187 Ga0307416_1001161873 153
229 3300032002 Ga0307416_100426548 Ga0307416_1004265482 153
230 3300032002 Ga0307416_100427040 Ga0307416_1004270402 153
231 3300032002 Ga0307416_102190751 Ga0307416_1021907512 153
232 3300032004 Ga0307414_10037431 Ga0307414_100374312 153
233 3300032004 Ga0307414_10199496 Ga0307414_101994962 153
234 3300032126 Ga0307415_100004993 Ga0307415_1000049936 153
235 3300032126 Ga0307415_102098612 Ga0307415_1020986121 153
236 3300037312 Ga0395899_0012250 Ga0395899_0012250_3654_4136 153
237 3300037312 Ga0395899_0098300 Ga0395899_0098300_901_1371 153
238 3300037418 Ga0395900_0159244 Ga0395900_0159244_1419_1901 153
239 3300037466 Ga0395898_0053846 Ga0395898_0053846_3349_3819 153
240 3300037466 Ga0395898_0290202 Ga0395898_0290202_158_640 153
241 3300037466 Ga0395898_0463860 Ga0395898_0463860_717_1187 153
242 3300037471 Ga0395905_0062416 Ga0395905_0062416_752_1234 153
243 3300037471 Ga0395905_0487785 Ga0395905_0487785_635_1105 153
244 3300038443 Ga0395901_0015383 Ga0395901_0015383_316_798 153
245 3300038443 Ga0395901_0144886 Ga0395901_0144886_1154_1624 153
246 3300038443 Ga0395901_0198156 Ga0395901_0198156_187_657 153
247 3300041405 Ga0439438_016239 Ga0439438_016239_22_504 153
248 3300041406 Ga0439439_0209688 Ga0439439_0209688_52_534 153
249 3300041411 Ga0439466_0009917 Ga0439466_0009917_2744_3229 153
250 3300041411 Ga0439466_0027880 Ga0439466_0027880_74_556 153
251 3300041999 Ga0439433_0000331 Ga0439433_0000331_1039_1524 153
252 3300041999 Ga0439433_0040508 Ga0439433_0040508_170_664 153
253 3300041999 Ga0439433_0100486 Ga0439433_0100486_21_503 153
254 3300042002 Ga0439442_005250 Ga0439442_005250_385_870 153
255 3300042002 Ga0439442_039327 Ga0439442_039327_349_831 153
256 3300042002 Ga0439442_098639 Ga0439442_098639_46_528 153
257 3300042007 Ga0439449_0000523 Ga0439449_0000523_9727_10209 153
258 3300042007 Ga0439449_0025444 Ga0439449_0025444_1570_2052 153
259 3300042007 Ga0439449_0064699 Ga0439449_0064699_700_1182 153
260 3300042010 Ga0439452_042634 Ga0439452_042634_30_524 153
261 3300042014 Ga0439457_000288 Ga0439457_000288_4707_5189 153
262 3300042121 Ga0450919_002256 Ga0450919_002256_1927_2409 153
263 3300042121 Ga0450919_002697 Ga0450919_002697_69_563 153
264 3300042122 Ga0450920_000499 Ga0450920_000499_1636_2130 153
265 3300042122 Ga0450920_013519 Ga0450920_013519_226_708 153
266 3300042128 Ga0450897_033566 Ga0450897_033566_59_553 153
267 3300042146 Ga0450907_000059 Ga0450907_000059_38877_39371 153
268 3300042184 Ga0450908_000450 Ga0450908_000450_44_526 153
269 3300042185 Ga0450909_001149 Ga0450909_001149_1208_1690 153
270 3300042435 Ga0439434_0006080 Ga0439434_0006080_26_520 153
271 3300042435 Ga0439434_0020550 Ga0439434_0020550_275_760 153
272 3300042435 Ga0439434_0186152 Ga0439434_0186152_133_615 153
273 3300042531 Ga0450918_002515 Ga0450918_002515_1009_1491 153
274 3300042531 Ga0450918_003682 Ga0450918_003682_1850_2344 153
275 3300046463 Ga0495653_0016169 Ga0495653_0016169_70_579 153
276 3300046472 Ga0495580_0014941 Ga0495580_0014941_992_1504 153
277 3300046472 Ga0495580_0019032 Ga0495580_0019032_248_718 153
278 3300046472 Ga0495580_0700206 Ga0495580_0700206_108_617 153
279 3300046473 Ga0495582_0069020 Ga0495582_0069020_205_702 153
280 3300046475 Ga0495639_0034660 Ga0495639_0034660_149_646 153
281 3300046476 Ga0495662_0029048 Ga0495662_0029048_1767_2276 153
282 3300046476 Ga0495662_0452331 Ga0495662_0452331_95_592 153
283 3300046477 Ga0495664_0069540 Ga0495664_0069540_436_945 153
284 3300046528 Ga0495642_0384194 Ga0495642_0384194_73_570 153
285 3300046528 Ga0495642_0420059 Ga0495642_0420059_71_541 153
286 3300046531 Ga0495665_0008063 Ga0495665_0008063_2038_2547 153
287 3300046535 Ga0495586_0004000 Ga0495586_0004000_7016_7525 153
288 3300046535 Ga0495586_0042950 Ga0495586_0042950_1435_1932 153
289 3300046535 Ga0495586_0716626 Ga0495586_0716626_51_548 153
290 3300046536 Ga0495587_0009542 Ga0495587_0009542_1337_1846 153
291 3300046543 Ga0495645_0016791 Ga0495645_0016791_4541_5050 153
292 3300046557 Ga0495622_0110571 Ga0495622_0110571_242_739 153
293 3300046558 Ga0495633_0019023 Ga0495633_0019023_82_552 153
294 3300046558 Ga0495633_0348199 Ga0495633_0348199_142_639 153
295 3300046558 Ga0495633_0387546 Ga0495633_0387546_108_578 153
296 3300046559 Ga0495667_0047436 Ga0495667_0047436_2168_2677 153
297 3300046615 Ga0495656_0002363 Ga0495656_0002363_579_1049 153
298 3300046615 Ga0495656_0027928 Ga0495656_0027928_1483_1980 153
299 3300046616 Ga0495668_0322054 Ga0495668_0322054_125_595 153
300 3300046648 Ga0495611_0395264 Ga0495611_0395264_54_524 153
301 3300046663 Ga0495635_0276304 Ga0495635_0276304_423_932 153
302 3300046664 Ga0495659_0024943 Ga0495659_0024943_112_609 153
303 3300046664 Ga0495659_0066137 Ga0495659_0066137_352_822 153
304 3300046674 Ga0495588_0003350 Ga0495588_0003350_1149_1646 153
305 3300046674 Ga0495588_0046455 Ga0495588_0046455_409_906 153
306 3300046674 Ga0495588_0162151 Ga0495588_0162151_50_547 153
307 3300046674 Ga0495588_0598283 Ga0495588_0598283_79_549 153
308 3300046675 Ga0495657_0148278 Ga0495657_0148278_135_644 153
309 3300046691 Ga0495670_0002186 Ga0495670_0002186_4341_4811 153
310 3300046691 Ga0495670_0006950 Ga0495670_0006950_729_1226 153
311 3300046691 Ga0495670_0046943 Ga0495670_0046943_720_1190 153
312 3300046692 Ga0495671_0091143 Ga0495671_0091143_277_747 153
313 3300046809 Ga0495600_0018579 Ga0495600_0018579_3734_4243 153
314 3300047315 Ga0495581_0005635 Ga0495581_0005635_779_1288 153
315 3300047315 Ga0495581_0019025 Ga0495581_0019025_2005_2502 153
316 3300047315 Ga0495581_0053929 Ga0495581_0053929_337_807 153
317 3300047318 Ga0495636_0002578 Ga0495636_0002578_2348_2818 153
318 3300047318 Ga0495636_0192637 Ga0495636_0192637_72_569 153
319 3300047322 Ga0495680_0137114 Ga0495680_0137114_298_807 153
320 3300047322 Ga0495680_0294541 Ga0495680_0294541_34_531 153
321 3300047444 Ga0495675_0394612 Ga0495675_0394612_272_769 153
322 3300047470 Ga0495681_0038306 Ga0495681_0038306_1773_2270 153
323 3300047470 Ga0495681_0139318 Ga0495681_0139318_325_795 153
324 3300047673 Ga0495593_0155440 Ga0495593_0155440_110_607 153
325 3300048090 Ga0495615_0036671 Ga0495615_0036671_551_1021 153
326 3300048903 Ga0496100_0042197 Ga0496100_0042197_2196_2693 153
327 3300048903 Ga0496100_0070740 Ga0496100_0070740_1208_1678 153
328 3300048903 Ga0496100_0087033 Ga0496100_0087033_141_638 153
329 3300048903 Ga0496100_0173780 Ga0496100_0173780_143_640 153
330 3300048904 Ga0496101_0003302 Ga0496101_0003302_5186_5656 153
331 3300048904 Ga0496101_0011775 Ga0496101_0011775_2094_2591 153
332 3300048904 Ga0496101_0372830 Ga0496101_0372830_280_777 153
333 3300048905 Ga0496102_0027524 Ga0496102_0027524_3029_3511 153
334 3300048905 Ga0496102_0032422 Ga0496102_0032422_601_1071 153
335 3300048905 Ga0496102_0049204 Ga0496102_0049204_2196_2693 153
336 3300048905 Ga0496102_0058454 Ga0496102_0058454_617_1087 153
337 3300048905 Ga0496102_0066854 Ga0496102_0066854_1090_1560 153
338 3300048905 Ga0496102_0539950 Ga0496102_0539950_540_1037 153
339 3300048905 Ga0496102_0808789 Ga0496102_0808789_209_679 153
340 3300048906 Ga0496103_0016598 Ga0496103_0016598_2437_2907 153
341 3300048906 Ga0496103_0046035 Ga0496103_0046035_1187_1684 153
342 3300048906 Ga0496103_0057741 Ga0496103_0057741_357_827 153
343 3300048906 Ga0496103_0073994 Ga0496103_0073994_310_792 153
344 3300048906 Ga0496103_0098987 Ga0496103_0098987_180_677 153
345 3300048908 Ga0496105_0015304 Ga0496105_0015304_2342_2839 153
346 3300048908 Ga0496105_0133024 Ga0496105_0133024_1358_1855 153
347 3300048909 Ga0496106_0006176 Ga0496106_0006176_5153_5623 153
348 3300048909 Ga0496106_0017566 Ga0496106_0017566_3870_4367 153
349 3300048909 Ga0496106_0132226 Ga0496106_0132226_36_533 153
350 3300048909 Ga0496106_0163934 Ga0496106_0163934_1081_1563 153
351 3300048909 Ga0496106_0280219 Ga0496106_0280219_450_947 153
352 3300048910 Ga0496107_0003194 Ga0496107_0003194_6582_7052 153
353 3300048910 Ga0496107_0043394 Ga0496107_0043394_2437_2934 153
354 3300048910 Ga0496107_0170981 Ga0496107_0170981_540_1037 153
355 3300048911 Ga0496108_0019315 Ga0496108_0019315_2770_3267 153
356 3300048911 Ga0496108_0040240 Ga0496108_0040240_1668_2165 153
357 3300048912 Ga0496109_0085428 Ga0496109_0085428_2196_2693 153
358 3300048912 Ga0496109_0571729 Ga0496109_0571729_380_877 153
359 3300048913 Ga0496110_0021591 Ga0496110_0021591_2548_3018 153
360 3300048913 Ga0496110_0030824 Ga0496110_0030824_3576_4073 153
361 3300048913 Ga0496110_0495552 Ga0496110_0495552_350_847 153
362 3300048914 Ga0496111_0004720 Ga0496111_0004720_6526_7023 153
363 3300048914 Ga0496111_0014693 Ga0496111_0014693_2376_2846 153
364 3300048914 Ga0496111_0066967 Ga0496111_0066967_945_1442 153
365 3300048915 Ga0496112_0011558 Ga0496112_0011558_1487_1957 153
366 3300048915 Ga0496112_0040442 Ga0496112_0040442_867_1364 153
367 3300048915 Ga0496112_0053465 Ga0496112_0053465_484_954 153
368 3300048915 Ga0496112_0464306 Ga0496112_0464306_556_1026 153
369 3300048916 Ga0496113_0019677 Ga0496113_0019677_1795_2292 153
370 3300048916 Ga0496113_0093826 Ga0496113_0093826_1795_2292 153
371 3300048917 Ga0496114_0009435 Ga0496114_0009435_347_844 153
372 3300048917 Ga0496114_0174785 Ga0496114_0174785_1354_1851 153
373 3300048928 Ga0496125_0028095 Ga0496125_0028095_3198_3695 153
374 3300048928 Ga0496125_0419059 Ga0496125_0419059_230_700 153
375 3300049537 Ga0501321_017083 Ga0501321_017083_185_667 153
376 3300049541 Ga0501325_007165 Ga0501325_007165_250_732 153
377 3300049569 Ga0501032_0013294 Ga0501032_0013294_4224_4703 153
378 3300049571 Ga0501034_0000488 Ga0501034_0000488_4214_4693 153
379 3300049573 Ga0501037_0053343 Ga0501037_0053343_360_842 153
380 3300049574 Ga0501038_0078817 Ga0501038_0078817_274_756 153
381 3300049579 Ga0501043_0249856 Ga0501043_0249856_693_1175 153
382 3300049851 Ga0501212_077463 Ga0501212_077463_92_562 153
383 3300050491 nmdc:mga00v17_835063_c1 nmdc:mga00v17_835063_c1_32_520 153
384 3300059510 Ga0587090_000889 Ga0587090_000889_2198_2680 153
385 3300059630 Ga0587128_032183 Ga0587128_032183_56_538 153
386 3300059643 Ga0587072_000443 Ga0587072_000443_3618_4100 153
387 3300059643 Ga0587072_005159 Ga0587072_005159_241_711 153
388 3300059652 Ga0587107_055159 Ga0587107_055159_23_493 153
389 iso_pu_bacteria 2932426870 2932430692 153
390 iso_pu_bacteria 2933418574 2933422402 153
391 iso_pu_bacteria 2939647034 2939651463 153
392 iso_pu_bacteria 8054107350 8054107860 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

33

156

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eci-assembly4.cif.gz_G structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.8942 6 132
6eci-assembly4.cif.gz_G structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.8787 6 132
3fkh-assembly1.cif.gz_A crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_601736.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.51 a resolution 0.8671 2 136
6eci-assembly7.cif.gz_M structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.8632 9 134
3fkh-assembly1.cif.gz_A crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_601736.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.51 a resolution 0.8607 2 136
ID Description Score Start End Superfamily
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8942 6 132 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8787 6 132 2.30.110.10
3fkhA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8694 2 136 2.30.110.10
3fkhA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.863 2 136 2.30.110.10
af_K7LE88_1237_1369_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8232 69 89 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4P9JD73-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9156 1 137
AF-A0A0K1JFI7-F1-model_v4 Flavin-nucleotide-binding protein 0.9141 1 138
AF-A0A0Q6PJX8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase putative domain-containing protein 0.9088 2 135
AF-A0A0A0IZ39-F1-model_v4 deleted 0.9078 4 136
AF-A0A0Q9KJI6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9064 19 135

Feature Viewer

pLDDT pTM Quality
82.97 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map