F432303

General Info

Members Datasets Scaffolds Average Seq Length
392 239 784 76

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12630018|Ga0105249_126300181
Length 83
Sequence VLAGEQPVTRQKLVVTTGSLIGGAIGLFAPVGVVKWLLRSEPEDAGILTLFFLPVWCLLLILGLLIGRRLGLLVTGGKRVMPR

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
220 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
230 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
233 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
236 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 0
Rhizoplane 8.42
Rhizosphere 79.34
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_12630018 3300009553 Bacteria 575
2 JGI24738J21930_10142848 3300002075 Bacteria 529
3 JGI25406J46586_10020049 3300003203 Bacteria 2713
4 JGI25406J46586_10031717 3300003203 Bacteria 1973
5 rootL2_10148200 3300003322 Bacteria 1904
6 JGI25404J52841_10003651 3300003659 Bacteria 3057
7 JGI25404J52841_10009531 3300003659 Bacteria 2077
8 JGI25404J52841_10023510 3300003659 Bacteria 1329
9 JGI25404J52841_10023958 3300003659 Bacteria 1316
10 JGI25405J52794_10008418 3300003911 Bacteria 1926
11 Ga0058860_12096582 3300004801 Bacteria 517
12 Ga0065712_10400882 3300005290 Bacteria 731
13 Ga0070658_10075927 3300005327 Bacteria 2757
14 Ga0070658_10126898 3300005327 Bacteria 2124
15 Ga0070683_100154820 3300005329 Bacteria 2174
16 Ga0070683_101487153 3300005329 Bacteria 651
17 Ga0070690_100138201 3300005330 Bacteria 1652
18 Ga0070670_100737863 3300005331 Bacteria 887
19 Ga0070682_100235505 3300005337 Bacteria 1311
20 Ga0068868_100023788 3300005338 Bacteria 4639
21 Ga0068868_100243213 3300005338 Bacteria 1512
22 Ga0068868_100769967 3300005338 Bacteria 866
23 Ga0068868_100794874 3300005338 Bacteria 853
24 Ga0070687_100715925 3300005343 Bacteria 701
25 Ga0070687_100871338 3300005343 Bacteria 643
26 Ga0070668_100013327 3300005347 Bacteria 6136
27 Ga0070668_100635372 3300005347 Bacteria 937
28 Ga0070675_100240989 3300005354 Bacteria 1580
29 Ga0070675_101627800 3300005354 Bacteria 596
30 Ga0070671_100061903 3300005355 Bacteria 3116
31 Ga0070671_101809917 3300005355 Bacteria 543
32 Ga0070674_100446521 3300005356 Bacteria 1066
33 Ga0070673_100553572 3300005364 Bacteria 1045
34 Ga0070688_101105036 3300005365 Bacteria 634
35 Ga0070667_100080838 3300005367 Bacteria 2780
36 Ga0070667_101359322 3300005367 Bacteria 666
37 Ga0070667_101505828 3300005367 Bacteria 632
38 Ga0070701_10801656 3300005438 Bacteria 642
39 Ga0070708_100511579 3300005445 Bacteria 1133
40 Ga0070663_100059182 3300005455 Unclassified 2753
41 Ga0070678_100002219 3300005456 Bacteria 10559
42 Ga0070678_100024249 3300005456 Bacteria 4057
43 Ga0070678_100376738 3300005456 Bacteria 1227
44 Ga0070662_100032307 3300005457 Bacteria 3678
45 Ga0070681_10040215 3300005458 Bacteria 4686
46 Ga0068867_101588369 3300005459 Bacteria 611
47 Ga0070706_100109944 3300005467 Bacteria 2565
48 Ga0070707_100179042 3300005468 Bacteria 2067
49 Ga0070698_101910491 3300005471 Bacteria 547
50 Ga0070679_100094227 3300005530 Bacteria 2981
51 Ga0070684_100243540 3300005535 Bacteria 1643
52 Ga0070684_101959643 3300005535 Bacteria 553
53 Ga0070697_100964165 3300005536 Bacteria 758
54 Ga0068853_100279007 3300005539 Bacteria 1540
55 Ga0068853_100390673 3300005539 Bacteria 1301
56 Ga0068853_102272170 3300005539 Bacteria 526
57 Ga0070672_100662369 3300005543 Bacteria 912
58 Ga0070672_101110183 3300005543 Bacteria 703
59 Ga0070693_100046786 3300005547 Bacteria 2459
60 Ga0070665_100127612 3300005548 Bacteria 2546
61 Ga0070665_100750519 3300005548 Bacteria 989
62 Ga0068855_100012246 3300005563 Bacteria 10366
63 Ga0070664_100345914 3300005564 Bacteria 1352
64 Ga0068854_100491217 3300005578 Bacteria 1032
65 Ga0068854_101376576 3300005578 Bacteria 637
66 Ga0068856_102670113 3300005614 Bacteria 505
67 Ga0070702_100681975 3300005615 Bacteria 781
68 Ga0068852_100044463 3300005616 Bacteria 3772
69 Ga0068852_100213525 3300005616 Bacteria 1832
70 Ga0068852_102577428 3300005616 Bacteria 528
71 Ga0068859_100350524 3300005617 Bacteria 1571
72 Ga0068864_100150221 3300005618 Bacteria 2109
73 Ga0068866_11138168 3300005718 Bacteria 561
74 Ga0068861_100010723 3300005719 Bacteria 6368
75 Ga0068851_10535791 3300005834 Bacteria 706
76 Ga0068870_10105540 3300005840 Bacteria 1600
77 Ga0068858_100481736 3300005842 Bacteria 1197
78 Ga0068860_100163133 3300005843 Bacteria 2149
79 Ga0068860_102381145 3300005843 Bacteria 550
80 Ga0068862_101150548 3300005844 Bacteria 773
81 Ga0081455_10003896 3300005937 Bacteria 16993
82 Ga0081455_10051124 3300005937 Bacteria 3547
83 Ga0081455_10076419 3300005937 Bacteria 2759
84 Ga0081455_10078573 3300005937 Bacteria 2712
85 Ga0081455_10256418 3300005937 Bacteria 1276
86 Ga0081540_1004323 3300005983 Bacteria 10885
87 Ga0081540_1008760 3300005983 Bacteria 7035
88 Ga0081540_1011446 3300005983 Bacteria 5927
89 Ga0081540_1014406 3300005983 Bacteria 5065
90 Ga0081540_1031424 3300005983 Bacteria 2919
91 Ga0081540_1039390 3300005983 Bacteria 2478
92 Ga0081539_10000948 3300005985 Bacteria 54410
93 Ga0081539_10016609 3300005985 Bacteria 5238
94 Ga0070717_11029731 3300006028 Bacteria 750
95 Ga0070717_11883188 3300006028 Unclassified 540
96 Ga0075365_10097420 3300006038 Bacteria 2011
97 Ga0075365_10392323 3300006038 Bacteria 979
98 Ga0075363_100046107 3300006048 Bacteria 2312
99 Ga0075364_10524510 3300006051 Bacteria 810
100 Ga0075364_10961014 3300006051 Bacteria 581
101 Ga0070716_100610700 3300006173 Bacteria 822
102 Ga0070712_100070357 3300006175 Bacteria 2500
103 Ga0075362_10625176 3300006177 Bacteria 558
104 Ga0075367_10391649 3300006178 Bacteria 878
105 Ga0075366_10249851 3300006195 Bacteria 1082
106 Ga0097621_100025100 3300006237 Bacteria 4661
107 Ga0097621_100335026 3300006237 Bacteria 1343
108 Ga0097621_100901156 3300006237 Bacteria 824
109 Ga0075370_10811267 3300006353 Bacteria 571
110 Ga0068871_100153153 3300006358 Bacteria 1967
111 Ga0068871_101264940 3300006358 Bacteria 693
112 Ga0075434_100124525 3300006871 Bacteria 2595
113 Ga0075434_101368666 3300006871 Bacteria 718
114 Ga0068865_100023936 3300006881 Bacteria 4003
115 Ga0068865_100713521 3300006881 Bacteria 858
116 Ga0068865_101899996 3300006881 Bacteria 539
117 Ga0097620_100350529 3300006931 Bacteria 1571
118 Ga0099795_10020968 3300007788 Bacteria 2137
119 Ga0099795_10106897 3300007788 Bacteria 1104
120 Ga0099795_10156313 3300007788 Bacteria 937
121 Ga0105240_10029512 3300009093 Bacteria 7144
122 Ga0105240_10041125 3300009093 Bacteria 5903
123 Ga0105240_12302456 3300009093 Bacteria 558
124 Ga0105245_10025118 3300009098 Bacteria 5238
125 Ga0105245_10143100 3300009098 Bacteria 2254
126 Ga0105245_10450271 3300009098 Bacteria 1296
127 Ga0105245_10566380 3300009098 Bacteria 1159
128 Ga0105247_10064694 3300009101 Bacteria 2273
129 Ga0105247_10088792 3300009101 Bacteria 1959
130 Ga0105243_10932719 3300009148 Bacteria 866
131 Ga0105243_11066667 3300009148 Bacteria 814
132 Ga0105243_12480003 3300009148 Bacteria 557
133 Ga0105241_10051527 3300009174 Bacteria 3139
134 Ga0105242_10592466 3300009176 Bacteria 1069
135 Ga0105242_11170388 3300009176 Bacteria 787
136 Ga0105248_10051094 3300009177 Bacteria 4639
137 Ga0105248_10340096 3300009177 Bacteria 1690
138 Ga0105248_10615252 3300009177 Bacteria 1225
139 Ga0105237_10058554 3300009545 Bacteria 3856
140 Ga0105238_10598650 3300009551 Bacteria 1110
141 Ga0099796_10016974 3300010159 Bacteria 2160
142 Ga0099796_10054293 3300010159 Bacteria 1400
143 Ga0099796_10542147 3300010159 Bacteria 523
144 Ga0105239_10009728 3300010375 Bacteria 10807
145 Ga0105239_10102321 3300010375 Unclassified 3170
146 Ga0105239_12584824 3300010375 Bacteria 592
147 Ga0105246_10041911 3300011119 Bacteria 3097
148 Ga0105246_10075514 3300011119 Bacteria 2386
149 Ga0105246_12012273 3300011119 Bacteria 558
150 Ga0157370_10070126 3300013104 Bacteria 3309
151 Ga0157374_10531408 3300013296 Bacteria 1183
152 Ga0157374_12672716 3300013296 Bacteria 527
153 Ga0157378_10007296 3300013297 Bacteria 9655
154 Ga0157378_10210210 3300013297 Bacteria 1845
155 Ga0157378_10358270 3300013297 Bacteria 1427
156 Ga0157378_10596837 3300013297 Bacteria 1115
157 Ga0163162_10010171 3300013306 Bacteria 9137
158 Ga0163162_10019321 3300013306 Bacteria 6681
159 Ga0163162_10169979 3300013306 Bacteria 2304
160 Ga0163162_11280305 3300013306 Bacteria 833
161 Ga0163162_11320334 3300013306 Bacteria 820
162 Ga0163162_12715059 3300013306 Bacteria 570
163 Ga0157375_10007831 3300013308 Bacteria 9349
164 Ga0157375_10298046 3300013308 Bacteria 1776
165 Ga0157375_10434043 3300013308 Bacteria 1479
166 Ga0163163_10102587 3300014325 Bacteria 2884
167 Ga0163163_10479194 3300014325 Bacteria 1305
168 Ga0163163_11303392 3300014325 Bacteria 788
169 Ga0163163_11903925 3300014325 Bacteria 655
170 Ga0157380_10012402 3300014326 Bacteria 6184
171 Ga0157380_10074695 3300014326 Bacteria 2753
172 Ga0157380_11002231 3300014326 Bacteria 869
173 Ga0157379_10033599 3300014968 Bacteria 4573
174 Ga0157379_10065629 3300014968 Bacteria 3245
175 Ga0157376_10040318 3300014969 Bacteria 3816
176 Ga0157376_10104033 3300014969 Bacteria 2487
177 Ga0163161_10136404 3300017792 Bacteria 1855
178 Ga0163161_10242962 3300017792 Bacteria 1401
179 Ga0163161_10807808 3300017792 Bacteria 789
180 Ga0207697_10518710 3300025315 Bacteria 525
181 Ga0207710_10288846 3300025900 Bacteria 826
182 Ga0207710_10331703 3300025900 Bacteria 773
183 Ga0207680_11121376 3300025903 Bacteria 562
184 Ga0207643_10239775 3300025908 Bacteria 1114
185 Ga0207705_10386154 3300025909 Bacteria 1082
186 Ga0207695_10523327 3300025913 Bacteria 1068
187 Ga0207671_10089816 3300025914 Bacteria 2313
188 Ga0207693_10083819 3300025915 Bacteria 2497
189 Ga0207660_10050633 3300025917 Bacteria 2950
190 Ga0207662_10795698 3300025918 Bacteria 666
191 Ga0207652_10047799 3300025921 Bacteria 3655
192 Ga0207646_10283220 3300025922 Bacteria 1498
193 Ga0207650_10421296 3300025925 Bacteria 1108
194 Ga0207659_10143875 3300025926 Bacteria 1854
195 Ga0207659_11194161 3300025926 Bacteria 654
196 Ga0207687_10402955 3300025927 Bacteria 1125
197 Ga0207687_10483702 3300025927 Bacteria 1031
198 Ga0207687_10536174 3300025927 Bacteria 980
199 Ga0207644_10379320 3300025931 Bacteria 1153
200 Ga0207644_10763423 3300025931 Bacteria 808
201 Ga0207706_10089846 3300025933 Bacteria 2701
202 Ga0207709_10595957 3300025935 Bacteria 874
203 Ga0207709_10888876 3300025935 Bacteria 723
204 Ga0207669_10040786 3300025937 Bacteria 2696
205 Ga0207704_10142458 3300025938 Bacteria 1679
206 Ga0207704_10647559 3300025938 Bacteria 870
207 Ga0207704_11115650 3300025938 Bacteria 671
208 Ga0207665_10503771 3300025939 Bacteria 935
209 Ga0207665_10617452 3300025939 Unclassified 848
210 Ga0207691_10302043 3300025940 Bacteria 1375
211 Ga0207691_10839343 3300025940 Bacteria 771
212 Ga0207691_11502908 3300025940 Bacteria 550
213 Ga0207711_10033729 3300025941 Bacteria 4334
214 Ga0207711_10194696 3300025941 Bacteria 1848
215 Ga0207711_10447621 3300025941 Bacteria 1202
216 Ga0207679_10547226 3300025945 Bacteria 1038
217 Ga0207667_10048313 3300025949 Bacteria 4500
218 Ga0207668_10882307 3300025972 Bacteria 795
219 Ga0207668_11765418 3300025972 Bacteria 558
220 Ga0207640_10415148 3300025981 Bacteria 1100
221 Ga0207677_10103994 3300026023 Bacteria 2098
222 Ga0207677_10797301 3300026023 Bacteria 845
223 Ga0207703_10651576 3300026035 Bacteria 999
224 Ga0207639_10897060 3300026041 Bacteria 828
225 Ga0207678_10007240 3300026067 Bacteria 9840
226 Ga0207678_10187589 3300026067 Bacteria 1767
227 Ga0207676_12031078 3300026095 Bacteria 573
228 Ga0207674_10365459 3300026116 Bacteria 1395
229 Ga0207674_11692227 3300026116 Unclassified 601
230 Ga0207675_101421950 3300026118 Bacteria 714
231 Ga0207683_10012928 3300026121 Bacteria 7128
232 Ga0207683_10036357 3300026121 Bacteria 4288
233 Ga0207683_10486393 3300026121 Bacteria 1139
234 Ga0207683_10966866 3300026121 Bacteria 791
235 Ga0207698_10223228 3300026142 Bacteria 1704
236 Ga0207698_11501356 3300026142 Bacteria 689
237 Ga0207698_12047580 3300026142 Bacteria 586
238 Ga0209179_1054715 3300027512 Bacteria 860
239 Ga0268266_10290296 3300028379 Bacteria 1523
240 Ga0268264_10727115 3300028381 Bacteria 987
241 Ga0307515_10004602 3300028794 Bacteria 28379
242 Ga0307515_10467261 3300028794 Unclassified 875
243 Ga0265328_10453755 3300031239 Bacteria 507
244 Ga0307508_10335259 3300031616 Bacteria 1104
245 Ga0307516_10009101 3300031730 Bacteria 11119
246 Ga0307516_10189281 3300031730 Bacteria 1785
247 Ga0307516_10818574 3300031730 Bacteria 593
248 Ga0307407_10980875 3300031903 Bacteria 652
249 Ga0373930_0052021 3300034816 Bacteria 897
250 Ga0373926_0168379 3300035083 Bacteria 838
251 Ga0373932_0128744 3300035112 Bacteria 851
252 Ga0373932_0143161 3300035112 Bacteria 815
253 Ga0373939_0047877 3300035114 Bacteria 1315
254 Ga0373939_0458799 3300035114 Bacteria 538
255 Ga0373953_0000528 3300035117 Bacteria 10623
256 Ga0373957_0202623 3300035120 Bacteria 827
257 Ga0373946_0197249 3300035171 Bacteria 963
258 Ga0373931_0064368 3300035691 Bacteria 1984
259 Ga0373927_0007132 3300035695 Bacteria 7585
260 Ga0373927_1063334 3300035695 Bacteria 534
261 Ga0373947_0064559 3300035725 Bacteria 2232
262 Ga0373947_0390548 3300035725 Bacteria 938
263 Ga0373937_1462686 3300036401 Bacteria 631
264 Ga0373925_0034913 3300037068 Bacteria 3708
265 Ga0373925_0077821 3300037068 Bacteria 2518
266 Ga0373925_0689427 3300037068 Bacteria 842
267 Ga0451793_0024880 3300041452 Bacteria 578
268 Ga0451833_0818574 3300041491 Bacteria 688
269 Ga0451835_0815785 3300041492 Bacteria 658
270 Ga0451849_0878998 3300041505 Bacteria 677
271 Ga0451843_0407961 3300041509 Bacteria 1254
272 Ga0451843_0998508 3300041509 Bacteria 598
273 Ga0495592_0805548 3300046454 Bacteria 558
274 Ga0495603_0015147 3300046455 Bacteria 4665
275 Ga0495603_0271421 3300046455 Bacteria 976
276 Ga0495603_0625980 3300046455 Bacteria 616
277 Ga0495629_0060596 3300046459 Bacteria 2645
278 Ga0495638_0315956 3300046460 Bacteria 836
279 Ga0495638_0418065 3300046460 Bacteria 692
280 Ga0495638_0529448 3300046460 Bacteria 589
281 Ga0495641_0077537 3300046461 Bacteria 1490
282 Ga0495651_0385874 3300046462 Bacteria 917
283 Ga0495651_0514498 3300046462 Bacteria 765
284 Ga0495651_0725922 3300046462 Bacteria 618
285 Ga0495580_0400580 3300046472 Bacteria 925
286 Ga0495580_0412842 3300046472 Bacteria 909
287 Ga0495582_0700788 3300046473 Bacteria 586
288 Ga0495639_0124099 3300046475 Bacteria 1233
289 Ga0495639_0215954 3300046475 Bacteria 942
290 Ga0495664_0311410 3300046477 Bacteria 950
291 Ga0495664_0444285 3300046477 Bacteria 777
292 Ga0495584_0171959 3300046491 Bacteria 1101
293 Ga0495594_0299026 3300046499 Bacteria 917
294 Ga0495594_0530303 3300046499 Bacteria 668
295 Ga0495583_0301314 3300046506 Bacteria 637
296 Ga0495632_0422143 3300046519 Bacteria 581
297 Ga0495644_0194586 3300046523 Bacteria 781
298 Ga0495609_0298142 3300046538 Bacteria 657
299 Ga0495645_0037516 3300046543 Bacteria 3533
300 Ga0495633_0061659 3300046558 Bacteria 1756
301 Ga0495668_0032857 3300046616 Bacteria 2917
302 Ga0495668_0532228 3300046616 Bacteria 648
303 Ga0495625_0216217 3300046660 Bacteria 1258
304 Ga0495625_0658442 3300046660 Bacteria 623
305 Ga0495625_0900359 3300046660 Bacteria 507
306 Ga0495588_0695683 3300046674 Bacteria 532
307 Ga0495623_0012417 3300046679 Bacteria 5515
308 Ga0495646_0004049 3300046680 Bacteria 9194
309 Ga0495647_0528030 3300046681 Bacteria 551
310 Ga0495669_0175556 3300046684 Bacteria 1020
311 Ga0495669_0361563 3300046684 Unclassified 702
312 Ga0495669_0365182 3300046684 Bacteria 698
313 Ga0495613_0127335 3300046689 Bacteria 1825
314 Ga0495624_0617462 3300046690 Bacteria 646
315 Ga0495624_0951865 3300046690 Bacteria 504
316 Ga0495649_0168438 3300046694 Bacteria 1147
317 Ga0495600_0301448 3300046809 Bacteria 1011
318 Ga0495581_0098121 3300047315 Bacteria 1702
319 Ga0495672_0189979 3300047320 Bacteria 1033
320 Ga0495676_0277273 3300047321 Bacteria 1136
321 Ga0495680_0314387 3300047322 Bacteria 1097
322 Ga0495677_0426941 3300047445 Bacteria 525
323 Ga0495673_0181117 3300047469 Bacteria 798
324 Ga0495673_0208517 3300047469 Bacteria 728
325 Ga0495593_0013032 3300047673 Bacteria 4747
326 Ga0495593_0694606 3300047673 Bacteria 511
327 Ga0496100_0014108 3300048903 Bacteria 4631
328 Ga0496100_0021207 3300048903 Bacteria 3910
329 Ga0496101_0023935 3300048904 Bacteria 4222
330 Ga0496101_0201933 3300048904 Bacteria 1537
331 Ga0496102_0001947 3300048905 Bacteria 17803
332 Ga0496102_0128042 3300048905 Bacteria 2375
333 Ga0496103_0701637 3300048906 Bacteria 641
334 Ga0496104_0016019 3300048907 Bacteria 6806
335 Ga0496104_0025226 3300048907 Bacteria 5479
336 Ga0496105_0017510 3300048908 Bacteria 5747
337 Ga0496105_0032333 3300048908 Bacteria 4292
338 Ga0496106_0055155 3300048909 Bacteria 3003
339 Ga0496106_0173605 3300048909 Bacteria 1709
340 Ga0496107_0059225 3300048910 Bacteria 2771
341 Ga0496107_0230115 3300048910 Bacteria 1379
342 Ga0496108_0100244 3300048911 Bacteria 2470
343 Ga0496109_0155151 3300048912 Bacteria 2144
344 Ga0496109_0171067 3300048912 Bacteria 2038
345 Ga0496109_1683568 3300048912 Bacteria 568
346 Ga0496110_0043265 3300048913 Bacteria 3932
347 Ga0496110_0297677 3300048913 Bacteria 1470
348 Ga0496111_0116394 3300048914 Bacteria 1971
349 Ga0496111_0134628 3300048914 Bacteria 1830
350 Ga0496111_1288711 3300048914 Unclassified 515
351 Ga0496112_0162290 3300048915 Bacteria 2201
352 Ga0496112_0410956 3300048915 Bacteria 1292
353 Ga0496113_0018265 3300048916 Bacteria 4881
354 Ga0496113_0023038 3300048916 Bacteria 4412
355 Ga0496114_0010445 3300048917 Bacteria 7387
356 Ga0496114_0031163 3300048917 Bacteria 4386
357 Ga0496115_0004016 3300048918 Bacteria 10621
358 Ga0496115_0018952 3300048918 Bacteria 5293
359 Ga0496121_0305084 3300048924 Bacteria 1079
360 Ga0496126_0298011 3300048929 Bacteria 1331
361 nmdc:mga03n38_5562_c1 3300050490 Bacteria 4301
362 nmdc:mga03n38_865087_c1 3300050490 Bacteria 529
363 nmdc:mga00v17_847667_c1 3300050491 Bacteria 580
364 nmdc:mga0yw44_252137_c1 3300050492 Bacteria 1175
365 nmdc:mga0yw44_96216_c1 3300050492 Bacteria 1879
366 nmdc:mga0k408_633674_c1 3300050493 Bacteria 629
367 nmdc:mga06z11_451066_c1 3300050494 Bacteria 777
368 nmdc:mga0qj67_300901_c1 3300050509 Bacteria 1299
369 nmdc:mga0n895_186130_c1 3300050512 Bacteria 2107
370 Ga0495601_0140050 3300053077 Bacteria 1578
371 Ga0500610_0092445 3300053079 Bacteria 1571
372 Ga0500635_0345125 3300053080 Bacteria 589
373 Ga0495595_0005595 3300053084 Bacteria 5086
374 Ga0495595_0463218 3300053084 Bacteria 645
375 Ga0495619_0195969 3300053085 Bacteria 1398
376 Ga0500566_0000747 3300053094 Bacteria 18284
377 Ga0500554_036273 3300053102 Bacteria 1488
378 Ga0500595_001753 3300053119 Bacteria 11294
379 Ga0500608_360594 3300053122 Bacteria 511
380 Ga0500658_0474597 3300053134 Bacteria 568
381 Ga0500559_0096496 3300053136 Bacteria 1358
382 Ga0500590_281800 3300053148 Bacteria 638
383 Ga0500603_035117 3300053150 Bacteria 1313
384 Ga0500604_0186528 3300053151 Bacteria 712
385 Ga0500620_192013 3300053155 Bacteria 700
386 Ga0500638_049684 3300053162 Bacteria 2028
387 Ga0500636_0259281 3300053177 Bacteria 881
388 Ga0500637_0030059 3300053178 Bacteria 3018
389 Ga0500601_041238 3300053737 Bacteria 562
390 Ga0500661_001578 3300055283 Bacteria 4302
391 Ga0587073_0261569 3300059492 Bacteria 547
392 Ga0587076_157782 3300059645 Bacteria 556
393 Ga0105249_12630018
394 JGI24738J21930_10142848
395 JGI25406J46586_10020049
396 JGI25406J46586_10031717
397 rootL2_10148200
398 JGI25404J52841_10003651
399 JGI25404J52841_10009531
400 JGI25404J52841_10023510
401 JGI25404J52841_10023958
402 JGI25405J52794_10008418
403 Ga0058860_12096582
404 Ga0065712_10400882
405 Ga0070658_10075927
406 Ga0070658_10126898
407 Ga0070683_100154820
408 Ga0070683_101487153
409 Ga0070690_100138201
410 Ga0070670_100737863
411 Ga0070682_100235505
412 Ga0068868_100023788
413 Ga0068868_100243213
414 Ga0068868_100769967
415 Ga0068868_100794874
416 Ga0070687_100715925
417 Ga0070687_100871338
418 Ga0070668_100013327
419 Ga0070668_100635372
420 Ga0070675_100240989
421 Ga0070675_101627800
422 Ga0070671_100061903
423 Ga0070671_101809917
424 Ga0070674_100446521
425 Ga0070673_100553572
426 Ga0070688_101105036
427 Ga0070667_100080838
428 Ga0070667_101359322
429 Ga0070667_101505828
430 Ga0070701_10801656
431 Ga0070708_100511579
432 Ga0070663_100059182
433 Ga0070678_100002219
434 Ga0070678_100024249
435 Ga0070678_100376738
436 Ga0070662_100032307
437 Ga0070681_10040215
438 Ga0068867_101588369
439 Ga0070706_100109944
440 Ga0070707_100179042
441 Ga0070698_101910491
442 Ga0070679_100094227
443 Ga0070684_100243540
444 Ga0070684_101959643
445 Ga0070697_100964165
446 Ga0068853_100279007
447 Ga0068853_100390673
448 Ga0068853_102272170
449 Ga0070672_100662369
450 Ga0070672_101110183
451 Ga0070693_100046786
452 Ga0070665_100127612
453 Ga0070665_100750519
454 Ga0068855_100012246
455 Ga0070664_100345914
456 Ga0068854_100491217
457 Ga0068854_101376576
458 Ga0068856_102670113
459 Ga0070702_100681975
460 Ga0068852_100044463
461 Ga0068852_100213525
462 Ga0068852_102577428
463 Ga0068859_100350524
464 Ga0068864_100150221
465 Ga0068866_11138168
466 Ga0068861_100010723
467 Ga0068851_10535791
468 Ga0068870_10105540
469 Ga0068858_100481736
470 Ga0068860_100163133
471 Ga0068860_102381145
472 Ga0068862_101150548
473 Ga0081455_10003896
474 Ga0081455_10051124
475 Ga0081455_10076419
476 Ga0081455_10078573
477 Ga0081455_10256418
478 Ga0081540_1004323
479 Ga0081540_1008760
480 Ga0081540_1011446
481 Ga0081540_1014406
482 Ga0081540_1031424
483 Ga0081540_1039390
484 Ga0081539_10000948
485 Ga0081539_10016609
486 Ga0070717_11029731
487 Ga0070717_11883188
488 Ga0075365_10097420
489 Ga0075365_10392323
490 Ga0075363_100046107
491 Ga0075364_10524510
492 Ga0075364_10961014
493 Ga0070716_100610700
494 Ga0070712_100070357
495 Ga0075362_10625176
496 Ga0075367_10391649
497 Ga0075366_10249851
498 Ga0097621_100025100
499 Ga0097621_100335026
500 Ga0097621_100901156
501 Ga0075370_10811267
502 Ga0068871_100153153
503 Ga0068871_101264940
504 Ga0075434_100124525
505 Ga0075434_101368666
506 Ga0068865_100023936
507 Ga0068865_100713521
508 Ga0068865_101899996
509 Ga0097620_100350529
510 Ga0099795_10020968
511 Ga0099795_10106897
512 Ga0099795_10156313
513 Ga0105240_10029512
514 Ga0105240_10041125
515 Ga0105240_12302456
516 Ga0105245_10025118
517 Ga0105245_10143100
518 Ga0105245_10450271
519 Ga0105245_10566380
520 Ga0105247_10064694
521 Ga0105247_10088792
522 Ga0105243_10932719
523 Ga0105243_11066667
524 Ga0105243_12480003
525 Ga0105241_10051527
526 Ga0105242_10592466
527 Ga0105242_11170388
528 Ga0105248_10051094
529 Ga0105248_10340096
530 Ga0105248_10615252
531 Ga0105237_10058554
532 Ga0105238_10598650
533 Ga0099796_10016974
534 Ga0099796_10054293
535 Ga0099796_10542147
536 Ga0105239_10009728
537 Ga0105239_10102321
538 Ga0105239_12584824
539 Ga0105246_10041911
540 Ga0105246_10075514
541 Ga0105246_12012273
542 Ga0157370_10070126
543 Ga0157374_10531408
544 Ga0157374_12672716
545 Ga0157378_10007296
546 Ga0157378_10210210
547 Ga0157378_10358270
548 Ga0157378_10596837
549 Ga0163162_10010171
550 Ga0163162_10019321
551 Ga0163162_10169979
552 Ga0163162_11280305
553 Ga0163162_11320334
554 Ga0163162_12715059
555 Ga0157375_10007831
556 Ga0157375_10298046
557 Ga0157375_10434043
558 Ga0163163_10102587
559 Ga0163163_10479194
560 Ga0163163_11303392
561 Ga0163163_11903925
562 Ga0157380_10012402
563 Ga0157380_10074695
564 Ga0157380_11002231
565 Ga0157379_10033599
566 Ga0157379_10065629
567 Ga0157376_10040318
568 Ga0157376_10104033
569 Ga0163161_10136404
570 Ga0163161_10242962
571 Ga0163161_10807808
572 Ga0207697_10518710
573 Ga0207710_10288846
574 Ga0207710_10331703
575 Ga0207680_11121376
576 Ga0207643_10239775
577 Ga0207705_10386154
578 Ga0207695_10523327
579 Ga0207671_10089816
580 Ga0207693_10083819
581 Ga0207660_10050633
582 Ga0207662_10795698
583 Ga0207652_10047799
584 Ga0207646_10283220
585 Ga0207650_10421296
586 Ga0207659_10143875
587 Ga0207659_11194161
588 Ga0207687_10402955
589 Ga0207687_10483702
590 Ga0207687_10536174
591 Ga0207644_10379320
592 Ga0207644_10763423
593 Ga0207706_10089846
594 Ga0207709_10595957
595 Ga0207709_10888876
596 Ga0207669_10040786
597 Ga0207704_10142458
598 Ga0207704_10647559
599 Ga0207704_11115650
600 Ga0207665_10503771
601 Ga0207665_10617452
602 Ga0207691_10302043
603 Ga0207691_10839343
604 Ga0207691_11502908
605 Ga0207711_10033729
606 Ga0207711_10194696
607 Ga0207711_10447621
608 Ga0207679_10547226
609 Ga0207667_10048313
610 Ga0207668_10882307
611 Ga0207668_11765418
612 Ga0207640_10415148
613 Ga0207677_10103994
614 Ga0207677_10797301
615 Ga0207703_10651576
616 Ga0207639_10897060
617 Ga0207678_10007240
618 Ga0207678_10187589
619 Ga0207676_12031078
620 Ga0207674_10365459
621 Ga0207674_11692227
622 Ga0207675_101421950
623 Ga0207683_10012928
624 Ga0207683_10036357
625 Ga0207683_10486393
626 Ga0207683_10966866
627 Ga0207698_10223228
628 Ga0207698_11501356
629 Ga0207698_12047580
630 Ga0209179_1054715
631 Ga0268266_10290296
632 Ga0268264_10727115
633 Ga0307515_10004602
634 Ga0307515_10467261
635 Ga0265328_10453755
636 Ga0307508_10335259
637 Ga0307516_10009101
638 Ga0307516_10189281
639 Ga0307516_10818574
640 Ga0307407_10980875
641 Ga0373930_0052021
642 Ga0373926_0168379
643 Ga0373932_0128744
644 Ga0373932_0143161
645 Ga0373939_0047877
646 Ga0373939_0458799
647 Ga0373953_0000528
648 Ga0373957_0202623
649 Ga0373946_0197249
650 Ga0373931_0064368
651 Ga0373927_0007132
652 Ga0373927_1063334
653 Ga0373947_0064559
654 Ga0373947_0390548
655 Ga0373937_1462686
656 Ga0373925_0034913
657 Ga0373925_0077821
658 Ga0373925_0689427
659 Ga0451793_0024880
660 Ga0451833_0818574
661 Ga0451835_0815785
662 Ga0451849_0878998
663 Ga0451843_0407961
664 Ga0451843_0998508
665 Ga0495592_0805548
666 Ga0495603_0015147
667 Ga0495603_0271421
668 Ga0495603_0625980
669 Ga0495629_0060596
670 Ga0495638_0315956
671 Ga0495638_0418065
672 Ga0495638_0529448
673 Ga0495641_0077537
674 Ga0495651_0385874
675 Ga0495651_0514498
676 Ga0495651_0725922
677 Ga0495580_0400580
678 Ga0495580_0412842
679 Ga0495582_0700788
680 Ga0495639_0124099
681 Ga0495639_0215954
682 Ga0495664_0311410
683 Ga0495664_0444285
684 Ga0495584_0171959
685 Ga0495594_0299026
686 Ga0495594_0530303
687 Ga0495583_0301314
688 Ga0495632_0422143
689 Ga0495644_0194586
690 Ga0495609_0298142
691 Ga0495645_0037516
692 Ga0495633_0061659
693 Ga0495668_0032857
694 Ga0495668_0532228
695 Ga0495625_0216217
696 Ga0495625_0658442
697 Ga0495625_0900359
698 Ga0495588_0695683
699 Ga0495623_0012417
700 Ga0495646_0004049
701 Ga0495647_0528030
702 Ga0495669_0175556
703 Ga0495669_0361563
704 Ga0495669_0365182
705 Ga0495613_0127335
706 Ga0495624_0617462
707 Ga0495624_0951865
708 Ga0495649_0168438
709 Ga0495600_0301448
710 Ga0495581_0098121
711 Ga0495672_0189979
712 Ga0495676_0277273
713 Ga0495680_0314387
714 Ga0495677_0426941
715 Ga0495673_0181117
716 Ga0495673_0208517
717 Ga0495593_0013032
718 Ga0495593_0694606
719 Ga0496100_0014108
720 Ga0496100_0021207
721 Ga0496101_0023935
722 Ga0496101_0201933
723 Ga0496102_0001947
724 Ga0496102_0128042
725 Ga0496103_0701637
726 Ga0496104_0016019
727 Ga0496104_0025226
728 Ga0496105_0017510
729 Ga0496105_0032333
730 Ga0496106_0055155
731 Ga0496106_0173605
732 Ga0496107_0059225
733 Ga0496107_0230115
734 Ga0496108_0100244
735 Ga0496109_0155151
736 Ga0496109_0171067
737 Ga0496109_1683568
738 Ga0496110_0043265
739 Ga0496110_0297677
740 Ga0496111_0116394
741 Ga0496111_0134628
742 Ga0496111_1288711
743 Ga0496112_0162290
744 Ga0496112_0410956
745 Ga0496113_0018265
746 Ga0496113_0023038
747 Ga0496114_0010445
748 Ga0496114_0031163
749 Ga0496115_0004016
750 Ga0496115_0018952
751 Ga0496121_0305084
752 Ga0496126_0298011
753 nmdc:mga03n38_5562_c1
754 nmdc:mga03n38_865087_c1
755 nmdc:mga00v17_847667_c1
756 nmdc:mga0yw44_252137_c1
757 nmdc:mga0yw44_96216_c1
758 nmdc:mga0k408_633674_c1
759 nmdc:mga06z11_451066_c1
760 nmdc:mga0qj67_300901_c1
761 nmdc:mga0n895_186130_c1
762 Ga0495601_0140050
763 Ga0500610_0092445
764 Ga0500635_0345125
765 Ga0495595_0005595
766 Ga0495595_0463218
767 Ga0495619_0195969
768 Ga0500566_0000747
769 Ga0500554_036273
770 Ga0500595_001753
771 Ga0500608_360594
772 Ga0500658_0474597
773 Ga0500559_0096496
774 Ga0500590_281800
775 Ga0500603_035117
776 Ga0500604_0186528
777 Ga0500620_192013
778 Ga0500638_049684
779 Ga0500636_0259281
780 Ga0500637_0030059
781 Ga0500601_041238
782 Ga0500661_001578
783 Ga0587073_0261569
784 Ga0587076_157782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oq1-assembly1.cif.gz_A tandem sh2 domains of zap-70 with 19-mer zeta1 peptide 0.7316 16 47
7blz-assembly1.cif.gz_K red alga c.merolae photosystem i 0.6051 17 60
7blz-assembly1.cif.gz_K red alga c.merolae photosystem i 0.5291 17 60
7y5d-assembly1.cif.gz_9 cryo-em structure of f-atp synthase from mycolicibacterium smegmatis (rotational state 3) (backbone) 0.4623 7 66
7y5d-assembly1.cif.gz_9 cryo-em structure of f-atp synthase from mycolicibacterium smegmatis (rotational state 3) (backbone) 0.3845 7 66
ID Description Score Start End Superfamily
af_Q2G2M4_4_134_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.762 15 42 1.10.1520.10
2fflA04 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.7205 13 45 1.10.1520.10
4fl3A02 Mainly Alpha;Orthogonal Bundle;Syk Kinase; Chain A, domain 2;Syk Kinase; Chain A, domain 2 0.7159 16 53 1.10.930.10
4fl3A02 Mainly Alpha;Orthogonal Bundle;Syk Kinase; Chain A, domain 2;Syk Kinase; Chain A, domain 2 0.6668 16 53 1.10.930.10
1m61A02 Mainly Alpha;Orthogonal Bundle;Syk Kinase; Chain A, domain 2;Syk Kinase; Chain A, domain 2 0.6311 14 54 1.10.930.10
ID Description Score Start End GO Terms
AF-A0A069IC74-F1-model_v4 Uncharacterized protein 0.6129 9 76 GO:0016020
AF-A0A069IC74-F1-model_v4 Uncharacterized protein 0.5589 9 76 GO:0016020
AF-A0A1Q9D7Y3-F1-model_v4 Uncharacterized protein 0.5008 5 75 GO:0016020
AF-A0A1Q9D7Y3-F1-model_v4 Uncharacterized protein 0.4797 5 75 GO:0016020
AF-A0A222FLE5-F1-model_v4 Uncharacterized protein 0.4001 2 70 GO:0016020

Map