F432080

General Info

Members Datasets Scaffolds Average Seq Length
391 230 782 219

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0005149|Ga0373947_0005149_765_1484
Length 239
Sequence VIRVALVDDQELVRAGLARILSPVDGFDVVAECGDGRQAVELLPGLRPDVVVMDIRMPVLDGIAATAALRGGEDPLDVLVLTTFGEDEVLWNAIEAGAAGFVLKDCTAEDLIAAVRAVAGGGAWFDPAVAPRLLGEYRRLVVPAAREASRLEQLTDREHEVLRLMARGATNAEIAASLFVAEATVKSHVGSIFGKLGMRDRAAAIVFAYDHGAVTPGASDHGRRPIGDHGPMRRRPGDD

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 2643221578 Streptomyces sp. Root63 Isolate Unclassified
218 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
219 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
220 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
221 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
222 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
223 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
224 2891562705 Microbispora tritici MT50 Isolate Unclassified
225 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
226 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
227 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
228 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
229 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
230 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 0.51
Isolates 3.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 9.21
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0005149 3300035725 Bacteria 7658
2 JGI24739J22299_10129508 3300001989 Bacteria 751
3 JGI24737J22298_10094596 3300001990 Bacteria 886
4 JGI24738J21930_10018360 3300002075 Bacteria 1462
5 JGI24749J21850_1031146 3300002076 Bacteria 766
6 JGI24744J21845_10004408 3300002077 Bacteria 2910
7 Ga0070683_100097511 3300005329 Bacteria 2765
8 Ga0070683_100291478 3300005329 Bacteria 1552
9 Ga0070682_100007243 3300005337 Bacteria 6249
10 Ga0070682_100163635 3300005337 Bacteria 1539
11 Ga0068868_100020933 3300005338 Bacteria 4923
12 Ga0068868_100034331 3300005338 Bacteria 3915
13 Ga0068868_100411046 3300005338 Bacteria 1170
14 Ga0068868_100456689 3300005338 Bacteria 1112
15 Ga0070660_100035569 3300005339 Bacteria 3771
16 Ga0070660_100126408 3300005339 Bacteria 2043
17 Ga0070660_100857571 3300005339 Bacteria 765
18 Ga0070689_100581802 3300005340 Bacteria 968
19 Ga0070691_10166016 3300005341 Bacteria 1141
20 Ga0070691_10168973 3300005341 Bacteria 1132
21 Ga0070661_100249587 3300005344 Bacteria 1369
22 Ga0070692_10003854 3300005345 Bacteria 6176
23 Ga0070692_10089013 3300005345 Bacteria 1675
24 Ga0070692_10303288 3300005345 Bacteria 976
25 Ga0070692_10305372 3300005345 Bacteria 973
26 Ga0070668_100016310 3300005347 Bacteria 5554
27 Ga0070668_100098316 3300005347 Bacteria 2316
28 Ga0070675_100045134 3300005354 Bacteria 3606
29 Ga0070675_100070602 3300005354 Bacteria 2895
30 Ga0070675_100154221 3300005354 Bacteria 1971
31 Ga0070674_100083230 3300005356 Bacteria 2291
32 Ga0070674_100125316 3300005356 Bacteria 1907
33 Ga0070673_100259339 3300005364 Bacteria 1518
34 Ga0070659_100002935 3300005366 Bacteria 12150
35 Ga0070659_100008901 3300005366 Bacteria 7359
36 Ga0070659_100015760 3300005366 Bacteria 5664
37 Ga0070659_100175880 3300005366 Bacteria 1755
38 Ga0070709_10003733 3300005434 Bacteria 8185
39 Ga0070709_10012603 3300005434 Bacteria 4735
40 Ga0070714_100017117 3300005435 Bacteria 5868
41 Ga0070713_100031391 3300005436 Bacteria 4231
42 Ga0070713_100239228 3300005436 Bacteria 1653
43 Ga0070710_10004470 3300005437 Bacteria 6618
44 Ga0070701_10051907 3300005438 Bacteria 2128
45 Ga0070711_100051497 3300005439 Bacteria 2828
46 Ga0070705_100129480 3300005440 Bacteria 1644
47 Ga0070700_100006499 3300005441 Bacteria 6256
48 Ga0070700_100084779 3300005441 Bacteria 2054
49 Ga0070700_100166550 3300005441 Bacteria 1522
50 Ga0070694_100001617 3300005444 Bacteria 13232
51 Ga0070663_100006025 3300005455 Bacteria 7258
52 Ga0070663_100088526 3300005455 Bacteria 2290
53 Ga0070678_100124684 3300005456 Bacteria 2037
54 Ga0070678_100342506 3300005456 Bacteria 1283
55 Ga0070662_100109252 3300005457 Bacteria 2104
56 Ga0068867_100011701 3300005459 Bacteria 6196
57 Ga0070685_10123591 3300005466 Bacteria 1610
58 Ga0070698_100014480 3300005471 Bacteria 8329
59 Ga0070679_100104983 3300005530 Bacteria 2812
60 Ga0070684_100005783 3300005535 Bacteria 9510
61 Ga0070684_100029901 3300005535 Bacteria 4623
62 Ga0070684_100147645 3300005535 Bacteria 2129
63 Ga0070684_100486631 3300005535 Bacteria 1142
64 Ga0068853_100002058 3300005539 Bacteria 14902
65 Ga0068853_100090228 3300005539 Bacteria 2693
66 Ga0070672_100001166 3300005543 Bacteria 16036
67 Ga0070672_100071899 3300005543 Bacteria 2753
68 Ga0070686_100271216 3300005544 Bacteria 1248
69 Ga0070686_100280386 3300005544 Bacteria 1229
70 Ga0070695_100003270 3300005545 Bacteria 9462
71 Ga0070696_100022452 3300005546 Bacteria 4287
72 Ga0070693_100047202 3300005547 Bacteria 2450
73 Ga0070693_100262699 3300005547 Bacteria 1149
74 Ga0070693_100430067 3300005547 Bacteria 922
75 Ga0070704_100001379 3300005549 Bacteria 12903
76 Ga0068855_100026938 3300005563 Bacteria 6878
77 Ga0068855_101095061 3300005563 Bacteria 833
78 Ga0070664_100009025 3300005564 Bacteria 8088
79 Ga0070664_100200209 3300005564 Bacteria 1782
80 Ga0070664_100649998 3300005564 Bacteria 980
81 Ga0068857_100035047 3300005577 Bacteria 4443
82 Ga0068854_100022245 3300005578 Bacteria 4315
83 Ga0068856_100337153 3300005614 Bacteria 1526
84 Ga0068856_100421453 3300005614 Bacteria 1355
85 Ga0068856_101022491 3300005614 Bacteria 844
86 Ga0068852_100034655 3300005616 Bacteria 4203
87 Ga0068852_100054457 3300005616 Bacteria 3448
88 Ga0068852_100082792 3300005616 Bacteria 2852
89 Ga0068852_100752002 3300005616 Bacteria 987
90 Ga0068864_100052224 3300005618 Bacteria 3523
91 Ga0068864_100091545 3300005618 Bacteria 2683
92 Ga0068866_10093493 3300005718 Bacteria 1643
93 Ga0068861_100045382 3300005719 Bacteria 3309
94 Ga0068861_100291280 3300005719 Bacteria 1410
95 Ga0068870_10097274 3300005840 Bacteria 1656
96 Ga0068860_100041138 3300005843 Bacteria 4414
97 Ga0081538_10021905 3300005981 Bacteria 4647
98 Ga0081538_10045936 3300005981 Bacteria 2701
99 Ga0081539_10002019 3300005985 Bacteria 30676
100 Ga0081539_10010320 3300005985 Bacteria 7604
101 Ga0070717_10014808 3300006028 Bacteria 6000
102 Ga0075365_10028744 3300006038 Bacteria 3548
103 Ga0070715_10003685 3300006163 Bacteria 4925
104 Ga0070716_100000710 3300006173 Bacteria 14221
105 Ga0097621_100029168 3300006237 Bacteria 4356
106 Ga0075433_10006746 3300006852 Bacteria 9097
107 Ga0075433_10482420 3300006852 Bacteria 1092
108 Ga0075434_100012412 3300006871 Bacteria 8077
109 Ga0068865_100172786 3300006881 Bacteria 1658
110 Ga0075436_100013279 3300006914 Bacteria 5643
111 Ga0075435_100050203 3300007076 Bacteria 3357
112 Ga0111539_10146463 3300009094 Bacteria 2765
113 Ga0105245_10005184 3300009098 Bacteria 11446
114 Ga0105245_10017688 3300009098 Bacteria 6222
115 Ga0105245_10025358 3300009098 Bacteria 5215
116 Ga0105245_10155697 3300009098 Bacteria 2164
117 Ga0105247_10012721 3300009101 Bacteria 5050
118 Ga0114129_10002100 3300009147 Bacteria 27414
119 Ga0105243_10055637 3300009148 Bacteria 3144
120 Ga0105241_10028149 3300009174 Bacteria 4186
121 Ga0105241_10968042 3300009174 Bacteria 794
122 Ga0105242_10033912 3300009176 Bacteria 4090
123 Ga0105242_10792819 3300009176 Bacteria 937
124 Ga0105248_10009726 3300009177 Bacteria 10589
125 Ga0105248_10021469 3300009177 Bacteria 7151
126 Ga0105248_10166752 3300009177 Bacteria 2483
127 Ga0105237_10008562 3300009545 Bacteria 11062
128 Ga0105238_10145494 3300009551 Bacteria 2346
129 Ga0105238_10725357 3300009551 Bacteria 1007
130 Ga0105249_10007284 3300009553 Bacteria 9649
131 Ga0105249_10183855 3300009553 Bacteria 2035
132 Ga0105249_10215532 3300009553 Bacteria 1887
133 Ga0105239_10016560 3300010375 Bacteria 8147
134 Ga0105239_10058515 3300010375 Bacteria 4229
135 Ga0157370_10012622 3300013104 Bacteria 8752
136 Ga0157369_10013362 3300013105 Bacteria 9288
137 Ga0157369_10015951 3300013105 Bacteria 8454
138 Ga0157374_10527897 3300013296 Bacteria 1187
139 Ga0157374_10765726 3300013296 Bacteria 980
140 Ga0163162_10002224 3300013306 Bacteria 18225
141 Ga0163162_10706231 3300013306 Bacteria 1130
142 Ga0157372_10016094 3300013307 Bacteria 8024
143 Ga0157372_10032024 3300013307 Bacteria 5761
144 Ga0157375_10005757 3300013308 Bacteria 10782
145 Ga0157375_10179105 3300013308 Bacteria 2271
146 Ga0157375_10219356 3300013308 Bacteria 2060
147 Ga0157375_10376023 3300013308 Bacteria 1587
148 Ga0163163_10075377 3300014325 Bacteria 3367
149 Ga0163163_10215197 3300014325 Bacteria 1970
150 Ga0163163_10574190 3300014325 Bacteria 1191
151 Ga0157380_10061886 3300014326 Bacteria 2997
152 Ga0157380_10101448 3300014326 Bacteria 2398
153 Ga0157380_10562078 3300014326 Bacteria 1121
154 Ga0157377_10004666 3300014745 Bacteria 6341
155 Ga0157377_10041824 3300014745 Bacteria 2543
156 Ga0157376_10366449 3300014969 Bacteria 1383
157 Ga0157376_10575120 3300014969 Bacteria 1118
158 Ga0163161_10023084 3300017792 Bacteria 4383
159 Ga0163161_10164812 3300017792 Bacteria 1692
160 Ga0206356_11211082 3300020070 Bacteria 1283
161 Ga0206353_11445231 3300020082 Bacteria 3786
162 Ga0213876_10235786 3300021384 Bacteria 972
163 Ga0213875_10000572 3300021388 Bacteria 30089
164 Ga0207656_10094965 3300025321 Bacteria 1359
165 Ga0207692_10025788 3300025898 Bacteria 2751
166 Ga0207642_10019532 3300025899 Bacteria 2626
167 Ga0207710_10009353 3300025900 Bacteria 4125
168 Ga0207688_10032616 3300025901 Bacteria 2879
169 Ga0207688_10039621 3300025901 Bacteria 2617
170 Ga0207688_10157271 3300025901 Bacteria 1345
171 Ga0207688_10300264 3300025901 Bacteria 982
172 Ga0207685_10128480 3300025905 Bacteria 1122
173 Ga0207699_10013152 3300025906 Bacteria 4226
174 Ga0207643_10007496 3300025908 Bacteria 5859
175 Ga0207705_10035520 3300025909 Bacteria 3566
176 Ga0207654_10017192 3300025911 Bacteria 3778
177 Ga0207671_10034730 3300025914 Bacteria 3746
178 Ga0207663_10058797 3300025916 Bacteria 2428
179 Ga0207663_10504553 3300025916 Bacteria 940
180 Ga0207657_10043080 3300025919 Bacteria 3979
181 Ga0207657_10049998 3300025919 Bacteria 3640
182 Ga0207657_10296667 3300025919 Bacteria 1281
183 Ga0207649_10190134 3300025920 Bacteria 1443
184 Ga0207652_10128709 3300025921 Bacteria 2256
185 Ga0207681_10420718 3300025923 Bacteria 1082
186 Ga0207694_10527817 3300025924 Bacteria 989
187 Ga0207659_10064679 3300025926 Bacteria 2648
188 Ga0207659_10101898 3300025926 Bacteria 2166
189 Ga0207659_10307271 3300025926 Bacteria 1304
190 Ga0207687_10016229 3300025927 Bacteria 4891
191 Ga0207687_10068447 3300025927 Bacteria 2529
192 Ga0207687_10095649 3300025927 Bacteria 2176
193 Ga0207700_10022045 3300025928 Bacteria 4362
194 Ga0207700_10462101 3300025928 Bacteria 1120
195 Ga0207664_10013983 3300025929 Bacteria 5785
196 Ga0207664_10025970 3300025929 Bacteria 4421
197 Ga0207690_10009108 3300025932 Bacteria 5890
198 Ga0207690_10012068 3300025932 Bacteria 5166
199 Ga0207690_10155116 3300025932 Bacteria 1701
200 Ga0207706_10045121 3300025933 Bacteria 3906
201 Ga0207706_10052679 3300025933 Bacteria 3593
202 Ga0207709_10037877 3300025935 Bacteria 2868
203 Ga0207709_10065434 3300025935 Bacteria 2286
204 Ga0207669_10101775 3300025937 Bacteria 1901
205 Ga0207669_10476276 3300025937 Bacteria 994
206 Ga0207704_10129965 3300025938 Bacteria 1742
207 Ga0207665_10014936 3300025939 Bacteria 5101
208 Ga0207691_10012345 3300025940 Bacteria 8187
209 Ga0207691_10120147 3300025940 Bacteria 2330
210 Ga0207691_10176921 3300025940 Bacteria 1866
211 Ga0207711_10185058 3300025941 Bacteria 1896
212 Ga0207711_10606806 3300025941 Bacteria 1021
213 Ga0207689_10044633 3300025942 Bacteria 3665
214 Ga0207661_10076641 3300025944 Bacteria 2747
215 Ga0207661_10144209 3300025944 Bacteria 2052
216 Ga0207661_10725875 3300025944 Bacteria 914
217 Ga0207667_10048348 3300025949 Bacteria 4498
218 Ga0207712_10097839 3300025961 Bacteria 2175
219 Ga0207712_10190871 3300025961 Bacteria 1617
220 Ga0207712_10347948 3300025961 Bacteria 1231
221 Ga0207668_10090497 3300025972 Bacteria 2246
222 Ga0207668_10189958 3300025972 Bacteria 1627
223 Ga0207668_11115696 3300025972 Bacteria 707
224 Ga0207640_10160074 3300025981 Bacteria 1664
225 Ga0207640_10161549 3300025981 Bacteria 1658
226 Ga0207640_10219838 3300025981 Bacteria 1454
227 Ga0207658_10323936 3300025986 Bacteria 1335
228 Ga0207658_10607053 3300025986 Bacteria 983
229 Ga0207677_10016211 3300026023 Bacteria 4406
230 Ga0207677_10216460 3300026023 Bacteria 1533
231 Ga0207677_10294779 3300026023 Bacteria 1338
232 Ga0207677_10587324 3300026023 Bacteria 976
233 Ga0207677_10665427 3300026023 Bacteria 920
234 Ga0207703_10136592 3300026035 Bacteria 2123
235 Ga0207639_10018471 3300026041 Bacteria 4955
236 Ga0207639_10082831 3300026041 Bacteria 2544
237 Ga0207678_10006835 3300026067 Bacteria 10117
238 Ga0207678_10020248 3300026067 Bacteria 5839
239 Ga0207708_10000606 3300026075 Bacteria 27697
240 Ga0207708_10163212 3300026075 Bacteria 1760
241 Ga0207708_10421430 3300026075 Bacteria 1107
242 Ga0207702_10226852 3300026078 Bacteria 1743
243 Ga0207702_10810763 3300026078 Bacteria 925
244 Ga0207641_10013388 3300026088 Bacteria 6725
245 Ga0207648_10007180 3300026089 Bacteria 10981
246 Ga0207648_10392258 3300026089 Bacteria 1257
247 Ga0207676_10194100 3300026095 Bacteria 1789
248 Ga0207676_10274076 3300026095 Bacteria 1529
249 Ga0207674_10053701 3300026116 Bacteria 4106
250 Ga0207675_100015647 3300026118 Bacteria 7075
251 Ga0207675_101098580 3300026118 Bacteria 815
252 Ga0207683_10004147 3300026121 Bacteria 12541
253 Ga0207683_10051721 3300026121 Bacteria 3599
254 Ga0207683_10092363 3300026121 Bacteria 2697
255 Ga0207683_10172694 3300026121 Bacteria 1958
256 Ga0207698_10020001 3300026142 Bacteria 4598
257 Ga0207698_10033725 3300026142 Bacteria 3724
258 Ga0207698_10130991 3300026142 Bacteria 2143
259 Ga0207698_10337363 3300026142 Bacteria 1418
260 Ga0207698_10710516 3300026142 Bacteria 1001
261 Ga0207428_10051369 3300027907 Bacteria 3296
262 Ga0207428_10310359 3300027907 Bacteria 1166
263 Ga0268264_10126256 3300028381 Bacteria 2261
264 Ga0268264_10272868 3300028381 Bacteria 1581
265 Ga0268264_10328125 3300028381 Bacteria 1449
266 Ga0307515_10270997 3300028794 Bacteria 1419
267 Ga0307513_10001044 3300031456 Bacteria 40198
268 Ga0307513_10317969 3300031456 Bacteria 1316
269 Ga0307508_10319719 3300031616 Bacteria 1144
270 Ga0307516_10026964 3300031730 Bacteria 5830
271 Ga0307405_10223695 3300031731 Bacteria 1383
272 Ga0307413_10276839 3300031824 Bacteria 1260
273 Ga0307406_10014272 3300031901 Bacteria 4568
274 Ga0307407_10020347 3300031903 Bacteria 3398
275 Ga0307409_100016986 3300031995 Bacteria 4835
276 Ga0307409_100090439 3300031995 Bacteria 2506
277 Ga0307409_100300087 3300031995 Bacteria 1494
278 Ga0307409_100515808 3300031995 Bacteria 1167
279 Ga0307416_100033267 3300032002 Bacteria 3906
280 Ga0307416_100043047 3300032002 Bacteria 3532
281 Ga0307411_10038965 3300032005 Bacteria 3003
282 Ga0307415_100044413 3300032126 Bacteria 2971
283 Ga0307415_100554507 3300032126 Bacteria 1015
284 Ga0307507_10000003 3300033179 Bacteria 371707
285 Ga0307510_10000606 3300033180 Bacteria 36344
286 Ga0373930_0011729 3300034816 Bacteria 1586
287 Ga0373949_0116808 3300035090 Bacteria 745
288 Ga0373960_0004889 3300035121 Bacteria 3086
289 Ga0373962_0021756 3300035242 Bacteria 1695
290 Ga0373931_0001059 3300035691 Bacteria 11637
291 Ga0395899_0010285 3300037312 Bacteria 7173
292 Ga0395899_0049266 3300037312 Bacteria 3132
293 Ga0395900_0007861 3300037418 Bacteria 10987
294 Ga0395900_0218474 3300037418 Bacteria 1922
295 Ga0395898_0023162 3300037466 Bacteria 6277
296 Ga0395905_0007324 3300037471 Bacteria 10994
297 Ga0436364_1206511 3300037853 Bacteria 41633
298 Ga0395901_0006721 3300038443 Bacteria 11621
299 Ga0436365_0209010 3300039437 Bacteria 25435
300 Ga0451793_1377460 3300041452 Bacteria 1609
301 Ga0439449_0001346 3300042007 Bacteria 9626
302 Ga0450920_008476 3300042122 Bacteria 1879
303 Ga0466961_0366625 3300044693 Bacteria 876
304 Ga0495629_0016645 3300046459 Bacteria 5277
305 Ga0495639_0010438 3300046475 Bacteria 4001
306 Ga0495662_0031406 3300046476 Bacteria 2566
307 Ga0495608_0180368 3300046511 Bacteria 1336
308 Ga0495645_0240779 3300046543 Bacteria 1207
309 Ga0495667_0304715 3300046559 Bacteria 1009
310 Ga0495656_0130240 3300046615 Bacteria 1197
311 Ga0495656_0419967 3300046615 Bacteria 702
312 Ga0495625_0222649 3300046660 Bacteria 1236
313 Ga0495588_0138578 3300046674 Bacteria 1285
314 Ga0495588_0187529 3300046674 Bacteria 1092
315 Ga0495599_0571773 3300046678 Bacteria 660
316 Ga0495658_0179769 3300046683 Bacteria 1312
317 Ga0495658_0569771 3300046683 Bacteria 725
318 Ga0495636_0004039 3300047318 Bacteria 5740
319 Ga0495636_0013379 3300047318 Bacteria 3257
320 Ga0495687_004597 3300047443 Bacteria 9230
321 Ga0495687_006870 3300047443 Bacteria 6858
322 Ga0495675_0007013 3300047444 Bacteria 6928
323 Ga0495593_0287701 3300047673 Bacteria 822
324 Ga0496101_0072273 3300048904 Bacteria 2532
325 Ga0496101_0183928 3300048904 Bacteria 1610
326 Ga0496102_0014268 3300048905 Bacteria 6904
327 Ga0496102_0038088 3300048905 Bacteria 4339
328 Ga0496102_0965889 3300048905 Bacteria 773
329 Ga0496104_0044606 3300048907 Bacteria 4166
330 Ga0496104_0158279 3300048907 Bacteria 2173
331 Ga0496105_0011027 3300048908 Bacteria 7123
332 Ga0496105_0015841 3300048908 Bacteria 6013
333 Ga0496106_0023229 3300048909 Bacteria 4607
334 Ga0496106_0363415 3300048909 Bacteria 1163
335 Ga0496107_0118152 3300048910 Bacteria 1952
336 Ga0496108_0007374 3300048911 Bacteria 8915
337 Ga0496108_0010679 3300048911 Bacteria 7451
338 Ga0496108_0202178 3300048911 Bacteria 1724
339 Ga0496108_0203145 3300048911 Bacteria 1720
340 Ga0496108_0603337 3300048911 Bacteria 956
341 Ga0496109_0008964 3300048912 Bacteria 8521
342 Ga0496109_0080884 3300048912 Bacteria 2994
343 Ga0496109_0286768 3300048912 Bacteria 1552
344 Ga0496109_0427272 3300048912 Bacteria 1251
345 Ga0496110_0000402 3300048913 Bacteria 29301
346 Ga0496110_0161570 3300048913 Bacteria 2031
347 Ga0496110_0417843 3300048913 Bacteria 1223
348 Ga0496111_0010190 3300048914 Bacteria 6295
349 Ga0496111_0046677 3300048914 Bacteria 3119
350 Ga0496111_0106594 3300048914 Bacteria 2063
351 Ga0496112_0050069 3300048915 Bacteria 4095
352 Ga0496113_0145953 3300048916 Bacteria 1864
353 Ga0496113_0261541 3300048916 Bacteria 1382
354 Ga0496114_0055060 3300048917 Bacteria 3317
355 Ga0496114_0062901 3300048917 Bacteria 3107
356 Ga0496114_0068519 3300048917 Bacteria 2979
357 Ga0496114_0360289 3300048917 Bacteria 1286
358 Ga0496115_0239079 3300048918 Bacteria 1497
359 Ga0501034_0284194 3300049571 Bacteria 1594
360 Ga0501038_0049927 3300049574 Bacteria 3616
361 nmdc:mga0yw44_104202_c1 3300050492 Bacteria 1810
362 nmdc:mga0yw44_133646_c1 3300050492 Bacteria 1608
363 nmdc:mga05p37_16410_c1 3300050507 Bacteria 8922
364 nmdc:mga08y16_20209_c1 3300050511 Bacteria 7029
365 nmdc:mga08y16_26119_c1 3300050511 Bacteria 6160
366 nmdc:mga08y16_350600_c1 3300050511 Bacteria 1516
367 nmdc:mga0n895_13328_c1 3300050512 Bacteria 7413
368 nmdc:mga0rr50_135793_c1 3300050513 Bacteria 1974
369 nmdc:mga08x19_13913_c1 3300050514 Bacteria 4874
370 nmdc:mga0a205_8962_c1 3300050515 Bacteria 9119
371 nmdc:mga0a205_937151_c1 3300050515 Bacteria 713
372 Ga0495655_0000690 3300053083 Bacteria 5407
373 Ga0495655_0015796 3300053083 Bacteria 1612
374 Ga0495619_0275958 3300053085 Bacteria 1165
375 Ga0500600_0075163 3300053149 Bacteria 1842
376 Ga0501082_0280570 3300060353 Bacteria 1450
377 2643903522 2643221578 Bacteria 9213798
378 2644409684 2643221673 Bacteria 9196637
379 2795785932 2795385470 Bacteria 8317180
380 2856744857 2856741275 Bacteria 8096094
381 2861525031 2861520306 Bacteria 8348283
382 2873319824 2873314349 Bacteria 8512634
383 2891397927 2891395885 Bacteria 9251614
384 2891404394 2891395885 Bacteria 9251614
385 2891567053 2891562705 Bacteria 8039471
386 2912764789 2912757875 Bacteria 7940295
387 2946052895 2946045630 Bacteria 8527308
388 3003003329 3002998708 Bacteria 11715108
389 3006498455 3006493962 Bacteria 8825450
390 8055181543 8055172936 Bacteria 9305943
391 8057570032 8057568493 Bacteria 7221719
392 Ga0373947_0005149
393 JGI24739J22299_10129508
394 JGI24737J22298_10094596
395 JGI24738J21930_10018360
396 JGI24749J21850_1031146
397 JGI24744J21845_10004408
398 Ga0070683_100097511
399 Ga0070683_100291478
400 Ga0070682_100007243
401 Ga0070682_100163635
402 Ga0068868_100020933
403 Ga0068868_100034331
404 Ga0068868_100411046
405 Ga0068868_100456689
406 Ga0070660_100035569
407 Ga0070660_100126408
408 Ga0070660_100857571
409 Ga0070689_100581802
410 Ga0070691_10166016
411 Ga0070691_10168973
412 Ga0070661_100249587
413 Ga0070692_10003854
414 Ga0070692_10089013
415 Ga0070692_10303288
416 Ga0070692_10305372
417 Ga0070668_100016310
418 Ga0070668_100098316
419 Ga0070675_100045134
420 Ga0070675_100070602
421 Ga0070675_100154221
422 Ga0070674_100083230
423 Ga0070674_100125316
424 Ga0070673_100259339
425 Ga0070659_100002935
426 Ga0070659_100008901
427 Ga0070659_100015760
428 Ga0070659_100175880
429 Ga0070709_10003733
430 Ga0070709_10012603
431 Ga0070714_100017117
432 Ga0070713_100031391
433 Ga0070713_100239228
434 Ga0070710_10004470
435 Ga0070701_10051907
436 Ga0070711_100051497
437 Ga0070705_100129480
438 Ga0070700_100006499
439 Ga0070700_100084779
440 Ga0070700_100166550
441 Ga0070694_100001617
442 Ga0070663_100006025
443 Ga0070663_100088526
444 Ga0070678_100124684
445 Ga0070678_100342506
446 Ga0070662_100109252
447 Ga0068867_100011701
448 Ga0070685_10123591
449 Ga0070698_100014480
450 Ga0070679_100104983
451 Ga0070684_100005783
452 Ga0070684_100029901
453 Ga0070684_100147645
454 Ga0070684_100486631
455 Ga0068853_100002058
456 Ga0068853_100090228
457 Ga0070672_100001166
458 Ga0070672_100071899
459 Ga0070686_100271216
460 Ga0070686_100280386
461 Ga0070695_100003270
462 Ga0070696_100022452
463 Ga0070693_100047202
464 Ga0070693_100262699
465 Ga0070693_100430067
466 Ga0070704_100001379
467 Ga0068855_100026938
468 Ga0068855_101095061
469 Ga0070664_100009025
470 Ga0070664_100200209
471 Ga0070664_100649998
472 Ga0068857_100035047
473 Ga0068854_100022245
474 Ga0068856_100337153
475 Ga0068856_100421453
476 Ga0068856_101022491
477 Ga0068852_100034655
478 Ga0068852_100054457
479 Ga0068852_100082792
480 Ga0068852_100752002
481 Ga0068864_100052224
482 Ga0068864_100091545
483 Ga0068866_10093493
484 Ga0068861_100045382
485 Ga0068861_100291280
486 Ga0068870_10097274
487 Ga0068860_100041138
488 Ga0081538_10021905
489 Ga0081538_10045936
490 Ga0081539_10002019
491 Ga0081539_10010320
492 Ga0070717_10014808
493 Ga0075365_10028744
494 Ga0070715_10003685
495 Ga0070716_100000710
496 Ga0097621_100029168
497 Ga0075433_10006746
498 Ga0075433_10482420
499 Ga0075434_100012412
500 Ga0068865_100172786
501 Ga0075436_100013279
502 Ga0075435_100050203
503 Ga0111539_10146463
504 Ga0105245_10005184
505 Ga0105245_10017688
506 Ga0105245_10025358
507 Ga0105245_10155697
508 Ga0105247_10012721
509 Ga0114129_10002100
510 Ga0105243_10055637
511 Ga0105241_10028149
512 Ga0105241_10968042
513 Ga0105242_10033912
514 Ga0105242_10792819
515 Ga0105248_10009726
516 Ga0105248_10021469
517 Ga0105248_10166752
518 Ga0105237_10008562
519 Ga0105238_10145494
520 Ga0105238_10725357
521 Ga0105249_10007284
522 Ga0105249_10183855
523 Ga0105249_10215532
524 Ga0105239_10016560
525 Ga0105239_10058515
526 Ga0157370_10012622
527 Ga0157369_10013362
528 Ga0157369_10015951
529 Ga0157374_10527897
530 Ga0157374_10765726
531 Ga0163162_10002224
532 Ga0163162_10706231
533 Ga0157372_10016094
534 Ga0157372_10032024
535 Ga0157375_10005757
536 Ga0157375_10179105
537 Ga0157375_10219356
538 Ga0157375_10376023
539 Ga0163163_10075377
540 Ga0163163_10215197
541 Ga0163163_10574190
542 Ga0157380_10061886
543 Ga0157380_10101448
544 Ga0157380_10562078
545 Ga0157377_10004666
546 Ga0157377_10041824
547 Ga0157376_10366449
548 Ga0157376_10575120
549 Ga0163161_10023084
550 Ga0163161_10164812
551 Ga0206356_11211082
552 Ga0206353_11445231
553 Ga0213876_10235786
554 Ga0213875_10000572
555 Ga0207656_10094965
556 Ga0207692_10025788
557 Ga0207642_10019532
558 Ga0207710_10009353
559 Ga0207688_10032616
560 Ga0207688_10039621
561 Ga0207688_10157271
562 Ga0207688_10300264
563 Ga0207685_10128480
564 Ga0207699_10013152
565 Ga0207643_10007496
566 Ga0207705_10035520
567 Ga0207654_10017192
568 Ga0207671_10034730
569 Ga0207663_10058797
570 Ga0207663_10504553
571 Ga0207657_10043080
572 Ga0207657_10049998
573 Ga0207657_10296667
574 Ga0207649_10190134
575 Ga0207652_10128709
576 Ga0207681_10420718
577 Ga0207694_10527817
578 Ga0207659_10064679
579 Ga0207659_10101898
580 Ga0207659_10307271
581 Ga0207687_10016229
582 Ga0207687_10068447
583 Ga0207687_10095649
584 Ga0207700_10022045
585 Ga0207700_10462101
586 Ga0207664_10013983
587 Ga0207664_10025970
588 Ga0207690_10009108
589 Ga0207690_10012068
590 Ga0207690_10155116
591 Ga0207706_10045121
592 Ga0207706_10052679
593 Ga0207709_10037877
594 Ga0207709_10065434
595 Ga0207669_10101775
596 Ga0207669_10476276
597 Ga0207704_10129965
598 Ga0207665_10014936
599 Ga0207691_10012345
600 Ga0207691_10120147
601 Ga0207691_10176921
602 Ga0207711_10185058
603 Ga0207711_10606806
604 Ga0207689_10044633
605 Ga0207661_10076641
606 Ga0207661_10144209
607 Ga0207661_10725875
608 Ga0207667_10048348
609 Ga0207712_10097839
610 Ga0207712_10190871
611 Ga0207712_10347948
612 Ga0207668_10090497
613 Ga0207668_10189958
614 Ga0207668_11115696
615 Ga0207640_10160074
616 Ga0207640_10161549
617 Ga0207640_10219838
618 Ga0207658_10323936
619 Ga0207658_10607053
620 Ga0207677_10016211
621 Ga0207677_10216460
622 Ga0207677_10294779
623 Ga0207677_10587324
624 Ga0207677_10665427
625 Ga0207703_10136592
626 Ga0207639_10018471
627 Ga0207639_10082831
628 Ga0207678_10006835
629 Ga0207678_10020248
630 Ga0207708_10000606
631 Ga0207708_10163212
632 Ga0207708_10421430
633 Ga0207702_10226852
634 Ga0207702_10810763
635 Ga0207641_10013388
636 Ga0207648_10007180
637 Ga0207648_10392258
638 Ga0207676_10194100
639 Ga0207676_10274076
640 Ga0207674_10053701
641 Ga0207675_100015647
642 Ga0207675_101098580
643 Ga0207683_10004147
644 Ga0207683_10051721
645 Ga0207683_10092363
646 Ga0207683_10172694
647 Ga0207698_10020001
648 Ga0207698_10033725
649 Ga0207698_10130991
650 Ga0207698_10337363
651 Ga0207698_10710516
652 Ga0207428_10051369
653 Ga0207428_10310359
654 Ga0268264_10126256
655 Ga0268264_10272868
656 Ga0268264_10328125
657 Ga0307515_10270997
658 Ga0307513_10001044
659 Ga0307513_10317969
660 Ga0307508_10319719
661 Ga0307516_10026964
662 Ga0307405_10223695
663 Ga0307413_10276839
664 Ga0307406_10014272
665 Ga0307407_10020347
666 Ga0307409_100016986
667 Ga0307409_100090439
668 Ga0307409_100300087
669 Ga0307409_100515808
670 Ga0307416_100033267
671 Ga0307416_100043047
672 Ga0307411_10038965
673 Ga0307415_100044413
674 Ga0307415_100554507
675 Ga0307507_10000003
676 Ga0307510_10000606
677 Ga0373930_0011729
678 Ga0373949_0116808
679 Ga0373960_0004889
680 Ga0373962_0021756
681 Ga0373931_0001059
682 Ga0395899_0010285
683 Ga0395899_0049266
684 Ga0395900_0007861
685 Ga0395900_0218474
686 Ga0395898_0023162
687 Ga0395905_0007324
688 Ga0436364_1206511
689 Ga0395901_0006721
690 Ga0436365_0209010
691 Ga0451793_1377460
692 Ga0439449_0001346
693 Ga0450920_008476
694 Ga0466961_0366625
695 Ga0495629_0016645
696 Ga0495639_0010438
697 Ga0495662_0031406
698 Ga0495608_0180368
699 Ga0495645_0240779
700 Ga0495667_0304715
701 Ga0495656_0130240
702 Ga0495656_0419967
703 Ga0495625_0222649
704 Ga0495588_0138578
705 Ga0495588_0187529
706 Ga0495599_0571773
707 Ga0495658_0179769
708 Ga0495658_0569771
709 Ga0495636_0004039
710 Ga0495636_0013379
711 Ga0495687_004597
712 Ga0495687_006870
713 Ga0495675_0007013
714 Ga0495593_0287701
715 Ga0496101_0072273
716 Ga0496101_0183928
717 Ga0496102_0014268
718 Ga0496102_0038088
719 Ga0496102_0965889
720 Ga0496104_0044606
721 Ga0496104_0158279
722 Ga0496105_0011027
723 Ga0496105_0015841
724 Ga0496106_0023229
725 Ga0496106_0363415
726 Ga0496107_0118152
727 Ga0496108_0007374
728 Ga0496108_0010679
729 Ga0496108_0202178
730 Ga0496108_0203145
731 Ga0496108_0603337
732 Ga0496109_0008964
733 Ga0496109_0080884
734 Ga0496109_0286768
735 Ga0496109_0427272
736 Ga0496110_0000402
737 Ga0496110_0161570
738 Ga0496110_0417843
739 Ga0496111_0010190
740 Ga0496111_0046677
741 Ga0496111_0106594
742 Ga0496112_0050069
743 Ga0496113_0145953
744 Ga0496113_0261541
745 Ga0496114_0055060
746 Ga0496114_0062901
747 Ga0496114_0068519
748 Ga0496114_0360289
749 Ga0496115_0239079
750 Ga0501034_0284194
751 Ga0501038_0049927
752 nmdc:mga0yw44_104202_c1
753 nmdc:mga0yw44_133646_c1
754 nmdc:mga05p37_16410_c1
755 nmdc:mga08y16_20209_c1
756 nmdc:mga08y16_26119_c1
757 nmdc:mga08y16_350600_c1
758 nmdc:mga0n895_13328_c1
759 nmdc:mga0rr50_135793_c1
760 nmdc:mga08x19_13913_c1
761 nmdc:mga0a205_8962_c1
762 nmdc:mga0a205_937151_c1
763 Ga0495655_0000690
764 Ga0495655_0015796
765 Ga0495619_0275958
766 Ga0500600_0075163
767 Ga0501082_0280570
768 2643903522
769 2644409684
770 2795785932
771 2856744857
772 2861525031
773 2873319824
774 2891397927
775 2891404394
776 2891567053
777 2912764789
778 2946052895
779 3003003329
780 3006498455
781 8055181543
782 8057570032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

116

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

152

208

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9808 155 215
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9794 153 215
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.975 155 215
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9736 153 215
1zlj-assembly2.cif.gz_C crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.9722 155 211
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9704 155 212 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9703 155 209 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9678 153 215 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9631 155 215 1.10.10.10
1zlkB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9604 152 213 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I1ZWD0-F1-model_v4 Two component transcriptional regulator, LuxR family 0.9776 4 218 GO:0000160
GO:0003677
GO:0006355
AF-A0A1Q9U024-F1-model_v4 deleted 0.9651 4 220
AF-A0A542H540-F1-model_v4 LuxR family two component transcriptional regulator 0.9624 1 218 GO:0000160
GO:0003677
GO:0006355
AF-A0A5D0UP06-F1-model_v4 Response regulator transcription factor 0.9619 4 219 GO:0000160
GO:0003677
GO:0006355
AF-D6X990-F1-model_v4 Two-component system regulator 0.9583 4 218 GO:0000160
GO:0003677
GO:0006355

Map