F432189

General Info

Members Datasets Scaffolds Average Seq Length
391 329 135 339

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2867369537|2867374744
Length 365
Sequence VTPVDAHPAPGAAPSPAAGPVRRPEPVRERGTVRERARARALWLLAGLAVLAALALVSLAYGSRDIPWADVWAALGGADTTLGEAAARKRVPRTVLAVLVGAALGLAGAVMQGITRNPLADPGILGVNMGASLAVVTAVAFFGLTSPTGYIWVAMGGAALAAAFVHTVGSLGRGGATPLTLALAGAASSAAFASLVTAVVLPRNDIAGGFRLWQIGGVGGASFDRIGQVAPFLAVGSAISLLSARSLNSLALGDELAAGIGERVALARGTAALGAVVLCGAATAVAGPIGFVGLVVPHTCRLLVGVDHRWLLPFSALLGAALLTAADVVGRVVARPAEVDVGIVTALIGAPFFIWIVRRQKVRAL

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
11 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
12 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
13 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
14 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
15 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
16 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
17 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
18 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
19 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
20 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
21 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
22 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
23 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
24 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
25 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
26 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
27 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
28 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
29 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
30 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
31 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
32 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
33 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
34 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
35 2643221548 Streptomyces sp. Root55 Isolate Unclassified
36 2643221557 Ensifer sp. Root558 Isolate Unclassified
37 2643221578 Streptomyces sp. Root63 Isolate Unclassified
38 2643221582 Rhizobium sp. Root651 Isolate Unclassified
39 2643221599 Rhizobium sp. Root708 Isolate Unclassified
40 2643221610 Ensifer sp. Root74 Isolate Unclassified
41 2643221668 Ensifer sp. Root423 Isolate Unclassified
42 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
43 2643221675 Ensifer sp. Root1298 Isolate Unclassified
44 2643221680 Ensifer sp. Root1312 Isolate Unclassified
45 2643221693 Rhizobium sp. Root491 Isolate Unclassified
46 2643221726 Ensifer sp. Root954 Isolate Unclassified
47 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
48 2738541293 Rhizobium sp. GV031 Isolate Unclassified
49 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
50 2751185800 Brucella pituitosa AA2 Isolate Unclassified
51 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
52 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
53 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
54 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
55 2808606448 Streptomyces sp. 193411 Isolate Unclassified
56 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
57 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
58 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
59 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
60 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
61 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
62 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
63 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
64 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
65 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
66 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
67 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
68 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
69 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
70 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
71 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
72 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
73 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
74 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
75 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
76 2854911287 Brucella lupini LUP21 Isolate Unclassified
77 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
78 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
79 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
80 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
81 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
82 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
83 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
84 2867369537 Streptomyces sp. Z26 Isolate Unclassified
85 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
86 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
87 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
88 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
89 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
90 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
91 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
92 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
93 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
94 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
95 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
96 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
97 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
98 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
99 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
100 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
101 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
102 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
103 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
104 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
105 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
106 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
107 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
108 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
109 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
110 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
111 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
112 2922554459 Rhodococcus sp. 66b Isolate Unclassified
113 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
114 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
115 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
116 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
117 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
118 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
119 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
120 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
121 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
122 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
123 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
124 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
125 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
126 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
127 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
128 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
129 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
130 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
131 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
132 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
133 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
134 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
135 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
136 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
137 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
138 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
139 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
140 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
141 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
142 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
143 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
144 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
145 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
146 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
147 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
148 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
149 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
150 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
151 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
152 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
153 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
154 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
155 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
156 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
157 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
158 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
159 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
160 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
161 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
162 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
163 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
164 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
165 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
166 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
167 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
168 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
169 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
170 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
171 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
172 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
173 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
174 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
175 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
176 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
177 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
178 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
179 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
180 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
181 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
182 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
183 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
184 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
185 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
186 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
187 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
188 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
189 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
190 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
191 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
192 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
193 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
194 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
195 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
196 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
197 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
198 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
199 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
200 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
201 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
202 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
203 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
204 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
205 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
206 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
207 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
208 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
209 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
210 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
211 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
212 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
213 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
214 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
215 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
216 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
217 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
218 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
219 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
220 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
221 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
222 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
223 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
224 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
225 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
226 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
227 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
228 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
229 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
230 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
231 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
232 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
233 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
234 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
235 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
236 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
237 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
238 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
239 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
240 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
241 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
242 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
243 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
244 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
245 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
246 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
247 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
248 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
249 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
250 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
251 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
252 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
253 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
254 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
255 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
256 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
257 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
258 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
259 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
260 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
261 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
262 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
263 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
264 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
265 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
266 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
267 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
269 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
270 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
273 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
276 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
277 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
310 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
311 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
312 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
322 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
323 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
324 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
325 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
326 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
327 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
328 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
329 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 34.27
Metatranscriptomes 0.26
Isolates 65.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.77
Bulb 0
Endosphere 13.81
Nodule 46.8
Rhizoplane 2.05
Rhizosphere 12.02
Stem 0
Stem Tuber 0
Unclassified 24.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001926 3300002773 Bacteria 8272
2 JGI25152J39213_1003492 3300002773 Bacteria 5340
3 JGI25150J39212_1010160 3300002774 Bacteria 1759
4 JGI25151J46595_10000007 3300003187 Bacteria 411751
5 JGI25151J46595_10001532 3300003187 Bacteria 15448
6 JGI25153J46596_10022465 3300003215 Bacteria 2324
7 Ga0006562J51391_1082793 3300003578 Bacteria 2534
8 Ga0055528_1000802 3300003790 Bacteria 21693
9 Ga0058692_1004262 3300003856 Bacteria 4259
10 Ga0070665_100004198 3300005548 Bacteria 15159
11 Ga0075365_10045660 3300006038 Bacteria 2875
12 Ga0075368_10047049 3300006042 Bacteria 1707
13 Ga0075364_10013709 3300006051 Bacteria 4992
14 Ga0075364_10014568 3300006051 Bacteria 4861
15 Ga0075364_10027293 3300006051 Bacteria 3646
16 Ga0075362_10024269 3300006177 Bacteria 2571
17 Ga0075369_10011458 3300006186 Bacteria 3489
18 Ga0075369_10019660 3300006186 Bacteria 2759
19 Ga0075369_10041210 3300006186 Bacteria 1976
20 Ga0075370_10066302 3300006353 Bacteria 2059
21 Ga0099826_10018603 3300006948 Bacteria 5240
22 Ga0157373_10009724 3300013100 Bacteria 7097
23 Ga0157371_10000005 3300013102 Bacteria 416456
24 Ga0157370_10001190 3300013104 Bacteria 32444
25 Ga0207425_1000018 3300025245 Bacteria 411841
26 Ga0207425_1002054 3300025245 Bacteria 7493
27 Ga0209129_1000019 3300025258 Bacteria 460802
28 Ga0209129_1000026 3300025258 Bacteria 411839
29 Ga0209129_1003722 3300025258 Bacteria 6455
30 Ga0209129_1003876 3300025258 Bacteria 6229
31 Ga0209673_1002763 3300025273 Bacteria 11468
32 Ga0209673_1018974 3300025273 Bacteria 2483
33 Ga0209025_1000035 3300025294 Bacteria 411841
34 Ga0209025_1000131 3300025294 Bacteria 198190
35 Ga0209025_1000186 3300025294 Bacteria 155131
36 Ga0209758_1000040 3300025297 Bacteria 411841
37 Ga0209758_1000599 3300025297 Bacteria 55985
38 Ga0209758_1001288 3300025297 Bacteria 30861
39 Ga0209256_1000162 3300025299 Bacteria 137997
40 Ga0209051_1040058 3300025303 Bacteria 1683
41 Ga0209281_1000934 3300027111 Bacteria 24031
42 Ga0209282_1027516 3300027666 Bacteria 3531
43 Ga0268266_10269037 3300028379 Bacteria 1581
44 Ga0307412_10013081 3300031911 Bacteria 4855
45 Ga0307414_10102532 3300032004 Bacteria 2157
46 Ga0466960_0056991 3300044901 Bacteria 1904
47 Ga0495610_0000609 3300046512 Bacteria 35431
48 Ga0495620_0028536 3300046515 Bacteria 2594
49 Ga0495632_0017837 3300046519 Bacteria 3907
50 Ga0495643_0036808 3300046522 Bacteria 2687
51 Ga0495654_0000369 3300046530 Bacteria 39001
52 Ga0495668_0000167 3300046616 Bacteria 97427
53 Ga0495588_0004096 3300046674 Bacteria 6414
54 Ga0495681_0004912 3300047470 Bacteria 9033
55 Ga0495686_0008721 3300047472 Bacteria 7397
56 Ga0496100_0235223 3300048903 Bacteria 1350
57 Ga0496101_0032013 3300048904 Bacteria 3700
58 Ga0496106_0000243 3300048909 Bacteria 37924
59 Ga0496111_0001989 3300048914 Bacteria 12152
60 Ga0496113_0036182 3300048916 Bacteria 3616
61 Ga0496113_0220591 3300048916 Bacteria 1511
62 Ga0496116_0002399 3300048919 Bacteria 19739
63 Ga0496116_0007270 3300048919 Bacteria 9865
64 Ga0496116_0057602 3300048919 Bacteria 2539
65 Ga0496117_0000083 3300048920 Bacteria 218945
66 Ga0496117_0006867 3300048920 Bacteria 11308
67 Ga0496117_0021668 3300048920 Bacteria 5187
68 Ga0496117_0057095 3300048920 Bacteria 2714
69 Ga0496117_0065650 3300048920 Bacteria 2466
70 Ga0496117_0102653 3300048920 Bacteria 1804
71 Ga0496118_0008267 3300048921 Bacteria 10785
72 Ga0496118_0032982 3300048921 Bacteria 4257
73 Ga0496118_0056998 3300048921 Bacteria 2932
74 Ga0496118_0125783 3300048921 Bacteria 1660
75 Ga0496119_0013404 3300048922 Bacteria 6535
76 Ga0496119_0017463 3300048922 Bacteria 5393
77 Ga0496119_0061381 3300048922 Bacteria 2245
78 Ga0496119_0078453 3300048922 Bacteria 1910
79 Ga0496120_0000030 3300048923 Bacteria 226066
80 Ga0496120_0009155 3300048923 Bacteria 7061
81 Ga0496120_0093909 3300048923 Bacteria 1597
82 Ga0496120_0138153 3300048923 Bacteria 1240
83 Ga0496121_0000005 3300048924 Bacteria 1034486
84 Ga0496121_0031089 3300048924 Bacteria 4888
85 Ga0496122_0000020 3300048925 Bacteria 401675
86 Ga0496122_0000050 3300048925 Bacteria 267874
87 Ga0496122_0008286 3300048925 Bacteria 11272
88 Ga0496122_0008584 3300048925 Bacteria 10984
89 Ga0496122_0009718 3300048925 Bacteria 10055
90 Ga0496122_0014613 3300048925 Bacteria 7577
91 Ga0496122_0052908 3300048925 Bacteria 3066
92 Ga0496122_0074253 3300048925 Bacteria 2407
93 Ga0496122_0142143 3300048925 Bacteria 1499
94 Ga0496123_0000003 3300048926 Bacteria 866556
95 Ga0496123_0000052 3300048926 Bacteria 236409
96 Ga0496123_0006828 3300048926 Bacteria 10950
97 Ga0496123_0033616 3300048926 Bacteria 3687
98 Ga0496123_0046074 3300048926 Bacteria 2961
99 Ga0496123_0133116 3300048926 Bacteria 1373
100 Ga0496124_0000091 3300048927 Bacteria 189706
101 Ga0496124_0000943 3300048927 Bacteria 46595
102 Ga0496124_0007535 3300048927 Bacteria 11549
103 Ga0496124_0021234 3300048927 Bacteria 5985
104 Ga0496124_0035527 3300048927 Bacteria 4359
105 Ga0496125_0000107 3300048928 Bacteria 197483
106 Ga0496125_0000275 3300048928 Bacteria 103052
107 Ga0496125_0018188 3300048928 Bacteria 6678
108 Ga0496125_0032928 3300048928 Bacteria 4595
109 Ga0496125_0036413 3300048928 Bacteria 4297
110 Ga0496125_0039952 3300048928 Bacteria 4031
111 Ga0496126_0072079 3300048929 Bacteria 3073
112 Ga0496126_0205962 3300048929 Bacteria 1658
113 Ga0501034_0054293 3300049571 Bacteria 4034
114 Ga0501080_0109039 3300049742 Bacteria 2566
115 nmdc:mga03683_41470_c1 3300050489 Bacteria 1891
116 nmdc:mga03n38_12960_c1 3300050490 Bacteria 3154
117 nmdc:mga03n38_21793_c1 3300050490 Bacteria 2584
118 nmdc:mga00v17_32_c1 3300050491 Bacteria 87395
119 nmdc:mga00v17_36_c1 3300050491 Bacteria 85171
120 nmdc:mga00v17_6191_c1 3300050491 Bacteria 6344
121 nmdc:mga0yw44_51880_c1 3300050492 Bacteria 2485
122 nmdc:mga0yw44_7724_c1 3300050492 Bacteria 5310
123 nmdc:mga0sz30_4892_c1 3300050516 Bacteria 4879
124 Ga0500651_0057192 3300053093 Bacteria 2441
125 Ga0500560_003017 3300053107 Bacteria 3330
126 Ga0500572_017360 3300053111 Bacteria 1848
127 Ga0500618_000090 3300053125 Bacteria 74320
128 Ga0500658_0001709 3300053134 Bacteria 8680
129 Ga0500561_0000568 3300053137 Bacteria 5952
130 Ga0500568_0000571 3300053139 Bacteria 26959
131 Ga0500616_0000298 3300053153 Bacteria 72155
132 Ga0500633_0014617 3300053160 Bacteria 2232
133 Ga0500634_0000011 3300053161 Bacteria 133329
134 Ga0500636_0000034 3300053177 Bacteria 72555
135 Ga0500636_0005628 3300053177 Bacteria 7160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0057095 Ga0496117_0057095_1010_2008 263
2 3300048925 Ga0496122_0014613 Ga0496122_0014613_1355_2353 263
3 3300005548 Ga0070665_100004198 Ga0070665_10000419814 292
4 3300028379 Ga0268266_10269037 Ga0268266_102690372 292
5 3300048916 Ga0496113_0036182 Ga0496113_0036182_670_1707 292
6 3300048923 Ga0496120_0000030 Ga0496120_0000030_79651_80688 292
7 3300048925 Ga0496122_0000050 Ga0496122_0000050_218659_219696 292
8 3300048926 Ga0496123_0000052 Ga0496123_0000052_144918_145955 292
9 3300048928 Ga0496125_0039952 Ga0496125_0039952_2762_3799 292
10 3300013102 Ga0157371_10000005 Ga0157371_10000005203 293
11 3300050489 nmdc:mga03683_41470_c1 nmdc:mga03683_41470_c1_341_1366 296
12 3300006042 Ga0075368_10047049 Ga0075368_100470492 298
13 3300006177 Ga0075362_10024269 Ga0075362_100242692 298
14 3300006186 Ga0075369_10019660 Ga0075369_100196602 298
15 3300013104 Ga0157370_10001190 Ga0157370_100011906 298
16 3300048920 Ga0496117_0000083 Ga0496117_0000083_61331_62368 298
17 3300048921 Ga0496118_0056998 Ga0496118_0056998_1025_2062 298
18 3300048927 Ga0496124_0021234 Ga0496124_0021234_589_1626 298
19 3300050490 nmdc:mga03n38_21793_c1 nmdc:mga03n38_21793_c1_576_1613 298
20 3300050491 nmdc:mga00v17_32_c1 nmdc:mga00v17_32_c1_71813_72850 298
21 3300050492 nmdc:mga0yw44_51880_c1 nmdc:mga0yw44_51880_c1_352_1389 298
22 3300050516 nmdc:mga0sz30_4892_c1 nmdc:mga0sz30_4892_c1_2056_3093 298
23 3300053137 Ga0500561_0000568 Ga0500561_0000568_411_1454 298
24 3300013100 Ga0157373_10009724 Ga0157373_100097242 299
25 3300048920 Ga0496117_0065650 Ga0496117_0065650_960_1880 299
26 3300048921 Ga0496118_0032982 Ga0496118_0032982_2431_3351 299
27 3300006186 Ga0075369_10041210 Ga0075369_100412102 303
28 3300003856 Ga0058692_1004262 Ga0058692_10042622 305
29 3300006948 Ga0099826_10018603 Ga0099826_100186034 305
30 3300027666 Ga0209282_1027516 Ga0209282_10275163 305
31 3300048924 Ga0496121_0031089 Ga0496121_0031089_1012_1932 306
32 3300048925 Ga0496122_0009718 Ga0496122_0009718_5239_6159 306
33 3300048926 Ga0496123_0046074 Ga0496123_0046074_1208_2128 306
34 3300048927 Ga0496124_0035527 Ga0496124_0035527_3216_4136 306
35 3300048928 Ga0496125_0018188 Ga0496125_0018188_4758_5678 306
36 3300053111 Ga0500572_017360 Ga0500572_017360_758_1690 310
37 3300053177 Ga0500636_0005628 Ga0500636_0005628_5930_6862 310
38 3300046674 Ga0495588_0004096 Ga0495588_0004096_1283_2326 311
39 3300047470 Ga0495681_0004912 Ga0495681_0004912_3549_4592 311
40 3300048921 Ga0496118_0125783 Ga0496118_0125783_513_1448 311
41 3300053107 Ga0500560_003017 Ga0500560_003017_2007_3050 311
42 3300048920 Ga0496117_0006867 Ga0496117_0006867_6620_7663 312
43 3300048923 Ga0496120_0093909 Ga0496120_0093909_569_1528 312
44 3300050492 nmdc:mga0yw44_7724_c1 nmdc:mga0yw44_7724_c1_4324_5292 315
45 3300048916 Ga0496113_0220591 Ga0496113_0220591_480_1460 316
46 3300048919 Ga0496116_0057602 Ga0496116_0057602_1105_2085 316
47 3300048922 Ga0496119_0013404 Ga0496119_0013404_2528_3508 316
48 3300048925 Ga0496122_0000020 Ga0496122_0000020_85101_86081 316
49 3300048926 Ga0496123_0000003 Ga0496123_0000003_300225_301205 316
50 3300048928 Ga0496125_0036413 Ga0496125_0036413_2286_3266 316
51 3300006051 Ga0075364_10014568 Ga0075364_100145683 317
52 3300048922 Ga0496119_0078453 Ga0496119_0078453_845_1888 317
53 3300048923 Ga0496120_0138153 Ga0496120_0138153_69_1022 317
54 3300053177 Ga0500636_0000034 Ga0500636_0000034_38655_39611 318
55 iso_pu_bacteria 2854916844 2854917670 318
56 3300003790 Ga0055528_1000802 Ga0055528_100080210 319
57 3300025273 Ga0209673_1002763 Ga0209673_10027635 319
58 3300049571 Ga0501034_0054293 Ga0501034_0054293_1135_2178 320
59 3300025294 Ga0209025_1000131 Ga0209025_1000131166 324
60 3300048923 Ga0496120_0009155 Ga0496120_0009155_3001_3981 324
61 3300006038 Ga0075365_10045660 Ga0075365_100456601 327
62 3300048922 Ga0496119_0061381 Ga0496119_0061381_534_1577 330
63 3300048928 Ga0496125_0000275 Ga0496125_0000275_6725_7768 330
64 3300048929 Ga0496126_0205962 Ga0496126_0205962_76_1119 330
65 3300006051 Ga0075364_10027293 Ga0075364_100272933 331
66 3300048922 Ga0496119_0017463 Ga0496119_0017463_1697_2740 331
67 3300048924 Ga0496121_0000005 Ga0496121_0000005_513078_514121 331
68 3300048927 Ga0496124_0007535 Ga0496124_0007535_5507_6550 331
69 3300048928 Ga0496125_0000107 Ga0496125_0000107_191633_192676 331
70 3300048929 Ga0496126_0072079 Ga0496126_0072079_88_1131 331
71 3300050491 nmdc:mga00v17_6191_c1 nmdc:mga00v17_6191_c1_5048_6091 331
72 iso_pu_bacteria 2818991272 2819244509 331
73 3300053125 Ga0500618_000090 Ga0500618_000090_8466_9506 333
74 3300048914 Ga0496111_0001989 Ga0496111_0001989_11064_12068 334
75 3300048925 Ga0496122_0052908 Ga0496122_0052908_756_1760 334
76 3300048926 Ga0496123_0006828 Ga0496123_0006828_813_1817 334
77 iso_pu_bacteria 2738541293 2738799960 334
78 iso_pu_bacteria 2862705112 2862711173 335
79 3300046530 Ga0495654_0000369 Ga0495654_0000369_35755_36780 336
80 iso_pu_bacteria 2857720070 2857721714 336
81 3300002773 JGI25152J39213_1001926 JGI25152J39213_10019266 338
82 3300002773 JGI25152J39213_1003492 JGI25152J39213_10034921 338
83 3300002774 JGI25150J39212_1010160 JGI25150J39212_10101602 338
84 3300003187 JGI25151J46595_10000007 JGI25151J46595_1000000723 338
85 3300003187 JGI25151J46595_10001532 JGI25151J46595_1000153211 338
86 3300003215 JGI25153J46596_10022465 JGI25153J46596_100224652 338
87 3300003578 Ga0006562J51391_1082793 Ga0006562J51391_10827931 338
88 3300006051 Ga0075364_10013709 Ga0075364_100137094 338
89 3300006186 Ga0075369_10011458 Ga0075369_100114583 338
90 3300006353 Ga0075370_10066302 Ga0075370_100663022 338
91 3300025245 Ga0207425_1000018 Ga0207425_1000018307 338
92 3300025245 Ga0207425_1002054 Ga0207425_10020542 338
93 3300025258 Ga0209129_1000019 Ga0209129_1000019226 338
94 3300025258 Ga0209129_1000026 Ga0209129_100002622 338
95 3300025258 Ga0209129_1003722 Ga0209129_10037226 338
96 3300025258 Ga0209129_1003876 Ga0209129_10038766 338
97 3300025273 Ga0209673_1018974 Ga0209673_10189742 338
98 3300025294 Ga0209025_1000035 Ga0209025_100003522 338
99 3300025294 Ga0209025_1000186 Ga0209025_100018697 338
100 3300025297 Ga0209758_1000040 Ga0209758_100004022 338
101 3300025297 Ga0209758_1000599 Ga0209758_100059925 338
102 3300025297 Ga0209758_1001288 Ga0209758_100128826 338
103 3300025299 Ga0209256_1000162 Ga0209256_100016292 338
104 3300025303 Ga0209051_1040058 Ga0209051_10400582 338
105 3300027111 Ga0209281_1000934 Ga0209281_10009344 338
106 3300031911 Ga0307412_10013081 Ga0307412_100130811 338
107 3300032004 Ga0307414_10102532 Ga0307414_101025322 338
108 3300044901 Ga0466960_0056991 Ga0466960_0056991_538_1581 338
109 3300046512 Ga0495610_0000609 Ga0495610_0000609_5167_6207 338
110 3300046515 Ga0495620_0028536 Ga0495620_0028536_1192_2232 338
111 3300046519 Ga0495632_0017837 Ga0495632_0017837_1079_2119 338
112 3300046522 Ga0495643_0036808 Ga0495643_0036808_1005_2045 338
113 3300046616 Ga0495668_0000167 Ga0495668_0000167_31432_32475 338
114 3300047472 Ga0495686_0008721 Ga0495686_0008721_4279_5319 338
115 3300048903 Ga0496100_0235223 Ga0496100_0235223_199_1239 338
116 3300048904 Ga0496101_0032013 Ga0496101_0032013_1200_2240 338
117 3300048909 Ga0496106_0000243 Ga0496106_0000243_17303_18346 338
118 3300048919 Ga0496116_0002399 Ga0496116_0002399_3598_4644 338
119 3300048919 Ga0496116_0007270 Ga0496116_0007270_5985_7025 338
120 3300048920 Ga0496117_0021668 Ga0496117_0021668_2322_3362 338
121 3300048920 Ga0496117_0102653 Ga0496117_0102653_561_1607 338
122 3300048921 Ga0496118_0008267 Ga0496118_0008267_5475_6515 338
123 3300048925 Ga0496122_0008286 Ga0496122_0008286_1058_2098 338
124 3300048925 Ga0496122_0008584 Ga0496122_0008584_7028_8071 338
125 3300048925 Ga0496122_0074253 Ga0496122_0074253_1145_2188 338
126 3300048925 Ga0496122_0142143 Ga0496122_0142143_293_1339 338
127 3300048926 Ga0496123_0033616 Ga0496123_0033616_827_1867 338
128 3300048926 Ga0496123_0133116 Ga0496123_0133116_274_1317 338
129 3300048927 Ga0496124_0000091 Ga0496124_0000091_182556_183596 338
130 3300048927 Ga0496124_0000943 Ga0496124_0000943_41953_42999 338
131 3300048928 Ga0496125_0032928 Ga0496125_0032928_1612_2652 338
132 3300049742 Ga0501080_0109039 Ga0501080_0109039_199_1242 338
133 3300050490 nmdc:mga03n38_12960_c1 nmdc:mga03n38_12960_c1_753_1796 338
134 3300050491 nmdc:mga00v17_36_c1 nmdc:mga00v17_36_c1_62844_63884 338
135 3300053093 Ga0500651_0057192 Ga0500651_0057192_459_1502 338
136 3300053134 Ga0500658_0001709 Ga0500658_0001709_122_1165 338
137 3300053139 Ga0500568_0000571 Ga0500568_0000571_18506_19549 338
138 3300053153 Ga0500616_0000298 Ga0500616_0000298_47602_48645 338
139 3300053160 Ga0500633_0014617 Ga0500633_0014617_1036_2079 338
140 3300053161 Ga0500634_0000011 Ga0500634_0000011_60623_61666 338
141 iso_pu_bacteria 2510065057 2510306863 338
142 iso_pu_bacteria 2510917026 2511172339 338
143 iso_pu_bacteria 2510917030 2511193683 338
144 iso_pu_bacteria 2511231052 2511500018 338
145 iso_pu_bacteria 2512047086 2512530432 338
146 iso_pu_bacteria 2513237086 2513586319 338
147 iso_pu_bacteria 2513237091 2513618900 338
148 iso_pu_bacteria 2513237140 2513883208 338
149 iso_pu_bacteria 2513237143 2513904212 338
150 iso_pu_bacteria 2515154107 2515609976 338
151 iso_pu_bacteria 2516653046 2516897557 338
152 iso_pu_bacteria 2524023207 2524452291 338
153 iso_pu_bacteria 2537561587 2537875017 338
154 iso_pu_bacteria 2551306084 2551674400 338
155 iso_pu_bacteria 2551306085 2551686858 338
156 iso_pu_bacteria 2551306086 2551690937 338
157 iso_pu_bacteria 2551306087 2551702474 338
158 iso_pu_bacteria 2551306089 2551714484 338
159 iso_pu_bacteria 2551306090 2551715757 338
160 iso_pu_bacteria 2551306091 2551730856 338
161 iso_pu_bacteria 2551306092 2551732700 338
162 iso_pu_bacteria 2551306092 2551735913 338
163 iso_pu_bacteria 2551306093 2551740697 338
164 iso_pu_bacteria 2554235003 2554244385 338
165 iso_pu_bacteria 2558860242 2559297808 338
166 iso_pu_bacteria 2565956761 2566994551 338
167 iso_pu_bacteria 2582581294 2585200975 338
168 iso_pu_bacteria 2582581298 2585226165 338
169 iso_pu_bacteria 2582581304 2585255604 338
170 iso_pu_bacteria 2585427529 2585548915 338
171 iso_pu_bacteria 2585427594 2585842307 338
172 iso_pu_bacteria 2585427633 2585993871 338
173 iso_pu_bacteria 2585427634 2586004792 338
174 iso_pu_bacteria 2599185156 2599335285 338
175 iso_pu_bacteria 2599185210 2599603846 338
176 iso_pu_bacteria 2643221548 2643761592 338
177 iso_pu_bacteria 2643221557 2643805197 338
178 iso_pu_bacteria 2643221578 2643898889 338
179 iso_pu_bacteria 2643221582 2643917767 338
180 iso_pu_bacteria 2643221599 2644004920 338
181 iso_pu_bacteria 2643221610 2644065565 338
182 iso_pu_bacteria 2643221668 2644375448 338
183 iso_pu_bacteria 2643221673 2644403551 338
184 iso_pu_bacteria 2643221675 2644418015 338
185 iso_pu_bacteria 2643221680 2644451186 338
186 iso_pu_bacteria 2643221693 2644522561 338
187 iso_pu_bacteria 2643221726 2644687533 338
188 iso_pu_bacteria 2734482000 2734967716 338
189 iso_pu_bacteria 2751185792 2753324529 338
190 iso_pu_bacteria 2751185800 2753361129 338
191 iso_pu_bacteria 2757320392 2757571087 338
192 iso_pu_bacteria 2758568522 2760306878 338
193 iso_pu_bacteria 2802429296 2804848912 338
194 iso_pu_bacteria 2808606387 2808989287 338
195 iso_pu_bacteria 2808606448 2809235229 338
196 iso_pu_bacteria 2837651117 2837653090 338
197 iso_pu_bacteria 2838675328 2838679174 338
198 iso_pu_bacteria 2838714209 2838719019 338
199 iso_pu_bacteria 2838719591 2838724018 338
200 iso_pu_bacteria 2838724970 2838728852 338
201 iso_pu_bacteria 2841846520 2841850143 338
202 iso_pu_bacteria 2841859092 2841861078 338
203 iso_pu_bacteria 2842124991 2842128615 338
204 iso_pu_bacteria 2842130223 2842134076 338
205 iso_pu_bacteria 2842152218 2842156072 338
206 iso_pu_bacteria 2842170452 2842175265 338
207 iso_pu_bacteria 2842175837 2842179835 338
208 iso_pu_bacteria 2842187318 2842191848 338
209 iso_pu_bacteria 2842211629 2842216165 338
210 iso_pu_bacteria 2842224351 2842228783 338
211 iso_pu_bacteria 2842515876 2842518655 338
212 iso_pu_bacteria 2842922631 2842927091 338
213 iso_pu_bacteria 2852677369 2852679650 338
214 iso_pu_bacteria 2854896431 2854901520 338
215 iso_pu_bacteria 2854911287 2854914731 338
216 iso_pu_bacteria 2855825444 2855830535 338
217 iso_pu_bacteria 2855839649 2855845690 338
218 iso_pu_bacteria 2858800743 2858805553 338
219 iso_pu_bacteria 2862290372 2862295768 338
220 iso_pu_bacteria 2867369537 2867374744 338
221 iso_pu_bacteria 2875391855 2875392209 338
222 iso_pu_bacteria 2899792073 2899793312 338
223 iso_pu_bacteria 2899845264 2899849803 338
224 iso_pu_bacteria 2904535858 2904536079 338
225 iso_pu_bacteria 2915986958 2915987082 338
226 iso_pu_bacteria 2915993759 2915997756 338
227 iso_pu_bacteria 2916000859 2916001502 338
228 iso_pu_bacteria 2916007675 2916011355 338
229 iso_pu_bacteria 2916014648 2916014761 338
230 iso_pu_bacteria 2916021584 2916025218 338
231 iso_pu_bacteria 2916028427 2916032267 338
232 iso_pu_bacteria 2916035215 2916039123 338
233 iso_pu_bacteria 2916041962 2916045439 338
234 iso_pu_bacteria 2916048683 2916051294 338
235 iso_pu_bacteria 2916055098 2916059061 338
236 iso_pu_bacteria 2916068649 2916072862 338
237 iso_pu_bacteria 2916076590 2916081916 338
238 iso_pu_bacteria 2919100787 2919108504 338
239 iso_pu_bacteria 2919114240 2919117830 338
240 iso_pu_bacteria 2921201388 2921203246 338
241 iso_pu_bacteria 2921208531 2921209357 338
242 iso_pu_bacteria 2921237296 2921239631 338
243 iso_pu_bacteria 2921244191 2921244967 338
244 iso_pu_bacteria 2921257292 2921263809 338
245 iso_pu_bacteria 2921263974 2921269961 338
246 iso_pu_bacteria 2921282425 2921283278 338
247 iso_pu_bacteria 2921289301 2921294391 338
248 iso_pu_bacteria 2922554459 2922555897 338
249 iso_pu_bacteria 2924144063 2924146258 338
250 iso_pu_bacteria 2924150972 2924155563 338
251 iso_pu_bacteria 2924158325 2924162100 338
252 iso_pu_bacteria 2924165586 2924170054 338
253 iso_pu_bacteria 2924172951 2924176611 338
254 iso_pu_bacteria 2924179722 2924180090 338
255 iso_pu_bacteria 2924193448 2924199098 338
256 iso_pu_bacteria 2924200457 2924202875 338
257 iso_pu_bacteria 2924207177 2924209829 338
258 iso_pu_bacteria 2924214083 2924216902 338
259 iso_pu_bacteria 2924221636 2924227571 338
260 iso_pu_bacteria 2924228884 2924230603 338
261 iso_pu_bacteria 2926754445 2926757635 338
262 iso_pu_bacteria 2926760298 2926764751 338
263 iso_pu_bacteria 2928521798 2928525254 338
264 iso_pu_bacteria 2929138655 2929143493 338
265 iso_pu_bacteria 2932398195 2932400580 338
266 iso_pu_bacteria 2933006813 2933010235 338
267 iso_pu_bacteria 2933011516 2933014281 338
268 iso_pu_bacteria 2936996657 2936997257 338
269 iso_pu_bacteria 2937002841 2937004203 338
270 iso_pu_bacteria 2937009748 2937011646 338
271 iso_pu_bacteria 2937016420 2937017858 338
272 iso_pu_bacteria 2937023124 2937028735 338
273 iso_pu_bacteria 2937042894 2937046519 338
274 iso_pu_bacteria 2937056579 2937058797 338
275 iso_pu_bacteria 2937071275 2937077860 338
276 iso_pu_bacteria 2937091812 2937097179 338
277 iso_pu_bacteria 2937098957 2937102177 338
278 iso_pu_bacteria 2937106411 2937107487 338
279 iso_pu_bacteria 2937113482 2937116744 338
280 iso_pu_bacteria 2937119839 2937125097 338
281 iso_pu_bacteria 2937126314 2937132130 338
282 iso_pu_bacteria 2939657138 2939657678 338
283 iso_pu_bacteria 2946045630 2946052681 338
284 iso_pu_bacteria 2957382221 2957385292 338
285 iso_pu_bacteria 2957388812 2957394409 338
286 iso_pu_bacteria 2957395598 2957402288 338
287 iso_pu_bacteria 2957402308 2957405704 338
288 iso_pu_bacteria 2957408893 2957410423 338
289 iso_pu_bacteria 2957415311 2957415326 338
290 iso_pu_bacteria 2957422303 2957423379 338
291 iso_pu_bacteria 2957430029 2957434966 338
292 iso_pu_bacteria 2957443900 2957448406 338
293 iso_pu_bacteria 2957450854 2957453578 338
294 iso_pu_bacteria 2957457609 2957459279 338
295 iso_pu_bacteria 2957464669 2957465853 338
296 iso_pu_bacteria 2957471148 2957471731 338
297 iso_pu_bacteria 2957478035 2957482123 338
298 iso_pu_bacteria 2957484790 2957484967 338
299 iso_pu_bacteria 2957491536 2957495683 338
300 iso_pu_bacteria 2957498199 2957502744 338
301 iso_pu_bacteria 2957505466 2957510461 338
302 iso_pu_bacteria 2960584000 2960588515 338
303 iso_pu_bacteria 2960597568 2960601499 338
304 iso_pu_bacteria 2960603979 2960605115 338
305 iso_pu_bacteria 2960610863 2960614526 338
306 iso_pu_bacteria 2960617483 2960623930 338
307 iso_pu_bacteria 2960624210 2960628416 338
308 iso_pu_bacteria 2960637947 2960644885 338
309 iso_pu_bacteria 2960645483 2960650661 338
310 iso_pu_bacteria 2960652885 2960654044 338
311 iso_pu_bacteria 2960660292 2960665056 338
312 iso_pu_bacteria 2960667422 2960670552 338
313 iso_pu_bacteria 2964607997 2964610925 338
314 iso_pu_bacteria 2964615318 2964621894 338
315 iso_pu_bacteria 2964621998 2964628560 338
316 iso_pu_bacteria 2964628898 2964634614 338
317 iso_pu_bacteria 2964636051 2964641506 338
318 iso_pu_bacteria 2964643177 2964645797 338
319 iso_pu_bacteria 2964649959 2964654344 338
320 iso_pu_bacteria 2964656573 2964663236 338
321 iso_pu_bacteria 2964663802 2964666457 338
322 iso_pu_bacteria 2964670856 2964673018 338
323 iso_pu_bacteria 2964678106 2964682586 338
324 iso_pu_bacteria 2964685014 2964691859 338
325 iso_pu_bacteria 2964691889 2964697419 338
326 iso_pu_bacteria 2964698721 2964703084 338
327 iso_pu_bacteria 2964705432 2964711586 338
328 iso_pu_bacteria 2964712639 2964715862 338
329 iso_pu_bacteria 2964719344 2964726259 338
330 iso_pu_bacteria 2967664464 2967665890 338
331 iso_pu_bacteria 2967671571 2967672697 338
332 iso_pu_bacteria 2967678726 2967682286 338
333 iso_pu_bacteria 2967693043 2967697717 338
334 iso_pu_bacteria 2967699805 2967702319 338
335 iso_pu_bacteria 2967706974 2967707361 338
336 iso_pu_bacteria 2967714385 2967718465 338
337 iso_pu_bacteria 2967721400 2967727786 338
338 iso_pu_bacteria 2967735183 2967740774 338
339 iso_pu_bacteria 2967742019 2967748409 338
340 iso_pu_bacteria 2967748971 2967751381 338
341 iso_pu_bacteria 2967755722 2967761550 338
342 iso_pu_bacteria 2967762386 2967764827 338
343 iso_pu_bacteria 2967769361 2967771731 338
344 iso_pu_bacteria 2967775926 2967778869 338
345 iso_pu_bacteria 2970019648 2970023148 338
346 iso_pu_bacteria 2970033650 2970035283 338
347 iso_pu_bacteria 2970040964 2970044638 338
348 iso_pu_bacteria 2970047711 2970050388 338
349 iso_pu_bacteria 2970054988 2970060483 338
350 iso_pu_bacteria 2970061556 2970068386 338
351 iso_pu_bacteria 2970068827 2970070432 338
352 iso_pu_bacteria 2970076120 2970079013 338
353 iso_pu_bacteria 2970088815 2970094455 338
354 iso_pu_bacteria 2970095765 2970102039 338
355 iso_pu_bacteria 2970102677 2970108240 338
356 iso_pu_bacteria 2970109326 2970114947 338
357 iso_pu_bacteria 2970116247 2970119789 338
358 iso_pu_bacteria 2970129317 2970133907 338
359 iso_pu_bacteria 2970136068 2970142547 338
360 iso_pu_bacteria 2970149975 2970155326 338
361 iso_pu_bacteria 2970156795 2970161989 338
362 iso_pu_bacteria 2970164137 2970168581 338
363 iso_pu_bacteria 2970170962 2970176357 338
364 iso_pu_bacteria 2970177841 2970181641 338
365 iso_pu_bacteria 2970184632 2970184654 338
366 iso_pu_bacteria 2970191845 2970197253 338
367 iso_pu_bacteria 2977516862 2977522374 338
368 iso_pu_bacteria 2977523885 2977527701 338
369 iso_pu_bacteria 2977537788 2977542509 338
370 iso_pu_bacteria 2977551784 2977554962 338
371 iso_pu_bacteria 2977558990 2977559823 338
372 iso_pu_bacteria 2977565890 2977568570 338
373 iso_pu_bacteria 2977572785 2977577736 338
374 iso_pu_bacteria 2977579622 2977583821 338
375 iso_pu_bacteria 2979089926 2979090135 338
376 iso_pu_bacteria 2979095461 2979095669 338
377 iso_pu_bacteria 2984509177 2984510868 338
378 iso_pu_bacteria 2984518228 2984518431 338
379 iso_pu_bacteria 2984537506 2984539217 338
380 iso_pu_bacteria 2990044586 2990048877 338
381 iso_pu_bacteria 3005445848 3005451037 338
382 iso_pu_bacteria 3005452660 3005458297 338
383 iso_pu_bacteria 648276728 648739281 338
384 iso_pu_bacteria 650716007 650842465 338
385 iso_pu_bacteria 8003570095 8003573404 338
386 iso_pu_bacteria 8003992118 8003998376 338
387 iso_pu_bacteria 8008485437 8008488541 338
388 iso_pu_bacteria 8025413630 8025417525 338
389 iso_pu_bacteria 8025524527 8025525062 338
390 iso_pu_bacteria 8025530807 8025537009 338
391 iso_pu_bacteria 8054460903 8054464572 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01032

FecCD

FecCD transport family

50

359

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.9127 13 330
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.9046 5 332
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.9036 4 332
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.898 13 330
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.893 4 332
ID Description Score Start End Superfamily
af_Q57552_11_347_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9289 13 333 1.10.3470.10
4g1uB00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9127 13 330 1.10.3470.10
af_Q2G1N5_4_331_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8994 13 336 1.10.3470.10
af_P15030_4_332_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8986 18 333 1.10.3470.10
4g1uB00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.898 13 330 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1B1BLT0-F1-model_v4 ABC transporter permease 0.9666 13 338 GO:0005886
GO:0022857
GO:0033214
AF-A0A285Y3S5-F1-model_v4 deleted 0.9655 10 338
AF-A0A859CYT1-F1-model_v4 Iron-siderophore ABC transporter permease protein 0.9655 13 338 GO:0005886
GO:0022857
GO:0033214
AF-A0A1E7KQM3-F1-model_v4 Iron ABC transporter permease 0.9646 11 278 GO:0005886
GO:0022857
GO:0033214
AF-A0A5J6U993-F1-model_v4 Iron ABC transporter permease 0.9638 13 338 GO:0005886
GO:0022857
GO:0033214

Feature Viewer

pLDDT pTM Quality
80.76 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map