F431833

General Info

Members Datasets Scaffolds Average Seq Length
390 248 369 207

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0018581|Ga0496117_0018581_2772_3506
Length 244
Sequence VAGPAEAPSRRHANASLSFPAQRRVKLHVHPLPVHAMPATWYFDFISPFAYLQLHRIAALRERIEIIPKPIVFGALLKHHGQLGPAEIPGKRAFTYRFVQWQAEHEGIALRFPPAHPFNPLAALRLCIAAGSNWTAVSAIFEHLWRDGRNGDSADDLAAVAATLGIADVATAIAAEAVKTELRTNTEAAIAAGVFGVPTLQVDDLLFWGTDATPMIEDWLDRPERFHSDEYARIATLPGMQRAR

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
5 2734482264 Dyella sp. AD052 Isolate Unclassified
6 2738543009 Luteibacter sp. OK325 Isolate Unclassified
7 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
8 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
9 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
10 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
11 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
12 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
13 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
14 2919085039 Luteibacter sp. 1214 Isolate Unclassified
15 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
16 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
17 2941471342 Luteibacter sp. 621 Isolate Unclassified
18 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
209 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
226 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
231 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
232 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
247 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
248 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.85
Metatranscriptomes 0.77
Isolates 5.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.64
Nodule 0
Rhizoplane 2.05
Rhizosphere 81.79
Stem 0
Stem Tuber 0
Unclassified 10.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001478 3300001915 Bacteria 6711
2 JGI24741J21665_1007011 3300001915 Bacteria 2215
3 JGI24741J21665_1019039 3300001915 Bacteria 1091
4 JGI24740J21852_10015830 3300001979 Bacteria 2741
5 JGI25152J39213_1000240 3300002773 Bacteria 36681
6 JGI25150J39212_1000170 3300002774 Bacteria 36653
7 JGI25151J46595_10000109 3300003187 Bacteria 112044
8 JGI25153J46596_10000084 3300003215 Bacteria 112044
9 Ga0058692_1000013 3300003856 Bacteria 316299
10 Ga0065704_10071352 3300005289 Bacteria 11574
11 Ga0070658_10059433 3300005327 Bacteria 3113
12 Ga0070658_10558910 3300005327 Bacteria 990
13 Ga0070676_10005754 3300005328 Bacteria 6609
14 Ga0070670_100002870 3300005331 Bacteria 14263
15 Ga0070670_100126868 3300005331 Bacteria 2203
16 Ga0068869_100035452 3300005334 Bacteria 3536
17 Ga0070680_100000209 3300005336 Bacteria 38470
18 Ga0070682_100037751 3300005337 Bacteria 2959
19 Ga0070682_100585496 3300005337 Bacteria 878
20 Ga0068868_100070348 3300005338 Bacteria 2790
21 Ga0070660_100080351 3300005339 Bacteria 2558
22 Ga0070660_100611706 3300005339 Unclassified 911
23 Ga0070661_100030679 3300005344 Bacteria 3884
24 Ga0070661_100098873 3300005344 Bacteria 2167
25 Ga0070692_10003374 3300005345 Bacteria 6466
26 Ga0070668_100072657 3300005347 Bacteria 2680
27 Ga0070669_100078472 3300005353 Bacteria 2454
28 Ga0070669_100114900 3300005353 Bacteria 2047
29 Ga0070671_100022554 3300005355 Bacteria 5142
30 Ga0070673_100381110 3300005364 Bacteria 1257
31 Ga0070659_100080881 3300005366 Bacteria 2594
32 Ga0070709_10075931 3300005434 Bacteria 2181
33 Ga0070711_100040095 3300005439 Bacteria 3156
34 Ga0070711_100879639 3300005439 Bacteria 764
35 Ga0070663_100047147 3300005455 Bacteria 3052
36 Ga0070663_100113265 3300005455 Bacteria 2041
37 Ga0070663_100160645 3300005455 Bacteria 1729
38 Ga0070663_100416716 3300005455 Bacteria 1101
39 Ga0070678_100236707 3300005456 Bacteria 1525
40 Ga0070681_10000397 3300005458 Bacteria 35263
41 Ga0070681_10025928 3300005458 Bacteria 5894
42 Ga0070679_100000412 3300005530 Bacteria 36448
43 Ga0070679_100175215 3300005530 Bacteria 2117
44 Ga0070684_100038273 3300005535 Bacteria 4119
45 Ga0068853_100012331 3300005539 Bacteria 6954
46 Ga0068853_100058274 3300005539 Bacteria 3334
47 Ga0068853_100117334 3300005539 Bacteria 2370
48 Ga0070665_100133184 3300005548 Bacteria 2487
49 Ga0070665_101144041 3300005548 Bacteria 789
50 Ga0070665_101304932 3300005548 Bacteria 736
51 Ga0068855_100064052 3300005563 Bacteria 4288
52 Ga0068857_100175652 3300005577 Bacteria 1948
53 Ga0068854_100611598 3300005578 Unclassified 931
54 Ga0068856_100142680 3300005614 Bacteria 2402
55 Ga0068856_100179112 3300005614 Bacteria 2132
56 Ga0070702_100330134 3300005615 Bacteria 1066
57 Ga0068852_100145835 3300005616 Unclassified 2195
58 Ga0068852_100198428 3300005616 Bacteria 1898
59 Ga0068859_100859401 3300005617 Bacteria 993
60 Ga0068861_100047197 3300005719 Bacteria 3250
61 Ga0068851_10369707 3300005834 Unclassified 838
62 Ga0068860_100041617 3300005843 Bacteria 4389
63 Ga0081455_10162313 3300005937 Bacteria 1711
64 Ga0075364_10000094 3300006051 Bacteria 36136
65 Ga0075369_10084757 3300006186 Bacteria 1409
66 Ga0068865_100004540 3300006881 Bacteria 8374
67 Ga0068865_100044497 3300006881 Bacteria 3039
68 Ga0097620_100025671 3300006931 Bacteria 5910
69 Ga0097620_100859431 3300006931 Bacteria 993
70 Ga0105251_10000272 3300009011 Bacteria 51783
71 Ga0105240_10457343 3300009093 Bacteria 1427
72 Ga0105240_11051454 3300009093 Unclassified 868
73 Ga0105241_10008658 3300009174 Bacteria 7479
74 Ga0105241_10059823 3300009174 Bacteria 2930
75 Ga0105241_10142779 3300009174 Bacteria 1951
76 Ga0105242_10037151 3300009176 Bacteria 3911
77 Ga0105237_10006937 3300009545 Bacteria 12486
78 Ga0105238_10001169 3300009551 Bacteria 26421
79 Ga0105238_10021534 3300009551 Bacteria 6566
80 Ga0105249_10167329 3300009553 Bacteria 2129
81 Ga0105249_10286667 3300009553 Bacteria 1647
82 Ga0105239_10007867 3300010375 Bacteria 12184
83 Ga0105239_10038400 3300010375 Bacteria 5247
84 Ga0105239_10041588 3300010375 Bacteria 5037
85 Ga0105239_10410431 3300010375 Bacteria 1533
86 Ga0105239_10851717 3300010375 Bacteria 1045
87 Ga0157373_10140897 3300013100 Bacteria 1696
88 Ga0157370_10005440 3300013104 Bacteria 14285
89 Ga0157370_10038994 3300013104 Bacteria 4594
90 Ga0157370_10049704 3300013104 Bacteria 4013
91 Ga0157370_10177823 3300013104 Bacteria 1978
92 Ga0157369_10001448 3300013105 Bacteria 29115
93 Ga0157369_10008373 3300013105 Bacteria 11860
94 Ga0157369_10109596 3300013105 Bacteria 2935
95 Ga0157369_11039950 3300013105 Unclassified 838
96 Ga0157374_10105745 3300013296 Bacteria 2703
97 Ga0163162_10017502 3300013306 Bacteria 7011
98 Ga0157372_10001569 3300013307 Bacteria 24888
99 Ga0157375_10000387 3300013308 Bacteria 40109
100 Ga0182008_10063635 3300014497 Bacteria 1817
101 Ga0157376_10010790 3300014969 Bacteria 6705
102 Ga0182006_1000031 3300015261 Bacteria 240055
103 Ga0182007_10022292 3300015262 Bacteria 2238
104 Ga0182005_1000049 3300015265 Bacteria 123003
105 Ga0182005_1037400 3300015265 Bacteria 1320
106 Ga0206356_10663857 3300020070 Unclassified 847
107 Ga0206352_11254628 3300020078 Bacteria 1423
108 Ga0154015_1397088 3300020610 Bacteria 2699
109 Ga0213876_10141892 3300021384 Bacteria 1277
110 Ga0207425_1000290 3300025245 Bacteria 36693
111 Ga0209148_1001786 3300025254 Bacteria 9177
112 Ga0209129_1000202 3300025258 Bacteria 72795
113 Ga0209025_1000013 3300025294 Bacteria 871757
114 Ga0209758_1000014 3300025297 Bacteria 871757
115 Ga0209051_1046965 3300025303 Bacteria 1480
116 Ga0207713_1000379 3300025735 Bacteria 48102
117 Ga0207647_10003545 3300025904 Bacteria 11708
118 Ga0207645_10196514 3300025907 Bacteria 1326
119 Ga0207643_10028979 3300025908 Bacteria 3078
120 Ga0207705_10042418 3300025909 Bacteria 3266
121 Ga0207705_10053410 3300025909 Bacteria 2911
122 Ga0207705_10072652 3300025909 Bacteria 2495
123 Ga0207654_10011951 3300025911 Bacteria 4439
124 Ga0207654_10013662 3300025911 Bacteria 4181
125 Ga0207654_10239095 3300025911 Bacteria 1213
126 Ga0207707_10000665 3300025912 Bacteria 34141
127 Ga0207707_10014279 3300025912 Bacteria 6919
128 Ga0207707_10044279 3300025912 Bacteria 3881
129 Ga0207695_10000772 3300025913 Bacteria 60706
130 Ga0207695_10010105 3300025913 Bacteria 11581
131 Ga0207695_10024219 3300025913 Bacteria 6835
132 Ga0207671_10042402 3300025914 Bacteria 3368
133 Ga0207671_10070744 3300025914 Bacteria 2602
134 Ga0207660_10010119 3300025917 Bacteria 6109
135 Ga0207660_10076395 3300025917 Bacteria 2449
136 Ga0207660_10088563 3300025917 Bacteria 2289
137 Ga0207657_10102110 3300025919 Bacteria 2379
138 Ga0207657_10104237 3300025919 Bacteria 2350
139 Ga0207649_10002467 3300025920 Bacteria 10351
140 Ga0207649_10262153 3300025920 Bacteria 1249
141 Ga0207652_10000030 3300025921 Bacteria 144884
142 Ga0207652_10072863 3300025921 Bacteria 2987
143 Ga0207652_10189536 3300025921 Bacteria 1850
144 Ga0207652_10219208 3300025921 Bacteria 1714
145 Ga0207681_10003654 3300025923 Bacteria 9567
146 Ga0207681_10111798 3300025923 Bacteria 1988
147 Ga0207694_10000595 3300025924 Bacteria 32650
148 Ga0207650_10001381 3300025925 Bacteria 17512
149 Ga0207650_10503629 3300025925 Bacteria 1012
150 Ga0207706_11010977 3300025933 Bacteria 698
151 Ga0207709_10009873 3300025935 Bacteria 5255
152 Ga0207704_10056639 3300025938 Bacteria 2403
153 Ga0207704_10274035 3300025938 Bacteria 1279
154 Ga0207689_10006632 3300025942 Bacteria 10208
155 Ga0207667_10019209 3300025949 Bacteria 7642
156 Ga0207667_10045524 3300025949 Bacteria 4646
157 Ga0207667_10918027 3300025949 Bacteria 867
158 Ga0207712_10178341 3300025961 Bacteria 1666
159 Ga0207712_10190047 3300025961 Bacteria 1620
160 Ga0207668_10167787 3300025972 Bacteria 1718
161 Ga0207640_10026022 3300025981 Bacteria 3548
162 Ga0207640_10059749 3300025981 Bacteria 2517
163 Ga0207640_10310737 3300025981 Bacteria 1251
164 Ga0207677_10052309 3300026023 Bacteria 2774
165 Ga0207677_10551712 3300026023 Bacteria 1004
166 Ga0207639_10007620 3300026041 Bacteria 7383
167 Ga0207639_10027825 3300026041 Bacteria 4121
168 Ga0207639_10079574 3300026041 Bacteria 2591
169 Ga0207678_10056671 3300026067 Bacteria 3373
170 Ga0207678_10113349 3300026067 Bacteria 2313
171 Ga0207678_10126812 3300026067 Bacteria 2177
172 Ga0207702_10032894 3300026078 Bacteria 4328
173 Ga0207702_10042470 3300026078 Bacteria 3814
174 Ga0207702_10050932 3300026078 Bacteria 3497
175 Ga0207648_10083390 3300026089 Bacteria 2788
176 Ga0207648_10271604 3300026089 Bacteria 1515
177 Ga0207683_10035784 3300026121 Bacteria 4319
178 Ga0207698_10084983 3300026142 Bacteria 2567
179 Ga0209371_1000007 3300027312 Bacteria 1050654
180 Ga0209371_1000536 3300027312 Bacteria 36059
181 Ga0268266_10223367 3300028379 Bacteria 1732
182 Ga0268266_10376809 3300028379 Bacteria 1338
183 Ga0268264_10037305 3300028381 Bacteria 4007
184 Ga0268256_1000008 3300030500 Bacteria 1050654
185 Ga0268256_1000453 3300030500 Bacteria 36046
186 Ga0307516_10000131 3300031730 Bacteria 89180
187 Ga0307405_10438329 3300031731 Bacteria 1033
188 Ga0307412_10100160 3300031911 Bacteria 2047
189 Ga0307414_10035660 3300032004 Bacteria 3312
190 Ga0307414_10065638 3300032004 Bacteria 2590
191 Ga0307414_10318931 3300032004 Bacteria 1322
192 Ga0307411_10141068 3300032005 Bacteria 1777
193 Ga0373956_0170514 3300035119 Bacteria 1027
194 Ga0373924_0249764 3300035410 Bacteria 785
195 Ga0373935_0311022 3300035692 Bacteria 1116
196 Ga0395905_0053002 3300037471 Bacteria 3797
197 Ga0395905_0105056 3300037471 Bacteria 2652
198 Ga0436365_1534762 3300039437 Bacteria 5644
199 Ga0436363_1171326 3300039450 Bacteria 1288
200 Ga0439436_0023278 3300041404 Bacteria 1832
201 Ga0439465_0000340 3300041413 Bacteria 13355
202 Ga0439465_0009287 3300041413 Bacteria 3097
203 Ga0451793_0550263 3300041452 Bacteria 1568
204 Ga0451795_0034327 3300041456 Bacteria 1926
205 Ga0451853_0869417 3300041512 Bacteria 822
206 Ga0439449_0010557 3300042007 Bacteria 3490
207 Ga0439452_013570 3300042010 Bacteria 2284
208 Ga0466957_0032933 3300044842 Bacteria 3106
209 Ga0451576_0939088 3300045051 Bacteria 907
210 Ga0495617_000607 3300046452 Bacteria 18027
211 Ga0495627_066401 3300046453 Bacteria 1059
212 Ga0495629_0022158 3300046459 Bacteria 4531
213 Ga0495650_0000869 3300046471 Bacteria 35923
214 Ga0495582_0072145 3300046473 Bacteria 1910
215 Ga0495662_0233342 3300046476 Bacteria 907
216 Ga0495584_0001662 3300046491 Bacteria 13072
217 Ga0495585_0001138 3300046492 Bacteria 21797
218 Ga0495585_0236455 3300046492 Bacteria 916
219 Ga0495607_0000133 3300046501 Bacteria 78789
220 Ga0495607_0000801 3300046501 Bacteria 29724
221 Ga0495607_0007528 3300046501 Bacteria 7519
222 Ga0495583_0012850 3300046506 Bacteria 4709
223 Ga0495606_0000160 3300046507 Bacteria 118218
224 Ga0495606_0001918 3300046507 Bacteria 25850
225 Ga0495606_0002253 3300046507 Bacteria 22923
226 Ga0495606_0273247 3300046507 Bacteria 927
227 Ga0495616_0000006 3300046513 Bacteria 234766
228 Ga0495616_0119439 3300046513 Bacteria 1218
229 Ga0495620_0000711 3300046515 Bacteria 20541
230 Ga0495620_0020019 3300046515 Bacteria 3276
231 Ga0495630_0181334 3300046517 Bacteria 1606
232 Ga0495631_0000036 3300046518 Bacteria 81635
233 Ga0495631_0000318 3300046518 Bacteria 33436
234 Ga0495632_0035926 3300046519 Bacteria 2524
235 Ga0495632_0143754 3300046519 Bacteria 1105
236 Ga0495637_0005382 3300046520 Bacteria 6537
237 Ga0495648_0000881 3300046524 Bacteria 31575
238 Ga0495648_0007239 3300046524 Bacteria 8910
239 Ga0495586_0047660 3300046535 Bacteria 2314
240 Ga0495587_0143607 3300046536 Bacteria 1361
241 Ga0495609_0036506 3300046538 Bacteria 2218
242 Ga0495633_0025483 3300046558 Bacteria 2910
243 Ga0495656_0066462 3300046615 Bacteria 1588
244 Ga0495668_0009490 3300046616 Bacteria 5974
245 Ga0495668_0127540 3300046616 Bacteria 1393
246 Ga0495611_0000003 3300046648 Bacteria 395679
247 Ga0495611_0000028 3300046648 Bacteria 116155
248 Ga0495625_0000193 3300046660 Bacteria 97042
249 Ga0495625_0006388 3300046660 Bacteria 10509
250 Ga0495625_0023511 3300046660 Bacteria 4707
251 Ga0495661_0001277 3300046665 Bacteria 21603
252 Ga0495646_0297694 3300046680 Bacteria 854
253 Ga0495658_0003717 3300046683 Bacteria 7546
254 Ga0495670_0000413 3300046691 Bacteria 20501
255 Ga0495670_0005889 3300046691 Bacteria 6008
256 Ga0495671_0000142 3300046692 Bacteria 63300
257 Ga0495589_0000042 3300046794 Bacteria 138627
258 Ga0495660_0000531 3300046810 Bacteria 31168
259 Ga0495660_0004438 3300046810 Bacteria 8484
260 Ga0495683_0000722 3300047323 Bacteria 24066
261 Ga0495679_000046 3300047446 Bacteria 132566
262 Ga0495673_0000004 3300047469 Bacteria 1354526
263 Ga0495673_0000041 3300047469 Bacteria 296723
264 Ga0495673_0004939 3300047469 Bacteria 8207
265 Ga0495673_0013654 3300047469 Bacteria 4254
266 Ga0495681_0107950 3300047470 Bacteria 1209
267 Ga0495684_0082506 3300047471 Bacteria 2439
268 Ga0495686_0000229 3300047472 Bacteria 103283
269 Ga0495686_0002823 3300047472 Bacteria 15713
270 Ga0495686_0038555 3300047472 Bacteria 3055
271 Ga0495686_0045468 3300047472 Bacteria 2778
272 Ga0495686_0163395 3300047472 Bacteria 1299
273 Ga0496101_0009659 3300048904 Bacteria 6347
274 Ga0496103_0045864 3300048906 Bacteria 2698
275 Ga0496104_0000005 3300048907 Bacteria 620360
276 Ga0496105_0000084 3300048908 Bacteria 67834
277 Ga0496106_0001877 3300048909 Bacteria 15732
278 Ga0496115_0000002 3300048918 Bacteria 365286
279 Ga0496116_0074788 3300048919 Bacteria 2129
280 Ga0496116_0178124 3300048919 Bacteria 1142
281 Ga0496116_0228143 3300048919 Bacteria 947
282 Ga0496117_0000368 3300048920 Bacteria 78448
283 Ga0496117_0018581 3300048920 Bacteria 5750
284 Ga0496117_0026634 3300048920 Bacteria 4521
285 Ga0496118_0000274 3300048921 Bacteria 90649
286 Ga0496118_0002903 3300048921 Bacteria 22296
287 Ga0496118_0238907 3300048921 Bacteria 1042
288 Ga0496119_0007968 3300048922 Bacteria 9421
289 Ga0496120_0000458 3300048923 Bacteria 64377
290 Ga0496121_0000771 3300048924 Bacteria 58811
291 Ga0496121_0001298 3300048924 Bacteria 42922
292 Ga0496121_0003299 3300048924 Bacteria 23175
293 Ga0496121_0058233 3300048924 Bacteria 3195
294 Ga0496122_0000896 3300048925 Bacteria 55027
295 Ga0496122_0027722 3300048925 Bacteria 4833
296 Ga0496122_0082260 3300048925 Bacteria 2237
297 Ga0496123_0000137 3300048926 Bacteria 152169
298 Ga0496123_0007772 3300048926 Bacteria 9994
299 Ga0496123_0144659 3300048926 Bacteria 1293
300 Ga0496124_0000725 3300048927 Bacteria 54102
301 Ga0496126_0000052 3300048929 Bacteria 312383
302 Ga0496126_0110144 3300048929 Bacteria 2399
303 Ga0496126_0197930 3300048929 Bacteria 1698
304 Ga0496126_0334360 3300048929 Bacteria 1242
305 Ga0495678_000066 3300049459 Bacteria 133706
306 Ga0495682_0003108 3300049460 Bacteria 7515
307 Ga0495682_0044760 3300049460 Bacteria 1618
308 Ga0501290_000533 3300049513 Bacteria 5839
309 Ga0501300_000457 3300049523 Bacteria 6216
310 Ga0501031_0014145 3300049568 Bacteria 5191
311 Ga0501032_0003524 3300049569 Bacteria 11954
312 Ga0501032_0019056 3300049569 Bacteria 4801
313 Ga0501033_0002011 3300049570 Bacteria 17702
314 Ga0501033_0069462 3300049570 Bacteria 2589
315 Ga0501034_0088970 3300049571 Bacteria 3085
316 Ga0501034_0110920 3300049571 Bacteria 2734
317 Ga0501034_0780524 3300049571 Bacteria 849
318 Ga0501034_0989339 3300049571 Bacteria 725
319 Ga0501036_0002973 3300049572 Bacteria 13472
320 Ga0501036_0008879 3300049572 Bacteria 8254
321 Ga0501037_0002843 3300049573 Bacteria 12548
322 Ga0501037_0016811 3300049573 Bacteria 5382
323 Ga0501037_0122246 3300049573 Bacteria 1871
324 Ga0501038_0006324 3300049574 Bacteria 10956
325 Ga0501038_0023611 3300049574 Bacteria 5495
326 Ga0501039_0010313 3300049575 Bacteria 7126
327 Ga0501039_0014913 3300049575 Bacteria 5943
328 Ga0501043_0003736 3300049579 Bacteria 12509
329 Ga0501043_0018116 3300049579 Bacteria 5522
330 Ga0501046_0004198 3300049580 Bacteria 13115
331 Ga0501046_0095323 3300049580 Bacteria 2286
332 Ga0501047_0006484 3300049581 Bacteria 11011
333 Ga0501047_0036823 3300049581 Bacteria 4729
334 Ga0501047_0342096 3300049581 Bacteria 1333
335 Ga0501068_0224560 3300049584 Bacteria 1194
336 Ga0501070_0013661 3300049586 Bacteria 6840
337 Ga0501070_0157035 3300049586 Bacteria 1876
338 Ga0501071_0044744 3300049587 Bacteria 3176
339 Ga0501073_0001983 3300049589 Bacteria 15269
340 Ga0501073_0049174 3300049589 Bacteria 2957
341 Ga0501073_0056326 3300049589 Bacteria 2750
342 Ga0501073_0094545 3300049589 Bacteria 2076
343 Ga0501073_0240893 3300049589 Bacteria 1249
344 Ga0501257_014571 3300049686 Bacteria 1811
345 Ga0501259_014756 3300049688 Bacteria 1328
346 Ga0501079_0502862 3300049741 Bacteria 953
347 Ga0501080_0001460 3300049742 Bacteria 19904
348 Ga0501080_0018916 3300049742 Bacteria 6379
349 Ga0501083_0066001 3300049744 Bacteria 2410
350 Ga0501265_000539 3300049762 Bacteria 4032
351 Ga0501270_015427 3300049767 Bacteria 1091
352 Ga0501275_000070 3300049772 Bacteria 10319
353 Ga0501035_0005648 3300049822 Bacteria 11811
354 Ga0501035_0045725 3300049822 Bacteria 3937
355 Ga0501035_0173726 3300049822 Bacteria 1860
356 Ga0501044_0020335 3300049823 Bacteria 7086
357 Ga0501044_0025120 3300049823 Bacteria 6317
358 Ga0501044_0156848 3300049823 Bacteria 2255
359 nmdc:mga00v17_705_c1 3300050491 Bacteria 18275
360 nmdc:mga0sz30_61222_c1 3300050516 Bacteria 1608
361 Ga0500643_000036 3300053087 Bacteria 183253
362 Ga0500583_0152372 3300053092 Bacteria 1151
363 Ga0500651_0000551 3300053093 Bacteria 19061
364 Ga0500555_001310 3300053103 Bacteria 7858
365 Ga0500568_0014286 3300053139 Bacteria 3590
366 Ga0500633_0049564 3300053160 Bacteria 1444
367 Ga0500634_0037354 3300053161 Bacteria 2641
368 Ga0500645_000639 3300053730 Bacteria 22272
369 Ga0501082_0000044 3300060353 Bacteria 86405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0027722 Ga0496122_0027722_3993_4619 179
2 3300048926 Ga0496123_0007772 Ga0496123_0007772_3507_4133 179
3 3300005455 Ga0070663_100113265 Ga0070663_1001132652 188
4 3300026067 Ga0207678_10126812 Ga0207678_101268122 188
5 3300046507 Ga0495606_0001918 Ga0495606_0001918_17928_18554 188
6 3300046660 Ga0495625_0006388 Ga0495625_0006388_2761_3387 188
7 3300047472 Ga0495686_0038555 Ga0495686_0038555_2060_2686 188
8 3300049568 Ga0501031_0014145 Ga0501031_0014145_4513_5175 188
9 3300049569 Ga0501032_0003524 Ga0501032_0003524_5939_6601 188
10 3300049570 Ga0501033_0002011 Ga0501033_0002011_3555_4217 188
11 3300049572 Ga0501036_0002973 Ga0501036_0002973_6138_6800 188
12 3300049573 Ga0501037_0002843 Ga0501037_0002843_360_1022 188
13 3300049574 Ga0501038_0006324 Ga0501038_0006324_4563_5225 188
14 3300049575 Ga0501039_0010313 Ga0501039_0010313_734_1396 188
15 3300049580 Ga0501046_0004198 Ga0501046_0004198_6455_7117 188
16 3300049581 Ga0501047_0006484 Ga0501047_0006484_5341_6003 188
17 3300049589 Ga0501073_0001983 Ga0501073_0001983_5331_5993 188
18 3300049742 Ga0501080_0001460 Ga0501080_0001460_14010_14672 188
19 3300049822 Ga0501035_0045725 Ga0501035_0045725_488_1150 188
20 3300049823 Ga0501044_0020335 Ga0501044_0020335_488_1150 188
21 3300046452 Ga0495617_000607 Ga0495617_000607_10536_11162 189
22 3300046492 Ga0495585_0236455 Ga0495585_0236455_269_895 189
23 3300046515 Ga0495620_0000711 Ga0495620_0000711_10495_11121 189
24 3300049579 Ga0501043_0003736 Ga0501043_0003736_7775_8437 189
25 3300046471 Ga0495650_0000869 Ga0495650_0000869_18076_18702 190
26 3300046501 Ga0495607_0000801 Ga0495607_0000801_27721_28347 190
27 3300046507 Ga0495606_0273247 Ga0495606_0273247_275_901 190
28 3300046518 Ga0495631_0000036 Ga0495631_0000036_49402_50028 190
29 3300046519 Ga0495632_0143754 Ga0495632_0143754_465_1091 190
30 3300046524 Ga0495648_0007239 Ga0495648_0007239_4661_5287 190
31 3300046648 Ga0495611_0000028 Ga0495611_0000028_23591_24217 190
32 3300046660 Ga0495625_0023511 Ga0495625_0023511_852_1478 190
33 3300047469 Ga0495673_0000041 Ga0495673_0000041_190078_190704 190
34 3300047472 Ga0495686_0163395 Ga0495686_0163395_289_915 190
35 3300048924 Ga0496121_0058233 Ga0496121_0058233_1215_1841 190
36 3300053160 Ga0500633_0049564 Ga0500633_0049564_451_1077 190
37 3300025920 Ga0207649_10262153 Ga0207649_102621532 191
38 3300041456 Ga0451795_0034327 Ga0451795_0034327_1086_1712 191
39 3300047472 Ga0495686_0000229 Ga0495686_0000229_64011_64637 191
40 3300013104 Ga0157370_10005440 Ga0157370_1000544010 193
41 3300013104 Ga0157370_10038994 Ga0157370_100389942 193
42 3300046660 Ga0495625_0000193 Ga0495625_0000193_14713_15339 193
43 3300015265 Ga0182005_1000049 Ga0182005_100004994 194
44 3300048919 Ga0496116_0228143 Ga0496116_0228143_130_759 194
45 3300005617 Ga0068859_100859401 Ga0068859_1008594011 195
46 3300006931 Ga0097620_100859431 Ga0097620_1008594311 195
47 3300010375 Ga0105239_10410431 Ga0105239_104104312 197
48 3300014497 Ga0182008_10063635 Ga0182008_100636352 197
49 3300015261 Ga0182006_1000031 Ga0182006_100003199 197
50 3300015262 Ga0182007_10022292 Ga0182007_100222922 197
51 3300015265 Ga0182005_1037400 Ga0182005_10374002 197
52 3300046492 Ga0495585_0001138 Ga0495585_0001138_6535_7161 197
53 3300046501 Ga0495607_0000133 Ga0495607_0000133_5231_5857 197
54 3300046506 Ga0495583_0012850 Ga0495583_0012850_1170_1796 197
55 3300046513 Ga0495616_0119439 Ga0495616_0119439_326_952 197
56 3300046518 Ga0495631_0000318 Ga0495631_0000318_18121_18747 197
57 3300046519 Ga0495632_0035926 Ga0495632_0035926_1411_2037 197
58 3300046520 Ga0495637_0005382 Ga0495637_0005382_3459_4085 197
59 3300046524 Ga0495648_0000881 Ga0495648_0000881_30044_30670 197
60 3300046538 Ga0495609_0036506 Ga0495609_0036506_1179_1805 197
61 3300046616 Ga0495668_0009490 Ga0495668_0009490_2658_3284 197
62 3300046616 Ga0495668_0127540 Ga0495668_0127540_674_1300 197
63 3300046648 Ga0495611_0000003 Ga0495611_0000003_380343_380969 197
64 3300046665 Ga0495661_0001277 Ga0495661_0001277_10993_11619 197
65 3300046691 Ga0495670_0000413 Ga0495670_0000413_2710_3336 197
66 3300046692 Ga0495671_0000142 Ga0495671_0000142_57445_58071 197
67 3300046794 Ga0495589_0000042 Ga0495589_0000042_14951_15577 197
68 3300046810 Ga0495660_0000531 Ga0495660_0000531_1404_2030 197
69 3300046810 Ga0495660_0004438 Ga0495660_0004438_1239_1865 197
70 3300047446 Ga0495679_000046 Ga0495679_000046_14713_15339 197
71 3300047469 Ga0495673_0000004 Ga0495673_0000004_578252_578878 197
72 3300047469 Ga0495673_0004939 Ga0495673_0004939_4796_5422 197
73 3300047470 Ga0495681_0107950 Ga0495681_0107950_561_1187 197
74 3300048924 Ga0496121_0000771 Ga0496121_0000771_42716_43342 197
75 3300049459 Ga0495678_000066 Ga0495678_000066_58698_59324 197
76 3300049460 Ga0495682_0003108 Ga0495682_0003108_1487_2113 197
77 3300049460 Ga0495682_0044760 Ga0495682_0044760_763_1389 197
78 3300053087 Ga0500643_000036 Ga0500643_000036_66135_66761 197
79 3300053092 Ga0500583_0152372 Ga0500583_0152372_390_1016 197
80 3300053103 Ga0500555_001310 Ga0500555_001310_6141_6767 197
81 3300053730 Ga0500645_000639 Ga0500645_000639_4861_5487 197
82 3300009545 Ga0105237_10006937 Ga0105237_100069379 199
83 iso_pu_bacteria 2894414249 2894414374 202
84 3300005455 Ga0070663_100047147 Ga0070663_1000471472 204
85 3300026067 Ga0207678_10113349 Ga0207678_101133492 204
86 iso_pu_bacteria 2524614729 2525557338 204
87 iso_pu_bacteria 2593339238 2595447966 204
88 iso_pu_bacteria 2627854209 2630650554 204
89 iso_pu_bacteria 2718218334 2721026094 204
90 iso_pu_bacteria 2734482264 2735833938 204
91 iso_pu_bacteria 2738543009 2739228920 204
92 iso_pu_bacteria 2818991440 2819565562 204
93 iso_pu_bacteria 2842918807 2842922148 204
94 iso_pu_bacteria 2884338543 2884341928 204
95 iso_pu_bacteria 2904463128 2904466064 204
96 iso_pu_bacteria 2941471342 2941474334 204
97 iso_pu_bacteria 2953994433 2953997266 204
98 iso_pu_bacteria 2852684882 2852687112 205
99 iso_pu_bacteria 2919085039 2919087327 205
100 iso_pu_bacteria 2919130084 2919131114 205
101 iso_pu_bacteria 2929195423 2929196354 205
102 iso_pu_bacteria 8021622325 8021623380 205
103 iso_pu_bacteria 8021626552 8021630616 205
104 iso_pu_bacteria 8021648035 8021650664 205
105 3300005337 Ga0070682_100037751 Ga0070682_1000377512 206
106 3300005353 Ga0070669_100078472 Ga0070669_1000784722 206
107 3300005355 Ga0070671_100022554 Ga0070671_1000225542 206
108 3300025923 Ga0207681_10003654 Ga0207681_1000365410 206
109 3300032004 Ga0307414_10035660 Ga0307414_100356602 206
110 3300032004 Ga0307414_10065638 Ga0307414_100656383 206
111 3300037471 Ga0395905_0053002 Ga0395905_0053002_1669_2301 206
112 3300037471 Ga0395905_0105056 Ga0395905_0105056_65_697 206
113 3300049513 Ga0501290_000533 Ga0501290_000533_216_848 206
114 3300049523 Ga0501300_000457 Ga0501300_000457_4439_5071 206
115 3300049762 Ga0501265_000539 Ga0501265_000539_2279_2911 206
116 3300049772 Ga0501275_000070 Ga0501275_000070_6386_7018 206
117 iso_pu_bacteria 2765235840 2765580466 206
118 3300031731 Ga0307405_10438329 Ga0307405_104383291 207
119 3300031911 Ga0307412_10100160 Ga0307412_101001602 207
120 3300041404 Ga0439436_0023278 Ga0439436_0023278_736_1383 207
121 3300041413 Ga0439465_0009287 Ga0439465_0009287_1722_2369 207
122 3300042007 Ga0439449_0010557 Ga0439449_0010557_2257_2904 207
123 3300042010 Ga0439452_013570 Ga0439452_013570_830_1477 207
124 3300046491 Ga0495584_0001662 Ga0495584_0001662_9703_10326 207
125 3300046507 Ga0495606_0000160 Ga0495606_0000160_16887_17510 207
126 3300046513 Ga0495616_0000006 Ga0495616_0000006_109349_109972 207
127 3300046615 Ga0495656_0066462 Ga0495656_0066462_581_1207 207
128 3300046691 Ga0495670_0005889 Ga0495670_0005889_4493_5116 207
129 3300047323 Ga0495683_0000722 Ga0495683_0000722_14879_15502 207
130 3300047469 Ga0495673_0013654 Ga0495673_0013654_2158_2781 207
131 3300047472 Ga0495686_0002823 Ga0495686_0002823_11431_12054 207
132 3300048924 Ga0496121_0003299 Ga0496121_0003299_5210_5833 207
133 3300049569 Ga0501032_0019056 Ga0501032_0019056_2465_3118 207
134 3300049570 Ga0501033_0069462 Ga0501033_0069462_1820_2473 207
135 3300049571 Ga0501034_0088970 Ga0501034_0088970_1685_2338 207
136 3300049572 Ga0501036_0008879 Ga0501036_0008879_4419_5072 207
137 3300049573 Ga0501037_0016811 Ga0501037_0016811_3434_4087 207
138 3300049574 Ga0501038_0023611 Ga0501038_0023611_936_1589 207
139 3300049575 Ga0501039_0014913 Ga0501039_0014913_1579_2232 207
140 3300049579 Ga0501043_0018116 Ga0501043_0018116_3639_4292 207
141 3300049581 Ga0501047_0036823 Ga0501047_0036823_1200_1853 207
142 3300049584 Ga0501068_0224560 Ga0501068_0224560_288_941 207
143 3300049586 Ga0501070_0013661 Ga0501070_0013661_3301_3954 207
144 3300049587 Ga0501071_0044744 Ga0501071_0044744_1037_1690 207
145 3300049589 Ga0501073_0049174 Ga0501073_0049174_1517_2170 207
146 3300049686 Ga0501257_014571 Ga0501257_014571_1046_1678 207
147 3300049688 Ga0501259_014756 Ga0501259_014756_535_1167 207
148 3300049742 Ga0501080_0018916 Ga0501080_0018916_1579_2232 207
149 3300049767 Ga0501270_015427 Ga0501270_015427_128_760 207
150 3300049822 Ga0501035_0005648 Ga0501035_0005648_3555_4208 207
151 3300049823 Ga0501044_0025120 Ga0501044_0025120_1579_2232 207
152 3300002773 JGI25152J39213_1000240 JGI25152J39213_10002405 208
153 3300002774 JGI25150J39212_1000170 JGI25150J39212_10001705 208
154 3300003187 JGI25151J46595_10000109 JGI25151J46595_1000010929 208
155 3300003215 JGI25153J46596_10000084 JGI25153J46596_1000008429 208
156 3300009553 Ga0105249_10167329 Ga0105249_101673292 208
157 3300010375 Ga0105239_10851717 Ga0105239_108517172 208
158 3300013104 Ga0157370_10177823 Ga0157370_101778232 208
159 3300013105 Ga0157369_10109596 Ga0157369_101095962 208
160 3300025245 Ga0207425_1000290 Ga0207425_100029032 208
161 3300025254 Ga0209148_1001786 Ga0209148_10017864 208
162 3300025258 Ga0209129_1000202 Ga0209129_100020232 208
163 3300025294 Ga0209025_1000013 Ga0209025_100001332 208
164 3300025297 Ga0209758_1000014 Ga0209758_100001432 208
165 3300025303 Ga0209051_1046965 Ga0209051_10469652 208
166 3300025961 Ga0207712_10190047 Ga0207712_101900472 208
167 3300041413 Ga0439465_0000340 Ga0439465_0000340_12127_12753 208
168 3300044842 Ga0466957_0032933 Ga0466957_0032933_313_939 208
169 3300045051 Ga0451576_0939088 Ga0451576_0939088_165_800 208
170 3300046501 Ga0495607_0007528 Ga0495607_0007528_1723_2349 208
171 3300046507 Ga0495606_0002253 Ga0495606_0002253_8670_9296 208
172 3300046515 Ga0495620_0020019 Ga0495620_0020019_1088_1714 208
173 3300047472 Ga0495686_0045468 Ga0495686_0045468_492_1121 208
174 3300048904 Ga0496101_0009659 Ga0496101_0009659_2354_2980 208
175 3300048909 Ga0496106_0001877 Ga0496106_0001877_6883_7509 208
176 3300048919 Ga0496116_0074788 Ga0496116_0074788_586_1212 208
177 3300048920 Ga0496117_0018581 Ga0496117_0018581_2772_3506 208
178 3300048920 Ga0496117_0026634 Ga0496117_0026634_685_1311 208
179 3300048921 Ga0496118_0000274 Ga0496118_0000274_5651_6385 208
180 3300048921 Ga0496118_0002903 Ga0496118_0002903_14885_15511 208
181 3300048924 Ga0496121_0001298 Ga0496121_0001298_35508_36134 208
182 3300048925 Ga0496122_0082260 Ga0496122_0082260_483_1109 208
183 3300048926 Ga0496123_0144659 Ga0496123_0144659_546_1172 208
184 3300048929 Ga0496126_0110144 Ga0496126_0110144_886_1512 208
185 3300048929 Ga0496126_0197930 Ga0496126_0197930_176_802 208
186 3300001915 JGI24741J21665_1001478 JGI24741J21665_10014787 209
187 3300001915 JGI24741J21665_1007011 JGI24741J21665_10070112 209
188 3300001915 JGI24741J21665_1019039 JGI24741J21665_10190392 209
189 3300001979 JGI24740J21852_10015830 JGI24740J21852_100158302 209
190 3300003856 Ga0058692_1000013 Ga0058692_1000013235 209
191 3300005289 Ga0065704_10071352 Ga0065704_100713526 209
192 3300005327 Ga0070658_10059433 Ga0070658_100594332 209
193 3300005327 Ga0070658_10558910 Ga0070658_105589101 209
194 3300005328 Ga0070676_10005754 Ga0070676_100057545 209
195 3300005331 Ga0070670_100002870 Ga0070670_10000287011 209
196 3300005331 Ga0070670_100126868 Ga0070670_1001268683 209
197 3300005334 Ga0068869_100035452 Ga0068869_1000354523 209
198 3300005336 Ga0070680_100000209 Ga0070680_1000002099 209
199 3300005337 Ga0070682_100585496 Ga0070682_1005854961 209
200 3300005338 Ga0068868_100070348 Ga0068868_1000703481 209
201 3300005339 Ga0070660_100080351 Ga0070660_1000803511 209
202 3300005339 Ga0070660_100611706 Ga0070660_1006117061 209
203 3300005344 Ga0070661_100030679 Ga0070661_1000306792 209
204 3300005344 Ga0070661_100098873 Ga0070661_1000988733 209
205 3300005345 Ga0070692_10003374 Ga0070692_100033741 209
206 3300005347 Ga0070668_100072657 Ga0070668_1000726571 209
207 3300005353 Ga0070669_100114900 Ga0070669_1001149002 209
208 3300005364 Ga0070673_100381110 Ga0070673_1003811101 209
209 3300005366 Ga0070659_100080881 Ga0070659_1000808812 209
210 3300005434 Ga0070709_10075931 Ga0070709_100759312 209
211 3300005439 Ga0070711_100040095 Ga0070711_1000400953 209
212 3300005439 Ga0070711_100879639 Ga0070711_1008796391 209
213 3300005455 Ga0070663_100160645 Ga0070663_1001606452 209
214 3300005455 Ga0070663_100416716 Ga0070663_1004167162 209
215 3300005456 Ga0070678_100236707 Ga0070678_1002367072 209
216 3300005458 Ga0070681_10000397 Ga0070681_100003974 209
217 3300005458 Ga0070681_10025928 Ga0070681_100259285 209
218 3300005530 Ga0070679_100000412 Ga0070679_10000041231 209
219 3300005530 Ga0070679_100175215 Ga0070679_1001752152 209
220 3300005535 Ga0070684_100038273 Ga0070684_1000382735 209
221 3300005539 Ga0068853_100012331 Ga0068853_1000123316 209
222 3300005539 Ga0068853_100058274 Ga0068853_1000582743 209
223 3300005539 Ga0068853_100117334 Ga0068853_1001173342 209
224 3300005548 Ga0070665_100133184 Ga0070665_1001331842 209
225 3300005548 Ga0070665_101144041 Ga0070665_1011440411 209
226 3300005548 Ga0070665_101304932 Ga0070665_1013049321 209
227 3300005563 Ga0068855_100064052 Ga0068855_1000640523 209
228 3300005577 Ga0068857_100175652 Ga0068857_1001756522 209
229 3300005578 Ga0068854_100611598 Ga0068854_1006115982 209
230 3300005614 Ga0068856_100142680 Ga0068856_1001426802 209
231 3300005614 Ga0068856_100179112 Ga0068856_1001791122 209
232 3300005615 Ga0070702_100330134 Ga0070702_1003301341 209
233 3300005616 Ga0068852_100145835 Ga0068852_1001458352 209
234 3300005616 Ga0068852_100198428 Ga0068852_1001984283 209
235 3300005719 Ga0068861_100047197 Ga0068861_1000471972 209
236 3300005834 Ga0068851_10369707 Ga0068851_103697071 209
237 3300005843 Ga0068860_100041617 Ga0068860_1000416173 209
238 3300005937 Ga0081455_10162313 Ga0081455_101623132 209
239 3300006051 Ga0075364_10000094 Ga0075364_1000009424 209
240 3300006186 Ga0075369_10084757 Ga0075369_100847572 209
241 3300006881 Ga0068865_100004540 Ga0068865_1000045406 209
242 3300006881 Ga0068865_100044497 Ga0068865_1000444974 209
243 3300006931 Ga0097620_100025671 Ga0097620_1000256715 209
244 3300009011 Ga0105251_10000272 Ga0105251_1000027231 209
245 3300009093 Ga0105240_10457343 Ga0105240_104573431 209
246 3300009093 Ga0105240_11051454 Ga0105240_110514542 209
247 3300009174 Ga0105241_10008658 Ga0105241_100086585 209
248 3300009174 Ga0105241_10059823 Ga0105241_100598231 209
249 3300009174 Ga0105241_10142779 Ga0105241_101427792 209
250 3300009176 Ga0105242_10037151 Ga0105242_100371512 209
251 3300009551 Ga0105238_10001169 Ga0105238_1000116911 209
252 3300009551 Ga0105238_10021534 Ga0105238_100215345 209
253 3300009553 Ga0105249_10286667 Ga0105249_102866673 209
254 3300010375 Ga0105239_10007867 Ga0105239_100078676 209
255 3300010375 Ga0105239_10038400 Ga0105239_100384004 209
256 3300010375 Ga0105239_10041588 Ga0105239_100415885 209
257 3300013100 Ga0157373_10140897 Ga0157373_101408972 209
258 3300013104 Ga0157370_10049704 Ga0157370_100497042 209
259 3300013105 Ga0157369_10001448 Ga0157369_1000144812 209
260 3300013105 Ga0157369_10008373 Ga0157369_100083735 209
261 3300013105 Ga0157369_11039950 Ga0157369_110399501 209
262 3300013296 Ga0157374_10105745 Ga0157374_101057453 209
263 3300013306 Ga0163162_10017502 Ga0163162_100175025 209
264 3300013307 Ga0157372_10001569 Ga0157372_100015699 209
265 3300013308 Ga0157375_10000387 Ga0157375_100003875 209
266 3300014969 Ga0157376_10010790 Ga0157376_100107902 209
267 3300020070 Ga0206356_10663857 Ga0206356_106638571 209
268 3300020078 Ga0206352_11254628 Ga0206352_112546281 209
269 3300020610 Ga0154015_1397088 Ga0154015_13970882 209
270 3300021384 Ga0213876_10141892 Ga0213876_101418922 209
271 3300025735 Ga0207713_1000379 Ga0207713_100037928 209
272 3300025904 Ga0207647_10003545 Ga0207647_100035452 209
273 3300025907 Ga0207645_10196514 Ga0207645_101965141 209
274 3300025908 Ga0207643_10028979 Ga0207643_100289792 209
275 3300025909 Ga0207705_10042418 Ga0207705_100424182 209
276 3300025909 Ga0207705_10053410 Ga0207705_100534102 209
277 3300025909 Ga0207705_10072652 Ga0207705_100726523 209
278 3300025911 Ga0207654_10011951 Ga0207654_100119513 209
279 3300025911 Ga0207654_10013662 Ga0207654_100136623 209
280 3300025911 Ga0207654_10239095 Ga0207654_102390952 209
281 3300025912 Ga0207707_10000665 Ga0207707_100006654 209
282 3300025912 Ga0207707_10014279 Ga0207707_100142795 209
283 3300025912 Ga0207707_10044279 Ga0207707_100442793 209
284 3300025913 Ga0207695_10000772 Ga0207695_1000077249 209
285 3300025913 Ga0207695_10010105 Ga0207695_100101053 209
286 3300025913 Ga0207695_10024219 Ga0207695_100242195 209
287 3300025914 Ga0207671_10042402 Ga0207671_100424023 209
288 3300025914 Ga0207671_10070744 Ga0207671_100707442 209
289 3300025917 Ga0207660_10010119 Ga0207660_100101192 209
290 3300025917 Ga0207660_10076395 Ga0207660_100763953 209
291 3300025917 Ga0207660_10088563 Ga0207660_100885631 209
292 3300025919 Ga0207657_10102110 Ga0207657_101021101 209
293 3300025919 Ga0207657_10104237 Ga0207657_101042373 209
294 3300025920 Ga0207649_10002467 Ga0207649_100024676 209
295 3300025921 Ga0207652_10000030 Ga0207652_1000003032 209
296 3300025921 Ga0207652_10072863 Ga0207652_100728633 209
297 3300025921 Ga0207652_10189536 Ga0207652_101895363 209
298 3300025921 Ga0207652_10219208 Ga0207652_102192082 209
299 3300025923 Ga0207681_10111798 Ga0207681_101117982 209
300 3300025924 Ga0207694_10000595 Ga0207694_1000059516 209
301 3300025925 Ga0207650_10001381 Ga0207650_100013815 209
302 3300025925 Ga0207650_10503629 Ga0207650_105036291 209
303 3300025933 Ga0207706_11010977 Ga0207706_110109771 209
304 3300025935 Ga0207709_10009873 Ga0207709_100098733 209
305 3300025938 Ga0207704_10056639 Ga0207704_100566392 209
306 3300025938 Ga0207704_10274035 Ga0207704_102740352 209
307 3300025942 Ga0207689_10006632 Ga0207689_100066327 209
308 3300025949 Ga0207667_10019209 Ga0207667_100192094 209
309 3300025949 Ga0207667_10045524 Ga0207667_100455241 209
310 3300025949 Ga0207667_10918027 Ga0207667_109180271 209
311 3300025961 Ga0207712_10178341 Ga0207712_101783411 209
312 3300025972 Ga0207668_10167787 Ga0207668_101677872 209
313 3300025981 Ga0207640_10026022 Ga0207640_100260223 209
314 3300025981 Ga0207640_10059749 Ga0207640_100597492 209
315 3300025981 Ga0207640_10310737 Ga0207640_103107371 209
316 3300026023 Ga0207677_10052309 Ga0207677_100523091 209
317 3300026023 Ga0207677_10551712 Ga0207677_105517121 209
318 3300026041 Ga0207639_10007620 Ga0207639_100076206 209
319 3300026041 Ga0207639_10027825 Ga0207639_100278252 209
320 3300026041 Ga0207639_10079574 Ga0207639_100795742 209
321 3300026067 Ga0207678_10056671 Ga0207678_100566713 209
322 3300026078 Ga0207702_10032894 Ga0207702_100328944 209
323 3300026078 Ga0207702_10042470 Ga0207702_100424703 209
324 3300026078 Ga0207702_10050932 Ga0207702_100509323 209
325 3300026089 Ga0207648_10083390 Ga0207648_100833904 209
326 3300026089 Ga0207648_10271604 Ga0207648_102716042 209
327 3300026121 Ga0207683_10035784 Ga0207683_100357842 209
328 3300026142 Ga0207698_10084983 Ga0207698_100849833 209
329 3300027312 Ga0209371_1000007 Ga0209371_1000007916 209
330 3300027312 Ga0209371_1000536 Ga0209371_10005365 209
331 3300028379 Ga0268266_10223367 Ga0268266_102233671 209
332 3300028379 Ga0268266_10376809 Ga0268266_103768092 209
333 3300028381 Ga0268264_10037305 Ga0268264_100373053 209
334 3300030500 Ga0268256_1000008 Ga0268256_100000836 209
335 3300030500 Ga0268256_1000453 Ga0268256_100045333 209
336 3300031730 Ga0307516_10000131 Ga0307516_1000013178 209
337 3300032004 Ga0307414_10318931 Ga0307414_103189311 209
338 3300032005 Ga0307411_10141068 Ga0307411_101410682 209
339 3300035119 Ga0373956_0170514 Ga0373956_0170514_45_674 209
340 3300035410 Ga0373924_0249764 Ga0373924_0249764_75_704 209
341 3300035692 Ga0373935_0311022 Ga0373935_0311022_256_885 209
342 3300039437 Ga0436365_1534762 Ga0436365_1534762_1820_2449 209
343 3300039450 Ga0436363_1171326 Ga0436363_1171326_64_693 209
344 3300041452 Ga0451793_0550263 Ga0451793_0550263_711_1421 209
345 3300041512 Ga0451853_0869417 Ga0451853_0869417_53_682 209
346 3300046453 Ga0495627_066401 Ga0495627_066401_75_704 209
347 3300046459 Ga0495629_0022158 Ga0495629_0022158_370_999 209
348 3300046473 Ga0495582_0072145 Ga0495582_0072145_678_1307 209
349 3300046476 Ga0495662_0233342 Ga0495662_0233342_257_886 209
350 3300046517 Ga0495630_0181334 Ga0495630_0181334_445_1074 209
351 3300046535 Ga0495586_0047660 Ga0495586_0047660_1017_1646 209
352 3300046536 Ga0495587_0143607 Ga0495587_0143607_26_655 209
353 3300046558 Ga0495633_0025483 Ga0495633_0025483_1906_2535 209
354 3300046680 Ga0495646_0297694 Ga0495646_0297694_11_640 209
355 3300046683 Ga0495658_0003717 Ga0495658_0003717_6301_6930 209
356 3300047471 Ga0495684_0082506 Ga0495684_0082506_724_1353 209
357 3300048906 Ga0496103_0045864 Ga0496103_0045864_38_667 209
358 3300048907 Ga0496104_0000005 Ga0496104_0000005_354069_354698 209
359 3300048908 Ga0496105_0000084 Ga0496105_0000084_64496_65125 209
360 3300048918 Ga0496115_0000002 Ga0496115_0000002_158142_158771 209
361 3300048919 Ga0496116_0178124 Ga0496116_0178124_327_956 209
362 3300048920 Ga0496117_0000368 Ga0496117_0000368_66217_66846 209
363 3300048921 Ga0496118_0238907 Ga0496118_0238907_126_755 209
364 3300048922 Ga0496119_0007968 Ga0496119_0007968_5814_6443 209
365 3300048923 Ga0496120_0000458 Ga0496120_0000458_45639_46268 209
366 3300048925 Ga0496122_0000896 Ga0496122_0000896_46772_47401 209
367 3300048926 Ga0496123_0000137 Ga0496123_0000137_46981_47610 209
368 3300048927 Ga0496124_0000725 Ga0496124_0000725_7819_8448 209
369 3300048929 Ga0496126_0000052 Ga0496126_0000052_105313_105942 209
370 3300048929 Ga0496126_0334360 Ga0496126_0334360_462_1091 209
371 3300049571 Ga0501034_0110920 Ga0501034_0110920_306_935 209
372 3300049571 Ga0501034_0780524 Ga0501034_0780524_201_830 209
373 3300049571 Ga0501034_0989339 Ga0501034_0989339_59_691 209
374 3300049573 Ga0501037_0122246 Ga0501037_0122246_610_1239 209
375 3300049580 Ga0501046_0095323 Ga0501046_0095323_159_788 209
376 3300049581 Ga0501047_0342096 Ga0501047_0342096_387_1016 209
377 3300049586 Ga0501070_0157035 Ga0501070_0157035_447_1076 209
378 3300049589 Ga0501073_0056326 Ga0501073_0056326_1484_2113 209
379 3300049589 Ga0501073_0094545 Ga0501073_0094545_180_809 209
380 3300049589 Ga0501073_0240893 Ga0501073_0240893_89_718 209
381 3300049741 Ga0501079_0502862 Ga0501079_0502862_291_920 209
382 3300049744 Ga0501083_0066001 Ga0501083_0066001_1027_1656 209
383 3300049822 Ga0501035_0173726 Ga0501035_0173726_253_882 209
384 3300049823 Ga0501044_0156848 Ga0501044_0156848_54_683 209
385 3300050491 nmdc:mga00v17_705_c1 nmdc:mga00v17_705_c1_15317_15946 209
386 3300050516 nmdc:mga0sz30_61222_c1 nmdc:mga0sz30_61222_c1_817_1446 209
387 3300053093 Ga0500651_0000551 Ga0500651_0000551_1647_2276 209
388 3300053139 Ga0500568_0014286 Ga0500568_0014286_98_727 209
389 3300053161 Ga0500634_0037354 Ga0500634_0037354_776_1405 209
390 3300060353 Ga0501082_0000044 Ga0501082_0000044_56736_57365 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

40

221

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rpn-assembly3.cif.gz_F crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione 0.863 2 185
1r4w-assembly2.cif.gz_D crystal structure of mitochondrial class kappa glutathione transferase 0.8555 2 185
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8385 2 185
3fz5-assembly1.cif.gz_A crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8135 2 185
3rpp-assembly1.cif.gz_A crystal structure of human kappa class glutathione transferase in apo form 0.8111 2 185
ID Description Score Start End Superfamily
af_F1R7E6_86_254_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9094 2 35 3.40.30.10
af_E9QGM3_60_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9059 2 35 3.40.30.10
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8583 2 186 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8464 1 183 3.40.30.10
2imdA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8045 4 189 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V8F833-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase 0.9934 1 170 GO:0004364
GO:0004602
GO:0006749
GO:0016853
AF-A0A091ASC2-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.993 1 208 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A091ASC2-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9883 1 208 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A3D0GBQ4-F1-model_v4 deleted 0.9848 28 209
AF-A0A327M456-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase 0.9793 2 209 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0016853

Feature Viewer

pLDDT pTM Quality
96.56 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map