F432322

General Info

Members Datasets Scaffolds Average Seq Length
392 219 389 136

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10312341|Ga0207695_103123411
Length 154
Sequence MNHVSVFVLNQESAFDFYVNKLGFKVHTDAPMGPGMRWLTVCPPEQPELEISLMSIDEGMMFSKESAQQMRDLVSKGTFGFGVFECDNLLVTYEELKAKGVEFTKAPTQEFYGFEALFKDDSGNWFSLGQKGXFEDLMMSXFEDEDLFXXXMMC

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
209 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
210 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
215 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.26
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0
Rhizoplane 1.02
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3838444 2162886011 Unclassified 974
2 JGI24739J22299_10113760 3300001989 Bacteria 811
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 JGI24034J26672_10015315 3300002239 Unclassified 1174
5 JGI25162J39368_1001951 3300002737 Bacteria 9291
6 JGI25157J39369_1004485 3300002741 Bacteria 2515
7 JGI25165J46597_1000742 3300003214 Bacteria 25223
8 rootH1_10008281 3300003316 Bacteria 9606
9 rootH1_10163228 3300003316 Bacteria 4464
10 rootH2_10005827 3300003320 Bacteria 117906
11 rootH2_10066872 3300003320 Unclassified 2882
12 rootH2_10182204 3300003320 Bacteria 2712
13 rootH1_10010318 3300003316 Bacteria 4702
14 rootH1_10010318 3300003323 Bacteria 8107
15 rootH1_10058588 3300003323 Bacteria 9000
16 Ga0058862_12658256 3300004803 Bacteria 1893
17 Ga0065714_10175077 3300005288 Bacteria 987
18 Ga0065712_10107329 3300005290 Bacteria 1887
19 Ga0065712_10455027 3300005290 Bacteria 683
20 Ga0065715_10058246 3300005293 Unclassified 981
21 Ga0070658_10000075 3300005327 Bacteria 95412
22 Ga0070658_10037412 3300005327 Bacteria 3913
23 Ga0070658_10176015 3300005327 Bacteria 1799
24 Ga0070676_10000314 3300005328 Bacteria 21903
25 Ga0070676_10466072 3300005328 Unclassified 891
26 Ga0070683_100488037 3300005329 Bacteria 1176
27 Ga0070683_101301628 3300005329 Bacteria 698
28 Ga0070690_100003443 3300005330 Bacteria 8646
29 Ga0070677_10615150 3300005333 Unclassified 603
30 Ga0068869_100039240 3300005334 Bacteria 3380
31 Ga0068869_100349115 3300005334 Unclassified 1205
32 Ga0070666_10001571 3300005335 Bacteria 13875
33 Ga0070680_100016622 3300005336 Bacteria 5792
34 Ga0070682_100316112 3300005337 Unclassified 1151
35 Ga0070682_100701938 3300005337 Unclassified 811
36 Ga0068868_100015156 3300005338 Bacteria 5695
37 Ga0068868_100642014 3300005338 Unclassified 944
38 Ga0070660_100017241 3300005339 Bacteria 5262
39 Ga0070660_100352560 3300005339 Bacteria 1212
40 Ga0070689_100031630 3300005340 Bacteria 4023
41 Ga0070687_100106054 3300005343 Bacteria 1582
42 Ga0070687_100748125 3300005343 Unclassified 687
43 Ga0070661_100020803 3300005344 Bacteria 4681
44 Ga0070669_100812663 3300005353 Bacteria 795
45 Ga0070675_100876152 3300005354 Unclassified 822
46 Ga0070671_100004435 3300005355 Bacteria 11107
47 Ga0070671_100024036 3300005355 Bacteria 4987
48 Ga0070674_100388534 3300005356 Unclassified 1137
49 Ga0070673_100031032 3300005364 Bacteria 4007
50 Ga0070673_100031363 3300005364 Bacteria 3987
51 Ga0070673_100736482 3300005364 Bacteria 907
52 Ga0070673_101218524 3300005364 Unclassified 705
53 Ga0070659_100000869 3300005366 Bacteria 22070
54 Ga0070659_101181716 3300005366 Unclassified 676
55 Ga0070667_100469864 3300005367 Unclassified 1151
56 Ga0070713_100470174 3300005436 Bacteria 1183
57 Ga0070678_100002570 3300005456 Bacteria 9968
58 Ga0070678_101645204 3300005456 Bacteria 603
59 Ga0070662_100043319 3300005457 Bacteria 3220
60 Ga0070662_100120888 3300005457 Unclassified 2007
61 Ga0070662_100301097 3300005457 Bacteria 1303
62 Ga0070681_10174548 3300005458 Bacteria 2071
63 Ga0068867_100000584 3300005459 Bacteria 24179
64 Ga0068867_100036110 3300005459 Bacteria 3585
65 Ga0068867_100072572 3300005459 Bacteria 2577
66 Ga0070685_10013832 3300005466 Bacteria 4266
67 Ga0070679_100058122 3300005530 Bacteria 3854
68 Ga0070684_100522296 3300005535 Bacteria 1100
69 Ga0068853_100004869 3300005539 Bacteria 10440
70 Ga0068853_100012203 3300005539 Bacteria 6987
71 Ga0068853_100017227 3300005539 Bacteria 5963
72 Ga0068853_100017308 3300005539 Bacteria 5951
73 Ga0068853_100026576 3300005539 Bacteria 4861
74 Ga0068853_100276328 3300005539 Bacteria 1548
75 Ga0068853_100809914 3300005539 Bacteria 897
76 Ga0068853_100889063 3300005539 Bacteria 855
77 Ga0070672_100402147 3300005543 Unclassified 1174
78 Ga0070686_100008343 3300005544 Bacteria 5800
79 Ga0070693_100169429 3300005547 Bacteria 1397
80 Ga0070693_100612649 3300005547 Bacteria 787
81 Ga0070665_100000284 3300005548 Bacteria 82062
82 Ga0070665_101906828 3300005548 Bacteria 600
83 Ga0068855_100000109 3300005563 Bacteria 102724
84 Ga0068855_100004474 3300005563 Bacteria 17073
85 Ga0068855_100016854 3300005563 Bacteria 8788
86 Ga0068855_100018067 3300005563 Bacteria 8475
87 Ga0068855_100568287 3300005563 Bacteria 1226
88 Ga0068855_100753423 3300005563 Bacteria 1038
89 Ga0068855_102573159 3300005563 Bacteria 505
90 Ga0070664_100136385 3300005564 Bacteria 2158
91 Ga0070664_100298385 3300005564 Bacteria 1456
92 Ga0070664_101254877 3300005564 Unclassified 699
93 Ga0068854_100159084 3300005578 Bacteria 1748
94 Ga0068854_101235839 3300005578 Bacteria 670
95 Ga0068854_101435047 3300005578 Unclassified 625
96 Ga0068856_100146602 3300005614 Bacteria 2368
97 Ga0068856_101048194 3300005614 Bacteria 833
98 Ga0070702_100006946 3300005615 Bacteria 5389
99 Ga0068852_100000386 3300005616 Bacteria 29492
100 Ga0068852_100028716 3300005616 Bacteria 4558
101 Ga0068852_100128858 3300005616 Bacteria 2327
102 Ga0068852_100219784 3300005616 Bacteria 1806
103 Ga0068859_100001033 3300005617 Bacteria 28515
104 Ga0068864_100011083 3300005618 Bacteria 7450
105 Ga0068864_100077829 3300005618 Unclassified 2901
106 Ga0068864_100108298 3300005618 Bacteria 2473
107 Ga0068866_10248719 3300005718 Bacteria 1087
108 Ga0068851_10079983 3300005834 Bacteria 1705
109 Ga0068851_10094297 3300005834 Bacteria 1580
110 Ga0068870_10368546 3300005840 Bacteria 926
111 Ga0068863_100066198 3300005841 Bacteria 3418
112 Ga0068858_100030224 3300005842 Bacteria 5031
113 Ga0068858_100097787 3300005842 Bacteria 2736
114 Ga0068860_100024122 3300005843 Bacteria 5880
115 Ga0068860_101427724 3300005843 Bacteria 713
116 Ga0070716_100129435 3300006173 Bacteria 1593
117 Ga0070716_100316731 3300006173 Bacteria 1091
118 Ga0075366_10000699 3300006195 Bacteria 15891
119 Ga0075366_10001336 3300006195 Bacteria 12316
120 Ga0075366_10039655 3300006195 Bacteria 2784
121 Ga0097621_100000321 3300006237 Bacteria 32515
122 Ga0097621_100010413 3300006237 Bacteria 6805
123 Ga0097621_100374185 3300006237 Bacteria 1271
124 Ga0068871_100000450 3300006358 Bacteria 28265
125 Ga0068871_100018703 3300006358 Bacteria 5275
126 Ga0068871_100476483 3300006358 Bacteria 1122
127 Ga0068865_100000582 3300006881 Bacteria 20467
128 Ga0068865_100167945 3300006881 Bacteria 1679
129 Ga0068865_101077446 3300006881 Bacteria 707
130 Ga0097620_100001033 3300006931 Bacteria 28515
131 Ga0105251_10020117 3300009011 Bacteria 3512
132 Ga0105240_10026620 3300009093 Bacteria 7589
133 Ga0105240_10027469 3300009093 Bacteria 7448
134 Ga0105240_10034096 3300009093 Bacteria 6569
135 Ga0105240_10139285 3300009093 Bacteria 2902
136 Ga0105240_10956508 3300009093 Bacteria 918
137 Ga0105240_11273702 3300009093 Bacteria 776
138 Ga0105245_10331758 3300009098 Bacteria 1502
139 Ga0105247_10074926 3300009101 Bacteria 2123
140 Ga0105243_10073871 3300009148 Bacteria 2764
141 Ga0105241_10032535 3300009174 Bacteria 3910
142 Ga0105241_10899049 3300009174 Bacteria 822
143 Ga0105241_10959149 3300009174 Bacteria 798
144 Ga0105242_10007191 3300009176 Bacteria 8586
145 Ga0105242_10104168 3300009176 Bacteria 2408
146 Ga0105248_10025733 3300009177 Bacteria 6545
147 Ga0105248_10773724 3300009177 Bacteria 1083
148 Ga0105248_10787256 3300009177 Bacteria 1073
149 Ga0105237_10000418 3300009545 Bacteria 60592
150 Ga0105237_10001162 3300009545 Bacteria 35201
151 Ga0105237_10001504 3300009545 Bacteria 30678
152 Ga0105237_10725025 3300009545 Bacteria 1001
153 Ga0105237_10766185 3300009545 Bacteria 972
154 Ga0105238_10000693 3300009551 Bacteria 35265
155 Ga0105238_11826839 3300009551 Bacteria 640
156 Ga0105239_10000166 3300010375 Bacteria 94743
157 Ga0105239_10034841 3300010375 Bacteria 5529
158 Ga0105239_10035992 3300010375 Bacteria 5435
159 Ga0105239_10069380 3300010375 Bacteria 3873
160 Ga0105239_11427067 3300010375 Unclassified 799
161 Ga0105246_10045883 3300011119 Bacteria 2979
162 Ga0105246_10694583 3300011119 Bacteria 891
163 Ga0105246_11220169 3300011119 Bacteria 693
164 Ga0157373_10033628 3300013100 Unclassified 3687
165 Ga0157371_10294467 3300013102 Bacteria 1174
166 Ga0157371_11129358 3300013102 Unclassified 602
167 Ga0157370_10109944 3300013104 Bacteria 2576
168 Ga0157369_10100118 3300013105 Bacteria 3089
169 Ga0157369_11080709 3300013105 Bacteria 820
170 Ga0157374_10001095 3300013296 Bacteria 23328
171 Ga0157374_10002023 3300013296 Bacteria 17017
172 Ga0157374_10016333 3300013296 Bacteria 6521
173 Ga0157374_10317632 3300013296 Bacteria 1543
174 Ga0157378_10005755 3300013297 Bacteria 10858
175 Ga0157378_10015219 3300013297 Bacteria 6737
176 Ga0157378_10039555 3300013297 Bacteria 4183
177 Ga0157378_11988927 3300013297 Bacteria 631
178 Ga0163162_10000044 3300013306 Bacteria 128200
179 Ga0163162_10002147 3300013306 Bacteria 18504
180 Ga0163162_10010423 3300013306 Bacteria 9035
181 Ga0163162_10096090 3300013306 Unclassified 3051
182 Ga0163162_10429729 3300013306 Bacteria 1453
183 Ga0163162_10898128 3300013306 Bacteria 999
184 Ga0157372_10237792 3300013307 Bacteria 2113
185 Ga0157372_10463100 3300013307 Bacteria 1477
186 Ga0157372_10870242 3300013307 Unclassified 1046
187 Ga0157375_10005384 3300013308 Bacteria 11119
188 Ga0157375_10007617 3300013308 Bacteria 9470
189 Ga0157375_10028667 3300013308 Bacteria 5224
190 Ga0157375_10073698 3300013308 Bacteria 3433
191 Ga0157375_10305724 3300013308 Bacteria 1754
192 Ga0157375_10797677 3300013308 Bacteria 1093
193 Ga0157375_11198639 3300013308 Unclassified 891
194 Ga0163163_10003900 3300014325 Bacteria 12719
195 Ga0163163_10318296 3300014325 Bacteria 1609
196 Ga0163163_10538249 3300014325 Bacteria 1230
197 Ga0157380_10004885 3300014326 Bacteria 9338
198 Ga0157377_10072979 3300014745 Bacteria 1987
199 Ga0157379_10007793 3300014968 Bacteria 9276
200 Ga0157376_10000059 3300014969 Bacteria 97194
201 Ga0157376_10007339 3300014969 Bacteria 7859
202 Ga0157376_10039578 3300014969 Bacteria 3847
203 Ga0182007_10331820 3300015262 Unclassified 566
204 Ga0163161_10000988 3300017792 Bacteria 21720
205 Ga0213876_10010743 3300021384 Bacteria 4906
206 Ga0209563_113234 3300025230 Bacteria 1096
207 Ga0207427_100122 3300025231 Bacteria 99064
208 Ga0209437_100048 3300025233 Bacteria 405107
209 Ga0209026_1000427 3300025250 Bacteria 35425
210 Ga0209233_1000029 3300025261 Bacteria 641642
211 Ga0207656_10138115 3300025321 Unclassified 1147
212 Ga0207642_10203558 3300025899 Bacteria 1095
213 Ga0207642_10527027 3300025899 Unclassified 727
214 Ga0207680_10007807 3300025903 Bacteria 5229
215 Ga0207647_10209842 3300025904 Bacteria 1125
216 Ga0207647_10339907 3300025904 Unclassified 851
217 Ga0207645_10002444 3300025907 Bacteria 14624
218 Ga0207645_10390095 3300025907 Unclassified 935
219 Ga0207705_10000102 3300025909 Bacteria 98105
220 Ga0207705_10056794 3300025909 Bacteria 2823
221 Ga0207705_10129692 3300025909 Bacteria 1876
222 Ga0207654_10315709 3300025911 Bacteria 1067
223 Ga0207707_10141825 3300025912 Bacteria 2101
224 Ga0207695_10002635 3300025913 Bacteria 26250
225 Ga0207695_10027609 3300025913 Bacteria 6316
226 Ga0207695_10312341 3300025913 Bacteria 1462
227 Ga0207695_10335868 3300025913 Bacteria 1399
228 Ga0207695_10350277 3300025913 Unclassified 1364
229 Ga0207695_11744789 3300025913 Bacteria 503
230 Ga0207671_10003572 3300025914 Bacteria 15392
231 Ga0207671_10028262 3300025914 Bacteria 4191
232 Ga0207671_10877205 3300025914 Bacteria 710
233 Ga0207660_10009697 3300025917 Bacteria 6232
234 Ga0207662_10213059 3300025918 Unclassified 1255
235 Ga0207657_10024374 3300025919 Bacteria 5605
236 Ga0207649_10400060 3300025920 Bacteria 1027
237 Ga0207652_10033807 3300025921 Bacteria 4307
238 Ga0207652_10379966 3300025921 Bacteria 1275
239 Ga0207681_10848859 3300025923 Bacteria 764
240 Ga0207694_10035189 3300025924 Bacteria 3841
241 Ga0207650_10465616 3300025925 Bacteria 1053
242 Ga0207659_10722293 3300025926 Unclassified 854
243 Ga0207644_10011569 3300025931 Bacteria 5842
244 Ga0207644_10012268 3300025931 Bacteria 5688
245 Ga0207690_10000811 3300025932 Bacteria 20049
246 Ga0207706_10084012 3300025933 Bacteria 2799
247 Ga0207706_10403744 3300025933 Unclassified 1185
248 Ga0207686_10089081 3300025934 Bacteria 2033
249 Ga0207670_10020221 3300025936 Bacteria 4086
250 Ga0207669_10431711 3300025937 Bacteria 1039
251 Ga0207669_10513339 3300025937 Bacteria 961
252 Ga0207704_10000016 3300025938 Bacteria 158362
253 Ga0207704_10010688 3300025938 Bacteria 4488
254 Ga0207704_10215061 3300025938 Bacteria 1418
255 Ga0207665_10128710 3300025939 Unclassified 1795
256 Ga0207691_10040278 3300025940 Unclassified 4317
257 Ga0207691_10063176 3300025940 Bacteria 3359
258 Ga0207691_10452430 3300025940 Bacteria 1093
259 Ga0207711_10006631 3300025941 Bacteria 9752
260 Ga0207689_10146227 3300025942 Bacteria 1947
261 Ga0207661_11386584 3300025944 Bacteria 645
262 Ga0207679_10598667 3300025945 Bacteria 993
263 Ga0207679_11181433 3300025945 Unclassified 702
264 Ga0207679_11447813 3300025945 Unclassified 630
265 Ga0207667_10000154 3300025949 Bacteria 102734
266 Ga0207667_10016537 3300025949 Bacteria 8333
267 Ga0207667_10025749 3300025949 Bacteria 6435
268 Ga0207667_10055170 3300025949 Bacteria 4178
269 Ga0207667_10296908 3300025949 Bacteria 1650
270 Ga0207651_10081152 3300025960 Bacteria 2337
271 Ga0207640_10469685 3300025981 Unclassified 1041
272 Ga0207640_10755122 3300025981 Unclassified 839
273 Ga0207640_11342363 3300025981 Bacteria 639
274 Ga0207658_10135733 3300025986 Bacteria 1983
275 Ga0207677_10017246 3300026023 Bacteria 4299
276 Ga0207677_10112734 3300026023 Bacteria 2029
277 Ga0207703_10007035 3300026035 Bacteria 8953
278 Ga0207703_10239397 3300026035 Bacteria 1631
279 Ga0207639_10020239 3300026041 Bacteria 4760
280 Ga0207639_10021254 3300026041 Bacteria 4659
281 Ga0207639_10029462 3300026041 Bacteria 4019
282 Ga0207639_10036295 3300026041 Bacteria 3652
283 Ga0207639_10073821 3300026041 Bacteria 2676
284 Ga0207639_10151296 3300026041 Bacteria 1944
285 Ga0207639_10205376 3300026041 Bacteria 1692
286 Ga0207639_11111444 3300026041 Bacteria 741
287 Ga0207702_10052816 3300026078 Bacteria 3440
288 Ga0207641_10003878 3300026088 Bacteria 13086
289 Ga0207641_10294080 3300026088 Bacteria 1532
290 Ga0207641_10492384 3300026088 Bacteria 1190
291 Ga0207641_10758898 3300026088 Bacteria 958
292 Ga0207648_10001694 3300026089 Bacteria 24136
293 Ga0207648_10156323 3300026089 Bacteria 2013
294 Ga0207676_10008311 3300026095 Bacteria 7377
295 Ga0207676_10071873 3300026095 Unclassified 2779
296 Ga0207676_10082541 3300026095 Bacteria 2615
297 Ga0207675_102557599 3300026118 Unclassified 521
298 Ga0207683_10024786 3300026121 Bacteria 5168
299 Ga0207698_10050289 3300026142 Bacteria 3178
300 Ga0207698_10188111 3300026142 Bacteria 1836
301 Ga0207698_11069045 3300026142 Bacteria 819
302 Ga0210002_1049397 3300027617 Bacteria 724
303 Ga0268266_10000291 3300028379 Bacteria 82093
304 Ga0268265_10548316 3300028380 Bacteria 1097
305 Ga0268264_10080371 3300028381 Bacteria 2784
306 Ga0307517_10006452 3300028786 Bacteria 17363
307 Ga0307515_10000007 3300028794 Bacteria 719669
308 Ga0307515_10001736 3300028794 Bacteria 48546
309 Ga0307515_10022599 3300028794 Bacteria 11073
310 Ga0307515_10145811 3300028794 Bacteria 2508
311 Ga0265338_10048247 3300028800 Bacteria 3877
312 Ga0265327_10116239 3300031251 Bacteria 1272
313 Ga0307513_10568999 3300031456 Bacteria 844
314 Ga0307509_10046173 3300031507 Bacteria 4691
315 Ga0307509_10120591 3300031507 Unclassified 2600
316 Ga0307509_10145320 3300031507 Bacteria 2299
317 Ga0307408_101180245 3300031548 Bacteria 713
318 Ga0307405_10034203 3300031731 Bacteria 3022
319 Ga0307406_10769516 3300031901 Unclassified 810
320 Ga0307407_10070982 3300031903 Bacteria 2072
321 Ga0307416_100053717 3300032002 Unclassified 3234
322 Ga0307414_10605040 3300032004 Bacteria 983
323 Ga0307411_10832188 3300032005 Unclassified 815
324 Ga0307415_100172523 3300032126 Bacteria 1688
325 Ga0307510_10000786 3300033180 Bacteria 32897
326 Ga0307510_10570578 3300033180 Bacteria 580
327 Ga0436365_1734381 3300039437 Bacteria 11979
328 Ga0466959_0101856 3300045049 Unclassified 2056
329 Ga0466967_1334198 3300045976 Unclassified 714
330 Ga0495651_0121830 3300046462 Bacteria 1915
331 Ga0495651_0247854 3300046462 Bacteria 1218
332 Ga0495650_0000014 3300046471 Bacteria 581606
333 Ga0495650_0260284 3300046471 Bacteria 588
334 Ga0495585_0000058 3300046492 Bacteria 112144
335 Ga0495585_0265214 3300046492 Bacteria 853
336 Ga0495583_0284837 3300046506 Bacteria 658
337 Ga0495606_0000528 3300046507 Bacteria 61795
338 Ga0495610_0001048 3300046512 Bacteria 25414
339 Ga0495616_0005539 3300046513 Bacteria 7758
340 Ga0495630_1431893 3300046517 Bacteria 519
341 Ga0495631_0012143 3300046518 Bacteria 4217
342 Ga0495631_0241569 3300046518 Bacteria 770
343 Ga0495632_0503222 3300046519 Unclassified 522
344 Ga0495637_0050523 3300046520 Bacteria 1744
345 Ga0495652_0183785 3300046529 Bacteria 1602
346 Ga0495609_0015989 3300046538 Bacteria 3502
347 Ga0495633_0000172 3300046558 Bacteria 84811
348 Ga0495633_0006348 3300046558 Bacteria 7031
349 Ga0495668_0115655 3300046616 Bacteria 1467
350 Ga0495634_0760978 3300046642 Bacteria 554
351 Ga0495625_0000009 3300046660 Bacteria 404954
352 Ga0495625_0005986 3300046660 Bacteria 10930
353 Ga0495625_0035552 3300046660 Bacteria 3671
354 Ga0495625_0038791 3300046660 Bacteria 3483
355 Ga0495661_0023127 3300046665 Bacteria 4038
356 Ga0495661_0090376 3300046665 Bacteria 1743
357 Ga0495624_0845021 3300046690 Bacteria 540
358 Ga0495649_0000002 3300046694 Bacteria 1093458
359 Ga0495649_0083181 3300046694 Bacteria 1710
360 Ga0495649_0242075 3300046694 Bacteria 929
361 Ga0495589_0123161 3300046794 Bacteria 1248
362 Ga0495600_0471053 3300046809 Bacteria 775
363 Ga0495672_0057639 3300047320 Bacteria 2255
364 Ga0495683_0017193 3300047323 Bacteria 3751
365 Ga0495687_000440 3300047443 Bacteria 51285
366 Ga0495687_115273 3300047443 Bacteria 979
367 Ga0495686_0103687 3300047472 Bacteria 1713
368 Ga0496105_0185712 3300048908 Bacteria 1701
369 Ga0496109_0361336 3300048912 Unclassified 1372
370 Ga0496114_0002330 3300048917 Bacteria 14456
371 Ga0501072_0064405 3300049588 Unclassified 2890
372 Ga0501072_1473056 3300049588 Bacteria 526
373 Ga0501209_099236 3300049656 Bacteria 853
374 Ga0501217_079882 3300049661 Bacteria 904
375 Ga0501227_118983 3300049665 Bacteria 712
376 Ga0501242_034335 3300049674 Bacteria 697
377 Ga0501234_019288 3300049707 Bacteria 1081
378 Ga0501271_035335 3300049768 Unclassified 633
379 nmdc:mga0k408_1086_c3 3300050493 Bacteria 10707
380 nmdc:mga0k408_497_c1 3300050493 Bacteria 21567
381 nmdc:mga0k408_7533_c1 3300050493 Bacteria 5815
382 nmdc:mga07m45_101449_c1 3300050496 Bacteria 1652
383 nmdc:mga08y16_1275247_c1 3300050511 Bacteria 702
384 Ga0500635_0005297 3300053080 Bacteria 3374
385 Ga0500650_0223653 3300053098 Bacteria 851
386 Ga0500608_006533 3300053122 Bacteria 4755
387 Ga0500568_0030931 3300053139 Bacteria 2214
388 Ga0500616_0031718 3300053153 Bacteria 2892
389 Ga0500622_0000720 3300053156 Bacteria 28908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100097787 Ga0068858_1000977872 124
2 3300006881 Ga0068865_100167945 Ga0068865_1001679452 124
3 3300013297 Ga0157378_11988927 Ga0157378_119889272 124
4 3300013308 Ga0157375_10073698 Ga0157375_100736982 124
5 3300014969 Ga0157376_10000059 Ga0157376_1000005952 124
6 3300025938 Ga0207704_10215061 Ga0207704_102150612 124
7 3300026035 Ga0207703_10239397 Ga0207703_102393972 124
8 3300011119 Ga0105246_10694583 Ga0105246_106945831 125
9 3300013308 Ga0157375_10797677 Ga0157375_107976771 125
10 3300031251 Ga0265327_10116239 Ga0265327_101162393 129
11 3300046492 Ga0495585_0265214 Ga0495585_0265214_64_453 129
12 3300046518 Ga0495631_0012143 Ga0495631_0012143_2681_3070 129
13 3300046519 Ga0495632_0503222 Ga0495632_0503222_22_411 129
14 3300046660 Ga0495625_0035552 Ga0495625_0035552_3064_3453 129
15 3300046690 Ga0495624_0845021 Ga0495624_0845021_53_442 129
16 3300046694 Ga0495649_0083181 Ga0495649_0083181_124_513 129
17 3300047323 Ga0495683_0017193 Ga0495683_0017193_2731_3120 129
18 3300053080 Ga0500635_0005297 Ga0500635_0005297_188_583 129
19 3300053098 Ga0500650_0223653 Ga0500650_0223653_252_641 129
20 3300053122 Ga0500608_006533 Ga0500608_006533_2936_3325 129
21 3300002737 JGI25162J39368_1001951 JGI25162J39368_10019512 132
22 3300003214 JGI25165J46597_1000742 JGI25165J46597_100074223 132
23 3300003323 rootH1_10058588 rootH1_100585885 132
24 3300005327 Ga0070658_10037412 Ga0070658_100374125 132
25 3300005327 Ga0070658_10176015 Ga0070658_101760152 132
26 3300005458 Ga0070681_10174548 Ga0070681_101745482 132
27 3300005563 Ga0068855_100753423 Ga0068855_1007534232 132
28 3300005614 Ga0068856_100146602 Ga0068856_1001466022 132
29 3300009093 Ga0105240_10956508 Ga0105240_109565082 132
30 3300011119 Ga0105246_11220169 Ga0105246_112201691 132
31 3300013306 Ga0163162_10002147 Ga0163162_100021479 132
32 3300015262 Ga0182007_10331820 Ga0182007_103318202 132
33 3300025230 Ga0209563_113234 Ga0209563_1132342 132
34 3300025231 Ga0207427_100122 Ga0207427_10012260 132
35 3300025233 Ga0209437_100048 Ga0209437_100048236 132
36 3300025261 Ga0209233_1000029 Ga0209233_1000029140 132
37 3300025904 Ga0207647_10209842 Ga0207647_102098423 132
38 3300025909 Ga0207705_10056794 Ga0207705_100567943 132
39 3300025909 Ga0207705_10129692 Ga0207705_101296922 132
40 3300025912 Ga0207707_10141825 Ga0207707_101418252 132
41 3300025913 Ga0207695_10312341 Ga0207695_103123411 132
42 3300025913 Ga0207695_10350277 Ga0207695_103502772 132
43 3300025914 Ga0207671_10877205 Ga0207671_108772052 132
44 3300025937 Ga0207669_10513339 Ga0207669_105133391 132
45 3300026078 Ga0207702_10052816 Ga0207702_100528163 132
46 3300026142 Ga0207698_10188111 Ga0207698_101881113 132
47 3300031507 Ga0307509_10046173 Ga0307509_100461733 132
48 3300046506 Ga0495583_0284837 Ga0495583_0284837_86_487 132
49 3300046513 Ga0495616_0005539 Ga0495616_0005539_6995_7396 132
50 3300046520 Ga0495637_0050523 Ga0495637_0050523_1184_1585 132
51 3300046529 Ga0495652_0183785 Ga0495652_0183785_1169_1570 132
52 3300046616 Ga0495668_0115655 Ga0495668_0115655_461_862 132
53 3300046642 Ga0495634_0760978 Ga0495634_0760978_140_538 132
54 3300046660 Ga0495625_0000009 Ga0495625_0000009_391814_392215 132
55 3300046665 Ga0495661_0023127 Ga0495661_0023127_318_719 132
56 3300046694 Ga0495649_0000002 Ga0495649_0000002_1006846_1007247 132
57 3300046794 Ga0495589_0123161 Ga0495589_0123161_173_574 132
58 iso_pu_bacteria 2928078545 2928080517 132
59 iso_pu_bacteria 2928147474 2928150705 132
60 iso_pu_bacteria 2932082852 2932083097 132
61 3300046694 Ga0495649_0242075 Ga0495649_0242075_358_786 134
62 3300048917 Ga0496114_0002330 Ga0496114_0002330_8314_8754 134
63 3300049588 Ga0501072_1473056 Ga0501072_1473056_67_483 134
64 2162886011 MRS1b_contig_3838444 MRS1b_0401.00001080 136
65 3300001989 JGI24739J22299_10113760 JGI24739J22299_101137602 136
66 3300002067 JGI24735J21928_10000004 JGI24735J21928_100000044 136
67 3300002239 JGI24034J26672_10015315 JGI24034J26672_100153152 136
68 3300002741 JGI25157J39369_1004485 JGI25157J39369_10044852 136
69 3300003316 rootH1_10008281 rootH1_1000828111 136
70 3300003316 rootH1_10163228 rootH1_101632283 136
71 3300003320 rootH2_10005827 rootH2_1000582744 136
72 3300003320 rootH2_10066872 rootH2_100668722 136
73 3300003320 rootH2_10182204 rootH2_101822043 136
74 3300003323 rootH1_10010318 rootH1_100103185 136
75 3300004803 Ga0058862_12658256 Ga0058862_126582561 136
76 3300005288 Ga0065714_10175077 Ga0065714_101750771 136
77 3300005290 Ga0065712_10107329 Ga0065712_101073293 136
78 3300005290 Ga0065712_10455027 Ga0065712_104550272 136
79 3300005293 Ga0065715_10058246 Ga0065715_100582462 136
80 3300005327 Ga0070658_10000075 Ga0070658_1000007552 136
81 3300005328 Ga0070676_10000314 Ga0070676_1000031415 136
82 3300005328 Ga0070676_10466072 Ga0070676_104660722 136
83 3300005329 Ga0070683_100488037 Ga0070683_1004880373 136
84 3300005329 Ga0070683_101301628 Ga0070683_1013016282 136
85 3300005330 Ga0070690_100003443 Ga0070690_1000034438 136
86 3300005333 Ga0070677_10615150 Ga0070677_106151501 136
87 3300005334 Ga0068869_100039240 Ga0068869_1000392404 136
88 3300005334 Ga0068869_100349115 Ga0068869_1003491152 136
89 3300005335 Ga0070666_10001571 Ga0070666_100015719 136
90 3300005336 Ga0070680_100016622 Ga0070680_1000166223 136
91 3300005337 Ga0070682_100316112 Ga0070682_1003161121 136
92 3300005337 Ga0070682_100701938 Ga0070682_1007019382 136
93 3300005338 Ga0068868_100015156 Ga0068868_1000151564 136
94 3300005338 Ga0068868_100642014 Ga0068868_1006420141 136
95 3300005339 Ga0070660_100017241 Ga0070660_1000172413 136
96 3300005339 Ga0070660_100352560 Ga0070660_1003525602 136
97 3300005340 Ga0070689_100031630 Ga0070689_1000316304 136
98 3300005343 Ga0070687_100106054 Ga0070687_1001060543 136
99 3300005343 Ga0070687_100748125 Ga0070687_1007481252 136
100 3300005344 Ga0070661_100020803 Ga0070661_1000208036 136
101 3300005353 Ga0070669_100812663 Ga0070669_1008126631 136
102 3300005354 Ga0070675_100876152 Ga0070675_1008761521 136
103 3300005355 Ga0070671_100004435 Ga0070671_1000044356 136
104 3300005355 Ga0070671_100024036 Ga0070671_1000240366 136
105 3300005356 Ga0070674_100388534 Ga0070674_1003885342 136
106 3300005364 Ga0070673_100031032 Ga0070673_1000310323 136
107 3300005364 Ga0070673_100031363 Ga0070673_1000313632 136
108 3300005364 Ga0070673_100736482 Ga0070673_1007364822 136
109 3300005364 Ga0070673_101218524 Ga0070673_1012185241 136
110 3300005366 Ga0070659_100000869 Ga0070659_1000008695 136
111 3300005366 Ga0070659_101181716 Ga0070659_1011817161 136
112 3300005367 Ga0070667_100469864 Ga0070667_1004698641 136
113 3300005436 Ga0070713_100470174 Ga0070713_1004701742 136
114 3300005456 Ga0070678_100002570 Ga0070678_1000025708 136
115 3300005456 Ga0070678_101645204 Ga0070678_1016452041 136
116 3300005457 Ga0070662_100043319 Ga0070662_1000433193 136
117 3300005457 Ga0070662_100120888 Ga0070662_1001208882 136
118 3300005457 Ga0070662_100301097 Ga0070662_1003010972 136
119 3300005459 Ga0068867_100000584 Ga0068867_10000058416 136
120 3300005459 Ga0068867_100036110 Ga0068867_1000361103 136
121 3300005459 Ga0068867_100072572 Ga0068867_1000725723 136
122 3300005466 Ga0070685_10013832 Ga0070685_100138322 136
123 3300005530 Ga0070679_100058122 Ga0070679_1000581223 136
124 3300005535 Ga0070684_100522296 Ga0070684_1005222962 136
125 3300005539 Ga0068853_100004869 Ga0068853_1000048699 136
126 3300005539 Ga0068853_100012203 Ga0068853_1000122038 136
127 3300005539 Ga0068853_100017227 Ga0068853_1000172275 136
128 3300005539 Ga0068853_100017308 Ga0068853_1000173086 136
129 3300005539 Ga0068853_100026576 Ga0068853_1000265764 136
130 3300005539 Ga0068853_100276328 Ga0068853_1002763282 136
131 3300005539 Ga0068853_100809914 Ga0068853_1008099142 136
132 3300005539 Ga0068853_100889063 Ga0068853_1008890631 136
133 3300005543 Ga0070672_100402147 Ga0070672_1004021471 136
134 3300005544 Ga0070686_100008343 Ga0070686_1000083438 136
135 3300005547 Ga0070693_100169429 Ga0070693_1001694292 136
136 3300005547 Ga0070693_100612649 Ga0070693_1006126491 136
137 3300005548 Ga0070665_100000284 Ga0070665_10000028425 136
138 3300005548 Ga0070665_101906828 Ga0070665_1019068282 136
139 3300005563 Ga0068855_100000109 Ga0068855_10000010923 136
140 3300005563 Ga0068855_100004474 Ga0068855_1000044746 136
141 3300005563 Ga0068855_100016854 Ga0068855_1000168545 136
142 3300005563 Ga0068855_100018067 Ga0068855_1000180678 136
143 3300005563 Ga0068855_100568287 Ga0068855_1005682873 136
144 3300005563 Ga0068855_102573159 Ga0068855_1025731591 136
145 3300005564 Ga0070664_100136385 Ga0070664_1001363853 136
146 3300005564 Ga0070664_100298385 Ga0070664_1002983852 136
147 3300005564 Ga0070664_101254877 Ga0070664_1012548771 136
148 3300005578 Ga0068854_100159084 Ga0068854_1001590842 136
149 3300005578 Ga0068854_101235839 Ga0068854_1012358392 136
150 3300005578 Ga0068854_101435047 Ga0068854_1014350472 136
151 3300005614 Ga0068856_101048194 Ga0068856_1010481942 136
152 3300005615 Ga0070702_100006946 Ga0070702_1000069467 136
153 3300005616 Ga0068852_100000386 Ga0068852_10000038621 136
154 3300005616 Ga0068852_100028716 Ga0068852_1000287163 136
155 3300005616 Ga0068852_100128858 Ga0068852_1001288584 136
156 3300005616 Ga0068852_100219784 Ga0068852_1002197843 136
157 3300005617 Ga0068859_100001033 Ga0068859_10000103310 136
158 3300005618 Ga0068864_100011083 Ga0068864_1000110834 136
159 3300005618 Ga0068864_100077829 Ga0068864_1000778292 136
160 3300005618 Ga0068864_100108298 Ga0068864_1001082983 136
161 3300005718 Ga0068866_10248719 Ga0068866_102487192 136
162 3300005834 Ga0068851_10079983 Ga0068851_100799832 136
163 3300005834 Ga0068851_10094297 Ga0068851_100942973 136
164 3300005840 Ga0068870_10368546 Ga0068870_103685462 136
165 3300005841 Ga0068863_100066198 Ga0068863_1000661984 136
166 3300005842 Ga0068858_100030224 Ga0068858_1000302245 136
167 3300005843 Ga0068860_100024122 Ga0068860_1000241223 136
168 3300005843 Ga0068860_101427724 Ga0068860_1014277242 136
169 3300006173 Ga0070716_100129435 Ga0070716_1001294352 136
170 3300006173 Ga0070716_100316731 Ga0070716_1003167312 136
171 3300006195 Ga0075366_10000699 Ga0075366_100006994 136
172 3300006195 Ga0075366_10001336 Ga0075366_1000133612 136
173 3300006195 Ga0075366_10039655 Ga0075366_100396556 136
174 3300006237 Ga0097621_100000321 Ga0097621_1000003219 136
175 3300006237 Ga0097621_100010413 Ga0097621_1000104134 136
176 3300006237 Ga0097621_100374185 Ga0097621_1003741852 136
177 3300006358 Ga0068871_100000450 Ga0068871_1000004509 136
178 3300006358 Ga0068871_100018703 Ga0068871_1000187035 136
179 3300006358 Ga0068871_100476483 Ga0068871_1004764832 136
180 3300006881 Ga0068865_100000582 Ga0068865_1000005824 136
181 3300006881 Ga0068865_101077446 Ga0068865_1010774461 136
182 3300006931 Ga0097620_100001033 Ga0097620_10000103316 136
183 3300009011 Ga0105251_10020117 Ga0105251_100201171 136
184 3300009093 Ga0105240_10026620 Ga0105240_100266202 136
185 3300009093 Ga0105240_10027469 Ga0105240_100274695 136
186 3300009093 Ga0105240_10034096 Ga0105240_100340966 136
187 3300009093 Ga0105240_10139285 Ga0105240_101392853 136
188 3300009093 Ga0105240_11273702 Ga0105240_112737022 136
189 3300009098 Ga0105245_10331758 Ga0105245_103317581 136
190 3300009101 Ga0105247_10074926 Ga0105247_100749262 136
191 3300009148 Ga0105243_10073871 Ga0105243_100738712 136
192 3300009174 Ga0105241_10032535 Ga0105241_100325353 136
193 3300009174 Ga0105241_10899049 Ga0105241_108990492 136
194 3300009174 Ga0105241_10959149 Ga0105241_109591491 136
195 3300009176 Ga0105242_10007191 Ga0105242_100071914 136
196 3300009176 Ga0105242_10104168 Ga0105242_101041684 136
197 3300009177 Ga0105248_10025733 Ga0105248_100257338 136
198 3300009177 Ga0105248_10773724 Ga0105248_107737242 136
199 3300009177 Ga0105248_10787256 Ga0105248_107872562 136
200 3300009545 Ga0105237_10000418 Ga0105237_1000041823 136
201 3300009545 Ga0105237_10001162 Ga0105237_1000116231 136
202 3300009545 Ga0105237_10001504 Ga0105237_1000150429 136
203 3300009545 Ga0105237_10725025 Ga0105237_107250252 136
204 3300009545 Ga0105237_10766185 Ga0105237_107661851 136
205 3300009551 Ga0105238_10000693 Ga0105238_1000069319 136
206 3300009551 Ga0105238_11826839 Ga0105238_118268392 136
207 3300010375 Ga0105239_10000166 Ga0105239_1000016618 136
208 3300010375 Ga0105239_10034841 Ga0105239_100348413 136
209 3300010375 Ga0105239_10035992 Ga0105239_100359923 136
210 3300010375 Ga0105239_10069380 Ga0105239_100693805 136
211 3300010375 Ga0105239_11427067 Ga0105239_114270672 136
212 3300011119 Ga0105246_10045883 Ga0105246_100458834 136
213 3300013100 Ga0157373_10033628 Ga0157373_100336284 136
214 3300013102 Ga0157371_10294467 Ga0157371_102944672 136
215 3300013102 Ga0157371_11129358 Ga0157371_111293581 136
216 3300013104 Ga0157370_10109944 Ga0157370_101099443 136
217 3300013105 Ga0157369_10100118 Ga0157369_101001183 136
218 3300013105 Ga0157369_11080709 Ga0157369_110807092 136
219 3300013296 Ga0157374_10001095 Ga0157374_1000109514 136
220 3300013296 Ga0157374_10002023 Ga0157374_1000202314 136
221 3300013296 Ga0157374_10016333 Ga0157374_100163335 136
222 3300013296 Ga0157374_10317632 Ga0157374_103176323 136
223 3300013297 Ga0157378_10005755 Ga0157378_100057559 136
224 3300013297 Ga0157378_10015219 Ga0157378_100152194 136
225 3300013297 Ga0157378_10039555 Ga0157378_100395553 136
226 3300013306 Ga0163162_10000044 Ga0163162_1000004434 136
227 3300013306 Ga0163162_10010423 Ga0163162_100104238 136
228 3300013306 Ga0163162_10096090 Ga0163162_100960903 136
229 3300013306 Ga0163162_10429729 Ga0163162_104297293 136
230 3300013306 Ga0163162_10898128 Ga0163162_108981282 136
231 3300013307 Ga0157372_10237792 Ga0157372_102377924 136
232 3300013307 Ga0157372_10463100 Ga0157372_104631002 136
233 3300013307 Ga0157372_10870242 Ga0157372_108702421 136
234 3300013308 Ga0157375_10005384 Ga0157375_100053846 136
235 3300013308 Ga0157375_10007617 Ga0157375_100076174 136
236 3300013308 Ga0157375_10028667 Ga0157375_100286676 136
237 3300013308 Ga0157375_10305724 Ga0157375_103057242 136
238 3300013308 Ga0157375_11198639 Ga0157375_111986392 136
239 3300014325 Ga0163163_10003900 Ga0163163_100039007 136
240 3300014325 Ga0163163_10318296 Ga0163163_103182962 136
241 3300014325 Ga0163163_10538249 Ga0163163_105382492 136
242 3300014326 Ga0157380_10004885 Ga0157380_100048853 136
243 3300014745 Ga0157377_10072979 Ga0157377_100729794 136
244 3300014968 Ga0157379_10007793 Ga0157379_100077936 136
245 3300014969 Ga0157376_10007339 Ga0157376_100073394 136
246 3300014969 Ga0157376_10039578 Ga0157376_100395783 136
247 3300017792 Ga0163161_10000988 Ga0163161_100009888 136
248 3300021384 Ga0213876_10010743 Ga0213876_100107435 136
249 3300025250 Ga0209026_1000427 Ga0209026_10004279 136
250 3300025321 Ga0207656_10138115 Ga0207656_101381153 136
251 3300025899 Ga0207642_10203558 Ga0207642_102035583 136
252 3300025899 Ga0207642_10527027 Ga0207642_105270271 136
253 3300025903 Ga0207680_10007807 Ga0207680_100078074 136
254 3300025904 Ga0207647_10339907 Ga0207647_103399072 136
255 3300025907 Ga0207645_10002444 Ga0207645_100024449 136
256 3300025907 Ga0207645_10390095 Ga0207645_103900951 136
257 3300025909 Ga0207705_10000102 Ga0207705_1000010252 136
258 3300025911 Ga0207654_10315709 Ga0207654_103157092 136
259 3300025913 Ga0207695_10002635 Ga0207695_1000263521 136
260 3300025913 Ga0207695_10027609 Ga0207695_100276096 136
261 3300025913 Ga0207695_10335868 Ga0207695_103358682 136
262 3300025913 Ga0207695_11744789 Ga0207695_117447891 136
263 3300025914 Ga0207671_10003572 Ga0207671_1000357216 136
264 3300025914 Ga0207671_10028262 Ga0207671_100282624 136
265 3300025917 Ga0207660_10009697 Ga0207660_100096974 136
266 3300025918 Ga0207662_10213059 Ga0207662_102130592 136
267 3300025919 Ga0207657_10024374 Ga0207657_100243742 136
268 3300025920 Ga0207649_10400060 Ga0207649_104000602 136
269 3300025921 Ga0207652_10033807 Ga0207652_100338074 136
270 3300025921 Ga0207652_10379966 Ga0207652_103799663 136
271 3300025923 Ga0207681_10848859 Ga0207681_108488592 136
272 3300025924 Ga0207694_10035189 Ga0207694_100351894 136
273 3300025925 Ga0207650_10465616 Ga0207650_104656161 136
274 3300025926 Ga0207659_10722293 Ga0207659_107222931 136
275 3300025931 Ga0207644_10011569 Ga0207644_100115696 136
276 3300025931 Ga0207644_10012268 Ga0207644_100122686 136
277 3300025932 Ga0207690_10000811 Ga0207690_1000081115 136
278 3300025933 Ga0207706_10084012 Ga0207706_100840123 136
279 3300025933 Ga0207706_10403744 Ga0207706_104037442 136
280 3300025934 Ga0207686_10089081 Ga0207686_100890812 136
281 3300025936 Ga0207670_10020221 Ga0207670_100202213 136
282 3300025937 Ga0207669_10431711 Ga0207669_104317112 136
283 3300025938 Ga0207704_10000016 Ga0207704_10000016118 136
284 3300025938 Ga0207704_10010688 Ga0207704_100106885 136
285 3300025939 Ga0207665_10128710 Ga0207665_101287102 136
286 3300025940 Ga0207691_10040278 Ga0207691_100402788 136
287 3300025940 Ga0207691_10063176 Ga0207691_100631764 136
288 3300025940 Ga0207691_10452430 Ga0207691_104524302 136
289 3300025941 Ga0207711_10006631 Ga0207711_100066318 136
290 3300025942 Ga0207689_10146227 Ga0207689_101462272 136
291 3300025944 Ga0207661_11386584 Ga0207661_113865841 136
292 3300025945 Ga0207679_10598667 Ga0207679_105986672 136
293 3300025945 Ga0207679_11181433 Ga0207679_111814332 136
294 3300025945 Ga0207679_11447813 Ga0207679_114478131 136
295 3300025949 Ga0207667_10000154 Ga0207667_1000015466 136
296 3300025949 Ga0207667_10016537 Ga0207667_100165375 136
297 3300025949 Ga0207667_10025749 Ga0207667_100257494 136
298 3300025949 Ga0207667_10055170 Ga0207667_100551704 136
299 3300025949 Ga0207667_10296908 Ga0207667_102969082 136
300 3300025960 Ga0207651_10081152 Ga0207651_100811524 136
301 3300025981 Ga0207640_10469685 Ga0207640_104696852 136
302 3300025981 Ga0207640_10755122 Ga0207640_107551222 136
303 3300025981 Ga0207640_11342363 Ga0207640_113423632 136
304 3300025986 Ga0207658_10135733 Ga0207658_101357334 136
305 3300026023 Ga0207677_10017246 Ga0207677_100172464 136
306 3300026023 Ga0207677_10112734 Ga0207677_101127341 136
307 3300026035 Ga0207703_10007035 Ga0207703_100070354 136
308 3300026041 Ga0207639_10020239 Ga0207639_100202393 136
309 3300026041 Ga0207639_10021254 Ga0207639_100212545 136
310 3300026041 Ga0207639_10029462 Ga0207639_100294624 136
311 3300026041 Ga0207639_10036295 Ga0207639_100362952 136
312 3300026041 Ga0207639_10073821 Ga0207639_100738213 136
313 3300026041 Ga0207639_10151296 Ga0207639_101512963 136
314 3300026041 Ga0207639_10205376 Ga0207639_102053762 136
315 3300026041 Ga0207639_11111444 Ga0207639_111114441 136
316 3300026088 Ga0207641_10003878 Ga0207641_100038784 136
317 3300026088 Ga0207641_10294080 Ga0207641_102940802 136
318 3300026088 Ga0207641_10492384 Ga0207641_104923842 136
319 3300026088 Ga0207641_10758898 Ga0207641_107588982 136
320 3300026089 Ga0207648_10001694 Ga0207648_100016948 136
321 3300026089 Ga0207648_10156323 Ga0207648_101563232 136
322 3300026095 Ga0207676_10008311 Ga0207676_100083118 136
323 3300026095 Ga0207676_10071873 Ga0207676_100718734 136
324 3300026095 Ga0207676_10082541 Ga0207676_100825412 136
325 3300026118 Ga0207675_102557599 Ga0207675_1025575991 136
326 3300026121 Ga0207683_10024786 Ga0207683_100247863 136
327 3300026142 Ga0207698_10050289 Ga0207698_100502894 136
328 3300026142 Ga0207698_11069045 Ga0207698_110690452 136
329 3300027617 Ga0210002_1049397 Ga0210002_10493972 136
330 3300028379 Ga0268266_10000291 Ga0268266_1000029124 136
331 3300028380 Ga0268265_10548316 Ga0268265_105483161 136
332 3300028381 Ga0268264_10080371 Ga0268264_100803713 136
333 3300028786 Ga0307517_10006452 Ga0307517_100064525 136
334 3300028794 Ga0307515_10000007 Ga0307515_10000007328 136
335 3300028794 Ga0307515_10001736 Ga0307515_1000173629 136
336 3300028794 Ga0307515_10022599 Ga0307515_100225999 136
337 3300028794 Ga0307515_10145811 Ga0307515_101458113 136
338 3300028800 Ga0265338_10048247 Ga0265338_100482475 136
339 3300031456 Ga0307513_10568999 Ga0307513_105689992 136
340 3300031507 Ga0307509_10120591 Ga0307509_101205913 136
341 3300031507 Ga0307509_10145320 Ga0307509_101453205 136
342 3300031548 Ga0307408_101180245 Ga0307408_1011802451 136
343 3300031731 Ga0307405_10034203 Ga0307405_100342033 136
344 3300031901 Ga0307406_10769516 Ga0307406_107695161 136
345 3300031903 Ga0307407_10070982 Ga0307407_100709822 136
346 3300032002 Ga0307416_100053717 Ga0307416_1000537174 136
347 3300032004 Ga0307414_10605040 Ga0307414_106050402 136
348 3300032005 Ga0307411_10832188 Ga0307411_108321882 136
349 3300032126 Ga0307415_100172523 Ga0307415_1001725233 136
350 3300033180 Ga0307510_10000786 Ga0307510_1000078612 136
351 3300033180 Ga0307510_10570578 Ga0307510_105705781 136
352 3300039437 Ga0436365_1734381 Ga0436365_1734381_9510_9920 136
353 3300045049 Ga0466959_0101856 Ga0466959_0101856_1085_1498 136
354 3300045976 Ga0466967_1334198 Ga0466967_1334198_286_702 136
355 3300046462 Ga0495651_0121830 Ga0495651_0121830_1282_1695 136
356 3300046462 Ga0495651_0247854 Ga0495651_0247854_199_609 136
357 3300046471 Ga0495650_0000014 Ga0495650_0000014_235149_235562 136
358 3300046471 Ga0495650_0260284 Ga0495650_0260284_69_482 136
359 3300046492 Ga0495585_0000058 Ga0495585_0000058_80239_80652 136
360 3300046507 Ga0495606_0000528 Ga0495606_0000528_60400_60813 136
361 3300046512 Ga0495610_0001048 Ga0495610_0001048_22787_23200 136
362 3300046517 Ga0495630_1431893 Ga0495630_1431893_63_482 136
363 3300046518 Ga0495631_0241569 Ga0495631_0241569_32_445 136
364 3300046538 Ga0495609_0015989 Ga0495609_0015989_492_905 136
365 3300046558 Ga0495633_0000172 Ga0495633_0000172_16045_16458 136
366 3300046558 Ga0495633_0006348 Ga0495633_0006348_2294_2707 136
367 3300046660 Ga0495625_0005986 Ga0495625_0005986_8151_8564 136
368 3300046660 Ga0495625_0038791 Ga0495625_0038791_151_567 136
369 3300046665 Ga0495661_0090376 Ga0495661_0090376_242_655 136
370 3300046809 Ga0495600_0471053 Ga0495600_0471053_326_739 136
371 3300047320 Ga0495672_0057639 Ga0495672_0057639_1735_2151 136
372 3300047443 Ga0495687_000440 Ga0495687_000440_37084_37497 136
373 3300047443 Ga0495687_115273 Ga0495687_115273_453_902 136
374 3300047472 Ga0495686_0103687 Ga0495686_0103687_1022_1432 136
375 3300048908 Ga0496105_0185712 Ga0496105_0185712_732_1142 136
376 3300048912 Ga0496109_0361336 Ga0496109_0361336_267_677 136
377 3300049588 Ga0501072_0064405 Ga0501072_0064405_767_1177 136
378 3300049656 Ga0501209_099236 Ga0501209_099236_100_516 136
379 3300049661 Ga0501217_079882 Ga0501217_079882_338_754 136
380 3300049665 Ga0501227_118983 Ga0501227_118983_227_643 136
381 3300049674 Ga0501242_034335 Ga0501242_034335_91_507 136
382 3300049707 Ga0501234_019288 Ga0501234_019288_198_614 136
383 3300049768 Ga0501271_035335 Ga0501271_035335_91_507 136
384 3300050493 nmdc:mga0k408_1086_c3 nmdc:mga0k408_1086_c3_9943_10353 136
385 3300050493 nmdc:mga0k408_497_c1 nmdc:mga0k408_497_c1_17819_18232 136
386 3300050493 nmdc:mga0k408_7533_c1 nmdc:mga0k408_7533_c1_2142_2555 136
387 3300050496 nmdc:mga07m45_101449_c1 nmdc:mga07m45_101449_c1_113_526 136
388 3300050511 nmdc:mga08y16_1275247_c1 nmdc:mga08y16_1275247_c1_31_441 136
389 3300053139 Ga0500568_0030931 Ga0500568_0030931_99_515 136
390 3300053153 Ga0500616_0031718 Ga0500616_0031718_509_922 136
391 3300053156 Ga0500622_0000720 Ga0500622_0000720_24466_24876 136
392 iso_pu_bacteria 2599185184 2599478431 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

128

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9536 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9497 1 133
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9466 1 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9461 2 134
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9292 1 133
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8859 83 132 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8728 1 136 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.866 1 136 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8638 83 134 3.30.720.110
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8518 2 135 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7Y5QQ45-F1-model_v4 deleted 0.9795 1 136
AF-A0A7V9M1E1-F1-model_v4 VOC family protein 0.9776 53 136
AF-A0A4Q3SET9-F1-model_v4 VOC family protein 0.9715 1 133 GO:0016020
AF-A0A4Q5QW41-F1-model_v4 VOC family protein 0.9683 1 133
AF-A0A7V9M1E1-F1-model_v4 VOC family protein 0.9663 53 136

Feature Viewer

pLDDT pTM Quality
94.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map