F431827

General Info

Members Datasets Scaffolds Average Seq Length
390 163 385 431

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0021623|Ga0495588_0021623_147_1607
Length 486
Sequence MPAPPGHRFPFCETTMSTENRPLPVPQPRADGSVRKHDLVSPAWSAAAGPAPAALXXXXPDGRLSGLAAFFYVFLPFAFGHYLSLMLRNINAVLAPYLVGSMALTPGQLGLLTSAFFFTYALAQLPIGLALDRYGPRKVQLALMLVATFGAMLFAHGHSFGQLVVARAIVGLGLAGCFMSAVKAVSHWVPPAKVPSVQGYLIAVGGLGSASATLPVRHMLEYTDWRGLFMLLAALIACAGLLIWLVTPRAAAGNAKSPTIRSVLDVFHDPAFRKIISLILVPHTVFFGIQGLWIGRWLADVARFPDAAIAYLLYLGMAAVIFGAIAVGLLTEWADRRGIKALDLAAVGVGAFLLVQVVIAVNYAPSRQLMSVMFTLVGTITGIDYALVARSMARELTGRAATCLNLLIFVGAFLVQAGFGQFLGLWRPDGTGHYPALAYQCAFGVLVLLQLPGLLLYLKRRRPVQCQLVKLLPEEDYEVGTVRPSR

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
25 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
52 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
53 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
69 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
74 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 3.08
Rhizosphere 89.23
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10003997 3300003322 Bacteria 8453
2 JGI25161J50226_1000390 3300003374 Bacteria 22180
3 Ga0055525_1000009 3300003759 Bacteria 596899
4 Ga0055529_1000271 3300003763 Bacteria 61698
5 Ga0055543_1000970 3300004625 Bacteria 13027
6 Ga0055543_1002318 3300004625 Bacteria 6386
7 Ga0065165_1000187 3300005262 Bacteria 108694
8 Ga0065165_1004781 3300005262 Bacteria 8089
9 Ga0065165_1005660 3300005262 Bacteria 6899
10 Ga0065165_1014092 3300005262 Bacteria 3122
11 Ga0070680_100139943 3300005336 Bacteria 2029
12 Ga0070659_100140960 3300005366 Bacteria 1963
13 Ga0068855_100013224 3300005563 Bacteria 9956
14 Ga0068854_100185893 3300005578 Bacteria 1626
15 Ga0105244_10057425 3300009036 Bacteria 1967
16 Ga0105243_10107422 3300009148 Bacteria 2328
17 Ga0105241_10001831 3300009174 Bacteria 16117
18 Ga0105242_10171774 3300009176 Bacteria 1906
19 Ga0105237_10124018 3300009545 Bacteria 2578
20 Ga0105239_10304407 3300010375 Bacteria 1795
21 Ga0157373_10056927 3300013100 Bacteria 2774
22 Ga0157371_10000001 3300013102 Bacteria 1162285
23 Ga0182008_10003081 3300014497 Bacteria 10237
24 Ga0209436_100062 3300025208 Bacteria 56841
25 Ga0209563_100015 3300025230 Bacteria 879901
26 Ga0209677_102389 3300025253 Bacteria 7149
27 Ga0209148_1000906 3300025254 Bacteria 20050
28 Ga0209565_1001196 3300025263 Bacteria 12378
29 Ga0209455_1000051 3300025272 Bacteria 369818
30 Ga0209130_1000191 3300025284 Bacteria 85239
31 Ga0209130_1000336 3300025284 Bacteria 53924
32 Ga0209675_1006621 3300025291 Bacteria 4611
33 Ga0209564_1000087 3300025295 Bacteria 250787
34 Ga0209564_1014677 3300025295 Bacteria 3238
35 Ga0209256_1002762 3300025299 Bacteria 13549
36 Ga0207705_10030087 3300025909 Bacteria 3873
37 Ga0207660_10127792 3300025917 Bacteria 1932
38 Ga0207657_10003483 3300025919 Bacteria 16789
39 Ga0207657_10030090 3300025919 Bacteria 4933
40 Ga0207687_10196200 3300025927 Bacteria 1574
41 Ga0207686_10003566 3300025934 Bacteria 8350
42 Ga0207709_10061219 3300025935 Bacteria 2351
43 Ga0207679_10193646 3300025945 Bacteria 1692
44 Ga0207667_10005855 3300025949 Bacteria 14971
45 Ga0207678_10096154 3300026067 Bacteria 2531
46 Ga0316182_1145027 3300030745 Bacteria 5987
47 Ga0307408_100025586 3300031548 Bacteria 4044
48 Ga0395899_0007063 3300037312 Bacteria 8690
49 Ga0395899_0016544 3300037312 Bacteria 5626
50 Ga0395899_0024821 3300037312 Bacteria 4528
51 Ga0395899_0032418 3300037312 Bacteria 3924
52 Ga0395900_0000484 3300037418 Bacteria 56481
53 Ga0395900_0001279 3300037418 Bacteria 30711
54 Ga0395900_0015997 3300037418 Bacteria 7644
55 Ga0395900_0096430 3300037418 Bacteria 3038
56 Ga0395898_0093737 3300037466 Bacteria 2885
57 Ga0395898_0098847 3300037466 Bacteria 2802
58 Ga0395901_0000084 3300038443 Bacteria 127737
59 Ga0395901_0003084 3300038443 Bacteria 16778
60 Ga0395901_0093255 3300038443 Bacteria 3152
61 Ga0395901_0374405 3300038443 Bacteria 1466
62 Ga0439448_0000079 3300042005 Bacteria 16914
63 Ga0439449_0033805 3300042007 Bacteria 1904
64 Ga0439450_000825 3300042008 Bacteria 4258
65 Ga0450904_000412 3300042139 Bacteria 8738
66 Ga0439458_0015893 3300042157 Bacteria 1709
67 Ga0466972_0000399 3300044658 Bacteria 23015
68 Ga0466965_0025885 3300044683 Bacteria 2842
69 Ga0466966_0002200 3300044684 Bacteria 12669
70 Ga0466966_0097417 3300044684 Bacteria 1821
71 Ga0466966_0137535 3300044684 Bacteria 1493
72 Ga0466961_0045157 3300044693 Bacteria 2819
73 Ga0466964_0002439 3300044706 Bacteria 6610
74 Ga0466968_0002165 3300044735 Bacteria 7171
75 Ga0466970_0061224 3300044765 Bacteria 2016
76 Ga0466957_0000893 3300044842 Bacteria 15287
77 Ga0466957_0095447 3300044842 Bacteria 1867
78 Ga0466959_0018035 3300045049 Bacteria 5179
79 Ga0466959_0120200 3300045049 Bacteria 1868
80 Ga0466958_0039970 3300045836 Bacteria 2819
81 Ga0466967_0010052 3300045976 Bacteria 7070
82 Ga0466967_0029013 3300045976 Bacteria 4625
83 Ga0466967_0052336 3300045976 Bacteria 3583
84 Ga0495617_000002 3300046452 Bacteria 710121
85 Ga0495617_024951 3300046452 Bacteria 2016
86 Ga0495627_000176 3300046453 Bacteria 72651
87 Ga0495627_011780 3300046453 Bacteria 3123
88 Ga0495603_0035544 3300046455 Bacteria 2992
89 Ga0495590_0000044 3300046457 Bacteria 119833
90 Ga0495590_0001422 3300046457 Bacteria 10351
91 Ga0495590_0029423 3300046457 Bacteria 1926
92 Ga0495591_000052 3300046458 Bacteria 136101
93 Ga0495591_013310 3300046458 Bacteria 3019
94 Ga0495629_0003492 3300046459 Bacteria 11889
95 Ga0495638_0002124 3300046460 Bacteria 16695
96 Ga0495638_0024051 3300046460 Bacteria 3976
97 Ga0495638_0042333 3300046460 Bacteria 2877
98 Ga0495653_0086072 3300046463 Bacteria 2310
99 Ga0495650_0000056 3300046471 Bacteria 307565
100 Ga0495650_0000376 3300046471 Bacteria 77893
101 Ga0495650_0004423 3300046471 Bacteria 9630
102 Ga0495650_0015964 3300046471 Bacteria 3826
103 Ga0495580_0013211 3300046472 Bacteria 6314
104 Ga0495582_0001313 3300046473 Bacteria 13931
105 Ga0495582_0007532 3300046473 Bacteria 6021
106 Ga0495582_0110461 3300046473 Bacteria 1544
107 Ga0495605_0000081 3300046474 Bacteria 125302
108 Ga0495605_0000087 3300046474 Bacteria 120256
109 Ga0495605_0004879 3300046474 Bacteria 7841
110 Ga0495605_0016858 3300046474 Bacteria 3946
111 Ga0495605_0019662 3300046474 Bacteria 3604
112 Ga0495605_0056411 3300046474 Bacteria 1894
113 Ga0495639_0027028 3300046475 Bacteria 2539
114 Ga0495584_0000011 3300046491 Bacteria 208322
115 Ga0495584_0000196 3300046491 Bacteria 42912
116 Ga0495584_0000224 3300046491 Bacteria 40823
117 Ga0495584_0003029 3300046491 Bacteria 9323
118 Ga0495584_0004075 3300046491 Bacteria 7889
119 Ga0495584_0004806 3300046491 Bacteria 7219
120 Ga0495584_0034418 3300046491 Bacteria 2563
121 Ga0495585_0000078 3300046492 Bacteria 100168
122 Ga0495585_0000379 3300046492 Bacteria 42623
123 Ga0495585_0001869 3300046492 Bacteria 15892
124 Ga0495585_0004662 3300046492 Bacteria 8841
125 Ga0495585_0047258 3300046492 Bacteria 2397
126 Ga0495594_0001964 3300046499 Bacteria 10730
127 Ga0495594_0006474 3300046499 Bacteria 6028
128 Ga0495594_0009391 3300046499 Bacteria 5052
129 Ga0495594_0036539 3300046499 Bacteria 2678
130 Ga0495594_0049377 3300046499 Bacteria 2312
131 Ga0495594_0065286 3300046499 Bacteria 2018
132 Ga0495596_0003107 3300046500 Bacteria 8573
133 Ga0495596_0003289 3300046500 Bacteria 8245
134 Ga0495596_0003866 3300046500 Bacteria 7433
135 Ga0495596_0012024 3300046500 Bacteria 3715
136 Ga0495596_0017298 3300046500 Bacteria 2988
137 Ga0495596_0035859 3300046500 Bacteria 1965
138 Ga0495607_0001173 3300046501 Bacteria 23719
139 Ga0495607_0002995 3300046501 Bacteria 13201
140 Ga0495607_0004171 3300046501 Bacteria 10738
141 Ga0495607_0005111 3300046501 Bacteria 9487
142 Ga0495607_0030279 3300046501 Bacteria 3324
143 Ga0495583_0000407 3300046506 Bacteria 65284
144 Ga0495583_0000801 3300046506 Bacteria 38811
145 Ga0495583_0000827 3300046506 Bacteria 37906
146 Ga0495583_0002569 3300046506 Bacteria 15276
147 Ga0495583_0004946 3300046506 Bacteria 9255
148 Ga0495583_0005537 3300046506 Bacteria 8542
149 Ga0495583_0008972 3300046506 Bacteria 6030
150 Ga0495583_0013254 3300046506 Bacteria 4609
151 Ga0495583_0021650 3300046506 Bacteria 3302
152 Ga0495583_0048146 3300046506 Bacteria 1957
153 Ga0495583_0067848 3300046506 Bacteria 1574
154 Ga0495606_0000007 3300046507 Bacteria 323713
155 Ga0495606_0044773 3300046507 Bacteria 2940
156 Ga0495606_0046053 3300046507 Bacteria 2885
157 Ga0495606_0054154 3300046507 Bacteria 2599
158 Ga0495610_0000493 3300046512 Bacteria 40287
159 Ga0495610_0069089 3300046512 Bacteria 1654
160 Ga0495616_0000103 3300046513 Bacteria 73155
161 Ga0495616_0000268 3300046513 Bacteria 42201
162 Ga0495616_0001114 3300046513 Bacteria 19091
163 Ga0495616_0005266 3300046513 Bacteria 7981
164 Ga0495616_0021296 3300046513 Bacteria 3511
165 Ga0495616_0033460 3300046513 Bacteria 2677
166 Ga0495616_0035614 3300046513 Bacteria 2573
167 Ga0495620_0016302 3300046515 Bacteria 3731
168 Ga0495630_0005220 3300046517 Bacteria 9153
169 Ga0495631_0000236 3300046518 Bacteria 37997
170 Ga0495631_0001324 3300046518 Bacteria 15177
171 Ga0495631_0005020 3300046518 Bacteria 6969
172 Ga0495631_0018747 3300046518 Bacteria 3254
173 Ga0495631_0028295 3300046518 Bacteria 2557
174 Ga0495631_0036139 3300046518 Bacteria 2206
175 Ga0495631_0054931 3300046518 Bacteria 1735
176 Ga0495632_0000040 3300046519 Bacteria 149644
177 Ga0495632_0004600 3300046519 Bacteria 9348
178 Ga0495632_0019117 3300046519 Bacteria 3739
179 Ga0495632_0023925 3300046519 Bacteria 3254
180 Ga0495637_0000006 3300046520 Bacteria 435763
181 Ga0495643_0000192 3300046522 Bacteria 96511
182 Ga0495643_0001148 3300046522 Bacteria 25919
183 Ga0495643_0005149 3300046522 Bacteria 8932
184 Ga0495643_0005587 3300046522 Bacteria 8459
185 Ga0495643_0036909 3300046522 Bacteria 2682
186 Ga0495643_0069453 3300046522 Bacteria 1851
187 Ga0495644_0007587 3300046523 Bacteria 4180
188 Ga0495644_0011556 3300046523 Bacteria 3399
189 Ga0495644_0011954 3300046523 Bacteria 3337
190 Ga0495644_0016308 3300046523 Bacteria 2843
191 Ga0495644_0021103 3300046523 Bacteria 2485
192 Ga0495644_0025511 3300046523 Bacteria 2243
193 Ga0495648_0000155 3300046524 Bacteria 81384
194 Ga0495648_0004826 3300046524 Bacteria 11379
195 Ga0495648_0004921 3300046524 Bacteria 11237
196 Ga0495648_0014475 3300046524 Bacteria 5773
197 Ga0495648_0014733 3300046524 Bacteria 5702
198 Ga0495648_0021412 3300046524 Bacteria 4476
199 Ga0495648_0045515 3300046524 Bacteria 2729
200 Ga0495648_0078397 3300046524 Bacteria 1889
201 Ga0495666_0001105 3300046526 Bacteria 12895
202 Ga0495666_0004790 3300046526 Bacteria 6839
203 Ga0495642_0000057 3300046528 Bacteria 66980
204 Ga0495642_0000799 3300046528 Bacteria 15291
205 Ga0495642_0007584 3300046528 Bacteria 4157
206 Ga0495642_0014273 3300046528 Bacteria 3078
207 Ga0495642_0015126 3300046528 Bacteria 2996
208 Ga0495642_0017351 3300046528 Bacteria 2812
209 Ga0495642_0026403 3300046528 Bacteria 2306
210 Ga0495642_0034983 3300046528 Bacteria 2025
211 Ga0495652_0005309 3300046529 Bacteria 12152
212 Ga0495654_0030509 3300046530 Bacteria 2742
213 Ga0495665_0040284 3300046531 Bacteria 2487
214 Ga0495665_0057610 3300046531 Bacteria 2051
215 Ga0495665_0058601 3300046531 Bacteria 2033
216 Ga0495640_0040534 3300046533 Bacteria 3261
217 Ga0495586_0011899 3300046535 Bacteria 4622
218 Ga0495586_0023175 3300046535 Bacteria 3314
219 Ga0495586_0029633 3300046535 Bacteria 2929
220 Ga0495587_0018681 3300046536 Bacteria 4297
221 Ga0495609_0000096 3300046538 Bacteria 104135
222 Ga0495609_0000634 3300046538 Bacteria 27340
223 Ga0495609_0000645 3300046538 Bacteria 27149
224 Ga0495609_0003010 3300046538 Bacteria 9938
225 Ga0495609_0053162 3300046538 Bacteria 1801
226 Ga0495597_0000586 3300046542 Bacteria 30141
227 Ga0495597_0000622 3300046542 Bacteria 28970
228 Ga0495597_0003069 3300046542 Bacteria 10047
229 Ga0495597_0006329 3300046542 Bacteria 6134
230 Ga0495597_0028422 3300046542 Bacteria 2559
231 Ga0495597_0041516 3300046542 Bacteria 2055
232 Ga0495645_0014039 3300046543 Bacteria 5676
233 Ga0495622_0017668 3300046557 Bacteria 3320
234 Ga0495622_0037252 3300046557 Bacteria 2266
235 Ga0495622_0048862 3300046557 Bacteria 1964
236 Ga0495633_0001325 3300046558 Bacteria 19442
237 Ga0495633_0019549 3300046558 Bacteria 3424
238 Ga0495633_0043537 3300046558 Bacteria 2129
239 Ga0495656_0078269 3300046615 Bacteria 1485
240 Ga0495668_0000435 3300046616 Bacteria 53680
241 Ga0495668_0001858 3300046616 Bacteria 18987
242 Ga0495668_0007986 3300046616 Bacteria 6669
243 Ga0495668_0043621 3300046616 Bacteria 2493
244 Ga0495668_0076613 3300046616 Bacteria 1836
245 Ga0495634_0098592 3300046642 Bacteria 1890
246 Ga0495611_0002429 3300046648 Bacteria 8527
247 Ga0495611_0056909 3300046648 Bacteria 1771
248 Ga0495611_0074706 3300046648 Bacteria 1552
249 Ga0495625_0012109 3300046660 Bacteria 6997
250 Ga0495625_0012509 3300046660 Bacteria 6872
251 Ga0495625_0053871 3300046660 Bacteria 2875
252 Ga0495659_0002136 3300046664 Bacteria 6446
253 Ga0495661_0000164 3300046665 Bacteria 78742
254 Ga0495661_0002204 3300046665 Bacteria 15188
255 Ga0495661_0003932 3300046665 Bacteria 10851
256 Ga0495661_0007754 3300046665 Bacteria 7474
257 Ga0495661_0034745 3300046665 Bacteria 3169
258 Ga0495661_0037952 3300046665 Bacteria 3004
259 Ga0495661_0053418 3300046665 Bacteria 2429
260 Ga0495661_0071060 3300046665 Bacteria 2035
261 Ga0495661_0078431 3300046665 Bacteria 1910
262 Ga0495661_0104157 3300046665 Bacteria 1591
263 Ga0495588_0000070 3300046674 Bacteria 227611
264 Ga0495588_0009834 3300046674 Bacteria 4434
265 Ga0495588_0014184 3300046674 Bacteria 3810
266 Ga0495588_0021230 3300046674 Bacteria 3197
267 Ga0495588_0021623 3300046674 Bacteria 3172
268 Ga0495588_0055768 3300046674 Bacteria 2039
269 Ga0495588_0065087 3300046674 Bacteria 1891
270 Ga0495588_0089218 3300046674 Bacteria 1614
271 Ga0495588_0089774 3300046674 Bacteria 1609
272 Ga0495599_0115150 3300046678 Bacteria 1673
273 Ga0495623_0037008 3300046679 Bacteria 3125
274 Ga0495646_0026883 3300046680 Bacteria 3612
275 Ga0495669_0000359 3300046684 Bacteria 23229
276 Ga0495669_0000615 3300046684 Bacteria 15534
277 Ga0495669_0001466 3300046684 Bacteria 9730
278 Ga0495669_0002392 3300046684 Bacteria 7701
279 Ga0495669_0055332 3300046684 Bacteria 1786
280 Ga0495613_0075979 3300046689 Bacteria 2445
281 Ga0495613_0091455 3300046689 Bacteria 2203
282 Ga0495624_0014604 3300046690 Bacteria 5322
283 Ga0495670_0005399 3300046691 Bacteria 6278
284 Ga0495670_0018212 3300046691 Bacteria 3458
285 Ga0495670_0037056 3300046691 Bacteria 2430
286 Ga0495671_0000132 3300046692 Bacteria 67269
287 Ga0495649_0000236 3300046694 Bacteria 48689
288 Ga0495649_0008354 3300046694 Bacteria 6231
289 Ga0495649_0063382 3300046694 Bacteria 1986
290 Ga0495589_0000036 3300046794 Bacteria 153299
291 Ga0495589_0000216 3300046794 Bacteria 48762
292 Ga0495589_0001431 3300046794 Bacteria 13766
293 Ga0495589_0003300 3300046794 Bacteria 8756
294 Ga0495589_0037204 3300046794 Bacteria 2438
295 Ga0495600_0004047 3300046809 Bacteria 8715
296 Ga0495660_0000117 3300046810 Bacteria 85237
297 Ga0495660_0006024 3300046810 Bacteria 7209
298 Ga0495660_0024943 3300046810 Bacteria 3400
299 Ga0495660_0027256 3300046810 Bacteria 3233
300 Ga0495660_0028051 3300046810 Bacteria 3183
301 Ga0495581_0016517 3300047315 Bacteria 4289
302 Ga0495581_0018978 3300047315 Bacteria 3990
303 Ga0495581_0071312 3300047315 Bacteria 2010
304 Ga0495604_0001907 3300047317 Bacteria 16899
305 Ga0495604_0016196 3300047317 Bacteria 5956
306 Ga0495604_0073606 3300047317 Bacteria 2578
307 Ga0495636_0009230 3300047318 Bacteria 3882
308 Ga0495672_0000086 3300047320 Bacteria 155010
309 Ga0495672_0000337 3300047320 Bacteria 60563
310 Ga0495672_0000576 3300047320 Bacteria 41488
311 Ga0495672_0000621 3300047320 Bacteria 39604
312 Ga0495672_0031626 3300047320 Bacteria 3302
313 Ga0495676_0000035 3300047321 Bacteria 120519
314 Ga0495676_0015278 3300047321 Bacteria 6841
315 Ga0495680_0020611 3300047322 Bacteria 5540
316 Ga0495680_0179145 3300047322 Bacteria 1531
317 Ga0495683_0000426 3300047323 Bacteria 33759
318 Ga0495683_0001928 3300047323 Bacteria 12944
319 Ga0495683_0037166 3300047323 Bacteria 2470
320 Ga0495683_0052551 3300047323 Bacteria 2034
321 Ga0495687_000074 3300047443 Bacteria 153464
322 Ga0495687_000403 3300047443 Bacteria 53439
323 Ga0495687_003226 3300047443 Bacteria 12052
324 Ga0495687_003435 3300047443 Bacteria 11494
325 Ga0495675_0025213 3300047444 Bacteria 3791
326 Ga0495675_0025999 3300047444 Bacteria 3730
327 Ga0495677_0000037 3300047445 Bacteria 78595
328 Ga0495677_0000348 3300047445 Bacteria 19947
329 Ga0495677_0002089 3300047445 Bacteria 7949
330 Ga0495677_0004321 3300047445 Bacteria 5460
331 Ga0495679_003503 3300047446 Bacteria 7516
332 Ga0495685_004426 3300047447 Bacteria 4539
333 Ga0495685_009499 3300047447 Bacteria 3251
334 Ga0495673_0008605 3300047469 Bacteria 5716
335 Ga0495681_0001268 3300047470 Bacteria 19172
336 Ga0495681_0008077 3300047470 Bacteria 6629
337 Ga0495681_0024367 3300047470 Bacteria 3190
338 Ga0495681_0058526 3300047470 Bacteria 1785
339 Ga0495686_0000740 3300047472 Bacteria 43603
340 Ga0495686_0001199 3300047472 Bacteria 29920
341 Ga0495686_0049593 3300047472 Bacteria 2640
342 Ga0495686_0054158 3300047472 Bacteria 2513
343 Ga0495593_0007101 3300047673 Bacteria 6567
344 Ga0495593_0041656 3300047673 Bacteria 2468
345 Ga0495593_0043579 3300047673 Bacteria 2403
346 Ga0495593_0070897 3300047673 Bacteria 1810
347 Ga0495602_0003985 3300048088 Bacteria 15391
348 Ga0495602_0012564 3300048088 Bacteria 8691
349 Ga0495614_0022884 3300048089 Bacteria 2694
350 Ga0495614_0023325 3300048089 Bacteria 2669
351 Ga0495615_0008709 3300048090 Bacteria 1971
352 Ga0495626_0000006 3300048091 Bacteria 284977
353 Ga0495626_0000454 3300048091 Bacteria 41810
354 Ga0495626_0001945 3300048091 Bacteria 15342
355 Ga0495626_0001993 3300048091 Bacteria 15071
356 Ga0495626_0002486 3300048091 Bacteria 12753
357 Ga0495626_0004706 3300048091 Bacteria 8267
358 Ga0495626_0006564 3300048091 Bacteria 6601
359 Ga0495626_0007723 3300048091 Bacteria 5960
360 Ga0495626_0014299 3300048091 Bacteria 4099
361 Ga0495626_0072655 3300048091 Bacteria 1542
362 Ga0496102_0000152 3300048905 Bacteria 94042
363 Ga0496102_0027803 3300048905 Bacteria 5051
364 Ga0496103_0094184 3300048906 Bacteria 1892
365 Ga0496103_0100593 3300048906 Bacteria 1829
366 Ga0496104_0181696 3300048907 Bacteria 2014
367 Ga0496105_0151083 3300048908 Bacteria 1909
368 Ga0496106_0029913 3300048909 Bacteria 4060
369 Ga0496113_0030220 3300048916 Bacteria 3920
370 Ga0496115_0001802 3300048918 Bacteria 15343
371 Ga0496115_0021344 3300048918 Bacteria 5002
372 Ga0496115_0122292 3300048918 Bacteria 2142
373 Ga0496115_0194934 3300048918 Bacteria 1674
374 Ga0496122_0056113 3300048925 Bacteria 2939
375 Ga0496123_0001815 3300048926 Bacteria 28098
376 Ga0496124_0007007 3300048927 Bacteria 12080
377 Ga0496124_0007249 3300048927 Bacteria 11832
378 Ga0496124_0124157 3300048927 Bacteria 2059
379 Ga0495678_000064 3300049459 Bacteria 138380
380 Ga0495678_000467 3300049459 Bacteria 40162
381 Ga0495678_001212 3300049459 Bacteria 21162
382 Ga0501034_0317294 3300049571 Bacteria 1492
383 Ga0501036_0063961 3300049572 Bacteria 3115
384 Ga0501035_0003533 3300049822 Bacteria 14938
385 Ga0501044_0066442 3300049823 Bacteria 3677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0030279 Ga0495607_0030279_10_1176 348
2 3300046506 Ga0495583_0048146 Ga0495583_0048146_13_1146 348
3 3300031548 Ga0307408_100025586 Ga0307408_1000255862 352
4 3300004625 Ga0055543_1002318 Ga0055543_10023182 357
5 3300005262 Ga0065165_1000187 Ga0065165_100018735 357
6 3300025284 Ga0209130_1000191 Ga0209130_10001914 357
7 3300046664 Ga0495659_0002136 Ga0495659_0002136_2380_3747 377
8 3300047470 Ga0495681_0008077 Ga0495681_0008077_2709_4076 377
9 3300046506 Ga0495583_0067848 Ga0495583_0067848_32_1399 379
10 3300046528 Ga0495642_0014273 Ga0495642_0014273_827_2194 379
11 3300046538 Ga0495609_0000645 Ga0495609_0000645_9004_10377 379
12 3300046660 Ga0495625_0012109 Ga0495625_0012109_1041_2414 379
13 3300046684 Ga0495669_0001466 Ga0495669_0001466_777_2144 379
14 3300046810 Ga0495660_0028051 Ga0495660_0028051_945_2312 379
15 3300047318 Ga0495636_0009230 Ga0495636_0009230_1009_2376 379
16 3300047447 Ga0495685_009499 Ga0495685_009499_1555_2922 379
17 3300025291 Ga0209675_1006621 Ga0209675_10066212 382
18 3300025295 Ga0209564_1000087 Ga0209564_1000087211 382
19 3300025299 Ga0209256_1002762 Ga0209256_10027624 382
20 3300046500 Ga0495596_0003866 Ga0495596_0003866_4584_5795 383
21 3300046518 Ga0495631_0018747 Ga0495631_0018747_1990_3201 383
22 3300046648 Ga0495611_0056909 Ga0495611_0056909_266_1477 383
23 3300047469 Ga0495673_0008605 Ga0495673_0008605_4066_5277 383
24 3300025295 Ga0209564_1014677 Ga0209564_10146772 384
25 3300003374 JGI25161J50226_1000390 JGI25161J50226_100039017 388
26 3300003763 Ga0055529_1000271 Ga0055529_100027110 388
27 3300004625 Ga0055543_1000970 Ga0055543_10009704 388
28 3300005262 Ga0065165_1005660 Ga0065165_10056606 388
29 3300025208 Ga0209436_100062 Ga0209436_10006233 388
30 3300025263 Ga0209565_1001196 Ga0209565_10011964 388
31 3300025272 Ga0209455_1000051 Ga0209455_100005147 388
32 3300025284 Ga0209130_1000336 Ga0209130_100033628 388
33 3300049459 Ga0495678_001212 Ga0495678_001212_7492_8802 391
34 3300046694 Ga0495649_0063382 Ga0495649_0063382_464_1741 393
35 3300047320 Ga0495672_0031626 Ga0495672_0031626_300_1541 393
36 3300046523 Ga0495644_0021103 Ga0495644_0021103_28_1272 394
37 3300048927 Ga0496124_0007249 Ga0496124_0007249_2890_4149 394
38 3300013102 Ga0157371_10000001 Ga0157371_10000001980 395
39 3300014497 Ga0182008_10003081 Ga0182008_100030815 395
40 3300030745 Ga0316182_1145027 Ga0316182_11450272 397
41 3300046507 Ga0495606_0000007 Ga0495606_0000007_243065_244390 397
42 3300046452 Ga0495617_000002 Ga0495617_000002_126526_127860 399
43 3300046453 Ga0495627_000176 Ga0495627_000176_58787_60121 399
44 3300046474 Ga0495605_0000081 Ga0495605_0000081_60203_61537 399
45 3300046501 Ga0495607_0004171 Ga0495607_0004171_6546_7880 399
46 3300046513 Ga0495616_0033460 Ga0495616_0033460_817_2151 399
47 3300046518 Ga0495631_0005020 Ga0495631_0005020_4865_6199 399
48 3300046523 Ga0495644_0011954 Ga0495644_0011954_199_1533 399
49 3300046524 Ga0495648_0004826 Ga0495648_0004826_1642_2976 399
50 3300046528 Ga0495642_0000057 Ga0495642_0000057_36574_37908 399
51 3300046530 Ga0495654_0030509 Ga0495654_0030509_616_1950 399
52 3300046616 Ga0495668_0007986 Ga0495668_0007986_541_1875 399
53 3300046665 Ga0495661_0007754 Ga0495661_0007754_394_1728 399
54 3300046684 Ga0495669_0002392 Ga0495669_0002392_5095_6429 399
55 3300046692 Ga0495671_0000132 Ga0495671_0000132_561_1895 399
56 3300046794 Ga0495589_0003300 Ga0495589_0003300_7171_8505 399
57 3300047470 Ga0495681_0058526 Ga0495681_0058526_417_1751 399
58 3300047472 Ga0495686_0049593 Ga0495686_0049593_627_1961 399
59 3300048905 Ga0496102_0000152 Ga0496102_0000152_75983_77317 399
60 3300046491 Ga0495584_0004075 Ga0495584_0004075_798_2102 400
61 3300046492 Ga0495585_0001869 Ga0495585_0001869_13561_14865 400
62 3300044765 Ga0466970_0061224 Ga0466970_0061224_717_1982 402
63 3300046506 Ga0495583_0000827 Ga0495583_0000827_31008_32309 402
64 3300046518 Ga0495631_0054931 Ga0495631_0054931_463_1725 402
65 3300046691 Ga0495670_0005399 Ga0495670_0005399_4108_5409 402
66 3300046492 Ga0495585_0047258 Ga0495585_0047258_671_1975 404
67 3300046515 Ga0495620_0016302 Ga0495620_0016302_2302_3606 404
68 3300046528 Ga0495642_0000799 Ga0495642_0000799_8558_9862 404
69 3300046810 Ga0495660_0024943 Ga0495660_0024943_325_1629 404
70 3300047470 Ga0495681_0024367 Ga0495681_0024367_1347_2651 404
71 3300046460 Ga0495638_0024051 Ga0495638_0024051_1768_3054 405
72 3300046522 Ga0495643_0000192 Ga0495643_0000192_38891_40168 405
73 3300048905 Ga0496102_0027803 Ga0496102_0027803_566_1855 405
74 3300046616 Ga0495668_0001858 Ga0495668_0001858_986_2287 406
75 3300048927 Ga0496124_0007007 Ga0496124_0007007_6281_7609 406
76 3300046471 Ga0495650_0000056 Ga0495650_0000056_160646_161932 409
77 iso_pu_bacteria 2643221664 2644359639 409
78 3300042139 Ga0450904_000412 Ga0450904_000412_2175_3470 410
79 3300046471 Ga0495650_0015964 Ga0495650_0015964_1821_3113 410
80 3300046452 Ga0495617_024951 Ga0495617_024951_247_1545 411
81 3300046460 Ga0495638_0002124 Ga0495638_0002124_6739_8040 411
82 3300046491 Ga0495584_0034418 Ga0495584_0034418_552_1859 411
83 3300046500 Ga0495596_0017298 Ga0495596_0017298_1058_2359 411
84 3300046519 Ga0495632_0023925 Ga0495632_0023925_527_1828 411
85 3300046522 Ga0495643_0069453 Ga0495643_0069453_59_1360 411
86 3300046542 Ga0495597_0028422 Ga0495597_0028422_590_1891 411
87 3300046660 Ga0495625_0053871 Ga0495625_0053871_987_2288 411
88 3300046665 Ga0495661_0034745 Ga0495661_0034745_423_1724 411
89 3300046794 Ga0495589_0000216 Ga0495589_0000216_45857_47170 412
90 iso_pu_bacteria 2643221556 2643797677 412
91 iso_pu_bacteria 2643221684 2644470541 412
92 iso_pu_bacteria 2808606418 2809144182 412
93 iso_pu_bacteria 8047673197 8047678980 412
94 3300025945 Ga0207679_10193646 Ga0207679_101936462 413
95 3300046455 Ga0495603_0035544 Ga0495603_0035544_765_2075 413
96 3300046471 Ga0495650_0000376 Ga0495650_0000376_40157_41476 413
97 3300046474 Ga0495605_0016858 Ga0495605_0016858_1980_3284 413
98 3300046474 Ga0495605_0056411 Ga0495605_0056411_536_1846 413
99 3300046499 Ga0495594_0049377 Ga0495594_0049377_634_1944 413
100 3300046500 Ga0495596_0035859 Ga0495596_0035859_488_1798 413
101 3300046506 Ga0495583_0000801 Ga0495583_0000801_13546_14841 413
102 3300046513 Ga0495616_0000103 Ga0495616_0000103_25650_26945 413
103 3300046513 Ga0495616_0005266 Ga0495616_0005266_5655_6965 413
104 3300046518 Ga0495631_0036139 Ga0495631_0036139_369_1679 413
105 3300046528 Ga0495642_0034983 Ga0495642_0034983_430_1740 413
106 3300046538 Ga0495609_0000634 Ga0495609_0000634_23772_25091 413
107 3300046557 Ga0495622_0048862 Ga0495622_0048862_369_1679 413
108 3300046648 Ga0495611_0074706 Ga0495611_0074706_177_1487 413
109 3300046665 Ga0495661_0071060 Ga0495661_0071060_232_1527 413
110 3300046674 Ga0495588_0009834 Ga0495588_0009834_1195_2502 413
111 3300046674 Ga0495588_0065087 Ga0495588_0065087_40_1368 413
112 3300046684 Ga0495669_0000359 Ga0495669_0000359_15781_17091 413
113 3300046689 Ga0495613_0091455 Ga0495613_0091455_178_1488 413
114 3300046691 Ga0495670_0037056 Ga0495670_0037056_487_1797 413
115 3300046794 Ga0495589_0037204 Ga0495589_0037204_778_2097 413
116 3300047320 Ga0495672_0000337 Ga0495672_0000337_19079_20398 413
117 3300047321 Ga0495676_0000035 Ga0495676_0000035_87052_88359 413
118 3300047443 Ga0495687_000403 Ga0495687_000403_51844_53151 413
119 3300047446 Ga0495679_003503 Ga0495679_003503_2049_3359 413
120 3300047472 Ga0495686_0000740 Ga0495686_0000740_12273_13709 413
121 3300047472 Ga0495686_0054158 Ga0495686_0054158_131_1429 413
122 3300048091 Ga0495626_0006564 Ga0495626_0006564_790_2085 413
123 3300005262 Ga0065165_1014092 Ga0065165_10140922 414
124 3300013100 Ga0157373_10056927 Ga0157373_100569272 414
125 3300042157 Ga0439458_0015893 Ga0439458_0015893_104_1411 414
126 3300046453 Ga0495627_011780 Ga0495627_011780_1295_2596 414
127 3300046459 Ga0495629_0003492 Ga0495629_0003492_827_2128 414
128 3300046472 Ga0495580_0013211 Ga0495580_0013211_2602_3900 414
129 3300046473 Ga0495582_0001313 Ga0495582_0001313_11137_12435 414
130 3300046473 Ga0495582_0007532 Ga0495582_0007532_446_1747 414
131 3300046473 Ga0495582_0110461 Ga0495582_0110461_151_1452 414
132 3300046474 Ga0495605_0000087 Ga0495605_0000087_48375_49688 414
133 3300046475 Ga0495639_0027028 Ga0495639_0027028_951_2249 414
134 3300046491 Ga0495584_0000011 Ga0495584_0000011_76188_77489 414
135 3300046492 Ga0495585_0000078 Ga0495585_0000078_67748_69049 414
136 3300046492 Ga0495585_0000379 Ga0495585_0000379_12488_13813 414
137 3300046492 Ga0495585_0004662 Ga0495585_0004662_1254_2555 414
138 3300046499 Ga0495594_0006474 Ga0495594_0006474_3148_4449 414
139 3300046499 Ga0495594_0009391 Ga0495594_0009391_2764_4065 414
140 3300046499 Ga0495594_0065286 Ga0495594_0065286_225_1523 414
141 3300046500 Ga0495596_0003107 Ga0495596_0003107_4072_5373 414
142 3300046500 Ga0495596_0003289 Ga0495596_0003289_3012_4313 414
143 3300046500 Ga0495596_0012024 Ga0495596_0012024_730_2031 414
144 3300046501 Ga0495607_0005111 Ga0495607_0005111_6689_8002 414
145 3300046506 Ga0495583_0005537 Ga0495583_0005537_4238_5539 414
146 3300046506 Ga0495583_0008972 Ga0495583_0008972_709_2010 414
147 3300046507 Ga0495606_0054154 Ga0495606_0054154_973_2295 414
148 3300046512 Ga0495610_0069089 Ga0495610_0069089_238_1539 414
149 3300046513 Ga0495616_0000268 Ga0495616_0000268_11607_12932 414
150 3300046517 Ga0495630_0005220 Ga0495630_0005220_1628_2926 414
151 3300046518 Ga0495631_0028295 Ga0495631_0028295_566_1867 414
152 3300046522 Ga0495643_0005587 Ga0495643_0005587_6560_7873 414
153 3300046522 Ga0495643_0036909 Ga0495643_0036909_1025_2338 414
154 3300046523 Ga0495644_0016308 Ga0495644_0016308_853_2154 414
155 3300046524 Ga0495648_0000155 Ga0495648_0000155_44388_45713 414
156 3300046524 Ga0495648_0078397 Ga0495648_0078397_476_1789 414
157 3300046526 Ga0495666_0004790 Ga0495666_0004790_4305_5603 414
158 3300046528 Ga0495642_0015126 Ga0495642_0015126_922_2223 414
159 3300046528 Ga0495642_0017351 Ga0495642_0017351_67_1368 414
160 3300046529 Ga0495652_0005309 Ga0495652_0005309_3866_5164 414
161 3300046531 Ga0495665_0040284 Ga0495665_0040284_89_1387 414
162 3300046531 Ga0495665_0058601 Ga0495665_0058601_25_1326 414
163 3300046535 Ga0495586_0023175 Ga0495586_0023175_254_1555 414
164 3300046535 Ga0495586_0029633 Ga0495586_0029633_1149_2450 414
165 3300046536 Ga0495587_0018681 Ga0495587_0018681_505_1806 414
166 3300046542 Ga0495597_0003069 Ga0495597_0003069_1011_2312 414
167 3300046542 Ga0495597_0041516 Ga0495597_0041516_132_1445 414
168 3300046557 Ga0495622_0017668 Ga0495622_0017668_1623_2924 414
169 3300046557 Ga0495622_0037252 Ga0495622_0037252_124_1425 414
170 3300046558 Ga0495633_0019549 Ga0495633_0019549_1357_2658 414
171 3300046558 Ga0495633_0043537 Ga0495633_0043537_480_1781 414
172 3300046615 Ga0495656_0078269 Ga0495656_0078269_62_1363 414
173 3300046642 Ga0495634_0098592 Ga0495634_0098592_327_1625 414
174 3300046660 Ga0495625_0012509 Ga0495625_0012509_1916_3217 414
175 3300046674 Ga0495588_0014184 Ga0495588_0014184_348_1649 414
176 3300046674 Ga0495588_0021623 Ga0495588_0021623_147_1607 414
177 3300046674 Ga0495588_0089218 Ga0495588_0089218_34_1350 414
178 3300046678 Ga0495599_0115150 Ga0495599_0115150_68_1366 414
179 3300046679 Ga0495623_0037008 Ga0495623_0037008_566_1864 414
180 3300046680 Ga0495646_0026883 Ga0495646_0026883_1798_3096 414
181 3300046684 Ga0495669_0000615 Ga0495669_0000615_2247_3548 414
182 3300046690 Ga0495624_0014604 Ga0495624_0014604_1792_3093 414
183 3300046691 Ga0495670_0018212 Ga0495670_0018212_1896_3221 414
184 3300046694 Ga0495649_0008354 Ga0495649_0008354_3718_5031 414
185 3300046809 Ga0495600_0004047 Ga0495600_0004047_3391_4692 414
186 3300046810 Ga0495660_0000117 Ga0495660_0000117_72771_74084 414
187 3300047315 Ga0495581_0016517 Ga0495581_0016517_2596_3897 414
188 3300047315 Ga0495581_0018978 Ga0495581_0018978_1587_2888 414
189 3300047315 Ga0495581_0071312 Ga0495581_0071312_668_1966 414
190 3300047317 Ga0495604_0001907 Ga0495604_0001907_7157_8458 414
191 3300047317 Ga0495604_0016196 Ga0495604_0016196_4070_5368 414
192 3300047320 Ga0495672_0000621 Ga0495672_0000621_25580_26893 414
193 3300047321 Ga0495676_0015278 Ga0495676_0015278_1655_2965 414
194 3300047322 Ga0495680_0020611 Ga0495680_0020611_3716_5014 414
195 3300047322 Ga0495680_0179145 Ga0495680_0179145_71_1372 414
196 3300047323 Ga0495683_0000426 Ga0495683_0000426_1134_2435 414
197 3300047323 Ga0495683_0037166 Ga0495683_0037166_583_1884 414
198 3300047323 Ga0495683_0052551 Ga0495683_0052551_587_1900 414
199 3300047443 Ga0495687_003226 Ga0495687_003226_10457_11770 414
200 3300047443 Ga0495687_003435 Ga0495687_003435_3356_4657 414
201 3300047444 Ga0495675_0025213 Ga0495675_0025213_2364_3665 414
202 3300047444 Ga0495675_0025999 Ga0495675_0025999_624_1922 414
203 3300047445 Ga0495677_0004321 Ga0495677_0004321_2760_4073 414
204 3300047472 Ga0495686_0001199 Ga0495686_0001199_13999_15336 414
205 3300047673 Ga0495593_0007101 Ga0495593_0007101_548_1849 414
206 3300047673 Ga0495593_0041656 Ga0495593_0041656_919_2220 414
207 3300047673 Ga0495593_0070897 Ga0495593_0070897_405_1706 414
208 3300048088 Ga0495602_0003985 Ga0495602_0003985_828_2126 414
209 3300048088 Ga0495602_0012564 Ga0495602_0012564_2940_4241 414
210 3300048089 Ga0495614_0022884 Ga0495614_0022884_1350_2651 414
211 3300048090 Ga0495615_0008709 Ga0495615_0008709_311_1624 414
212 3300048091 Ga0495626_0000006 Ga0495626_0000006_75053_76366 414
213 3300048091 Ga0495626_0001993 Ga0495626_0001993_10685_11986 414
214 3300048091 Ga0495626_0002486 Ga0495626_0002486_6180_7481 414
215 3300048918 Ga0496115_0001802 Ga0496115_0001802_13421_14722 414
216 3300048918 Ga0496115_0021344 Ga0496115_0021344_101_1402 414
217 3300048918 Ga0496115_0194934 Ga0496115_0194934_147_1448 414
218 3300048926 Ga0496123_0001815 Ga0496123_0001815_24014_25327 414
219 3300049571 Ga0501034_0317294 Ga0501034_0317294_55_1362 414
220 3300049572 Ga0501036_0063961 Ga0501036_0063961_878_2191 414
221 3300025927 Ga0207687_10196200 Ga0207687_101962002 415
222 3300003322 rootL2_10003997 rootL2_1000399710 416
223 3300003759 Ga0055525_1000009 Ga0055525_1000009428 416
224 3300005262 Ga0065165_1004781 Ga0065165_10047814 416
225 3300005336 Ga0070680_100139943 Ga0070680_1001399432 416
226 3300005366 Ga0070659_100140960 Ga0070659_1001409601 416
227 3300005563 Ga0068855_100013224 Ga0068855_1000132245 416
228 3300005578 Ga0068854_100185893 Ga0068854_1001858932 416
229 3300009036 Ga0105244_10057425 Ga0105244_100574252 416
230 3300009148 Ga0105243_10107422 Ga0105243_101074222 416
231 3300009174 Ga0105241_10001831 Ga0105241_1000183115 416
232 3300009176 Ga0105242_10171774 Ga0105242_101717741 416
233 3300009545 Ga0105237_10124018 Ga0105237_101240182 416
234 3300010375 Ga0105239_10304407 Ga0105239_103044071 416
235 3300025230 Ga0209563_100015 Ga0209563_100015543 416
236 3300025253 Ga0209677_102389 Ga0209677_1023892 416
237 3300025254 Ga0209148_1000906 Ga0209148_100090611 416
238 3300025909 Ga0207705_10030087 Ga0207705_100300872 416
239 3300025917 Ga0207660_10127792 Ga0207660_101277922 416
240 3300025919 Ga0207657_10003483 Ga0207657_1000348315 416
241 3300025919 Ga0207657_10030090 Ga0207657_100300903 416
242 3300025934 Ga0207686_10003566 Ga0207686_100035662 416
243 3300025935 Ga0207709_10061219 Ga0207709_100612192 416
244 3300025949 Ga0207667_10005855 Ga0207667_1000585516 416
245 3300026067 Ga0207678_10096154 Ga0207678_100961542 416
246 3300037312 Ga0395899_0007063 Ga0395899_0007063_6536_7849 416
247 3300037312 Ga0395899_0016544 Ga0395899_0016544_12_1328 416
248 3300037312 Ga0395899_0024821 Ga0395899_0024821_504_1811 416
249 3300037312 Ga0395899_0032418 Ga0395899_0032418_2145_3524 416
250 3300037418 Ga0395900_0000484 Ga0395900_0000484_44263_45570 416
251 3300037418 Ga0395900_0001279 Ga0395900_0001279_2108_3415 416
252 3300037418 Ga0395900_0015997 Ga0395900_0015997_6016_7329 416
253 3300037418 Ga0395900_0096430 Ga0395900_0096430_1512_2819 416
254 3300037466 Ga0395898_0093737 Ga0395898_0093737_550_1857 416
255 3300037466 Ga0395898_0098847 Ga0395898_0098847_1244_2551 416
256 3300038443 Ga0395901_0000084 Ga0395901_0000084_46505_47812 416
257 3300038443 Ga0395901_0003084 Ga0395901_0003084_15156_16463 416
258 3300038443 Ga0395901_0093255 Ga0395901_0093255_1342_2649 416
259 3300038443 Ga0395901_0374405 Ga0395901_0374405_135_1442 416
260 3300042005 Ga0439448_0000079 Ga0439448_0000079_6171_7478 416
261 3300042007 Ga0439449_0033805 Ga0439449_0033805_192_1499 416
262 3300042008 Ga0439450_000825 Ga0439450_000825_74_1381 416
263 3300044658 Ga0466972_0000399 Ga0466972_0000399_5184_6491 416
264 3300044683 Ga0466965_0025885 Ga0466965_0025885_900_2207 416
265 3300044684 Ga0466966_0002200 Ga0466966_0002200_5014_6321 416
266 3300044684 Ga0466966_0097417 Ga0466966_0097417_334_1704 416
267 3300044684 Ga0466966_0137535 Ga0466966_0137535_19_1326 416
268 3300044693 Ga0466961_0045157 Ga0466961_0045157_889_2196 416
269 3300044706 Ga0466964_0002439 Ga0466964_0002439_3435_4742 416
270 3300044735 Ga0466968_0002165 Ga0466968_0002165_5166_6473 416
271 3300044842 Ga0466957_0000893 Ga0466957_0000893_9875_11182 416
272 3300044842 Ga0466957_0095447 Ga0466957_0095447_463_1770 416
273 3300045049 Ga0466959_0018035 Ga0466959_0018035_3252_4559 416
274 3300045049 Ga0466959_0120200 Ga0466959_0120200_237_1544 416
275 3300045836 Ga0466958_0039970 Ga0466958_0039970_484_1791 416
276 3300045976 Ga0466967_0010052 Ga0466967_0010052_4661_5968 416
277 3300045976 Ga0466967_0029013 Ga0466967_0029013_394_1701 416
278 3300045976 Ga0466967_0052336 Ga0466967_0052336_720_2027 416
279 3300046457 Ga0495590_0000044 Ga0495590_0000044_106530_107840 416
280 3300046457 Ga0495590_0001422 Ga0495590_0001422_588_1898 416
281 3300046457 Ga0495590_0029423 Ga0495590_0029423_559_1872 416
282 3300046458 Ga0495591_000052 Ga0495591_000052_85401_86711 416
283 3300046458 Ga0495591_013310 Ga0495591_013310_1336_2646 416
284 3300046460 Ga0495638_0042333 Ga0495638_0042333_1006_2316 416
285 3300046463 Ga0495653_0086072 Ga0495653_0086072_160_1470 416
286 3300046471 Ga0495650_0004423 Ga0495650_0004423_5631_6941 416
287 3300046474 Ga0495605_0004879 Ga0495605_0004879_5895_7202 416
288 3300046474 Ga0495605_0019662 Ga0495605_0019662_1957_3267 416
289 3300046491 Ga0495584_0000196 Ga0495584_0000196_3742_5049 416
290 3300046491 Ga0495584_0000224 Ga0495584_0000224_27963_29273 416
291 3300046491 Ga0495584_0003029 Ga0495584_0003029_88_1395 416
292 3300046491 Ga0495584_0004806 Ga0495584_0004806_2020_3330 416
293 3300046499 Ga0495594_0001964 Ga0495594_0001964_4249_5559 416
294 3300046499 Ga0495594_0036539 Ga0495594_0036539_503_1813 416
295 3300046501 Ga0495607_0001173 Ga0495607_0001173_12527_13834 416
296 3300046501 Ga0495607_0002995 Ga0495607_0002995_1101_2411 416
297 3300046506 Ga0495583_0000407 Ga0495583_0000407_9142_10452 416
298 3300046506 Ga0495583_0002569 Ga0495583_0002569_6828_8138 416
299 3300046506 Ga0495583_0004946 Ga0495583_0004946_2333_3643 416
300 3300046506 Ga0495583_0013254 Ga0495583_0013254_2388_3698 416
301 3300046506 Ga0495583_0021650 Ga0495583_0021650_293_1603 416
302 3300046507 Ga0495606_0044773 Ga0495606_0044773_1384_2694 416
303 3300046507 Ga0495606_0046053 Ga0495606_0046053_956_2266 416
304 3300046512 Ga0495610_0000493 Ga0495610_0000493_37957_39267 416
305 3300046513 Ga0495616_0001114 Ga0495616_0001114_12420_13727 416
306 3300046513 Ga0495616_0021296 Ga0495616_0021296_1310_2635 416
307 3300046513 Ga0495616_0035614 Ga0495616_0035614_295_1605 416
308 3300046518 Ga0495631_0000236 Ga0495631_0000236_11571_12881 416
309 3300046518 Ga0495631_0001324 Ga0495631_0001324_1849_3159 416
310 3300046519 Ga0495632_0000040 Ga0495632_0000040_94184_95494 416
311 3300046519 Ga0495632_0004600 Ga0495632_0004600_6446_7771 416
312 3300046519 Ga0495632_0019117 Ga0495632_0019117_1201_2511 416
313 3300046520 Ga0495637_0000006 Ga0495637_0000006_133852_135162 416
314 3300046522 Ga0495643_0001148 Ga0495643_0001148_21301_22626 416
315 3300046522 Ga0495643_0005149 Ga0495643_0005149_4658_5968 416
316 3300046523 Ga0495644_0007587 Ga0495644_0007587_886_2196 416
317 3300046523 Ga0495644_0011556 Ga0495644_0011556_1298_2608 416
318 3300046523 Ga0495644_0025511 Ga0495644_0025511_20_1330 416
319 3300046524 Ga0495648_0004921 Ga0495648_0004921_2299_3612 416
320 3300046524 Ga0495648_0014475 Ga0495648_0014475_1445_2755 416
321 3300046524 Ga0495648_0014733 Ga0495648_0014733_4159_5469 416
322 3300046524 Ga0495648_0021412 Ga0495648_0021412_88_1398 416
323 3300046524 Ga0495648_0045515 Ga0495648_0045515_1184_2482 416
324 3300046526 Ga0495666_0001105 Ga0495666_0001105_5413_6723 416
325 3300046528 Ga0495642_0007584 Ga0495642_0007584_95_1405 416
326 3300046528 Ga0495642_0026403 Ga0495642_0026403_941_2251 416
327 3300046531 Ga0495665_0057610 Ga0495665_0057610_29_1339 416
328 3300046533 Ga0495640_0040534 Ga0495640_0040534_1115_2425 416
329 3300046535 Ga0495586_0011899 Ga0495586_0011899_598_1908 416
330 3300046538 Ga0495609_0000096 Ga0495609_0000096_37254_38561 416
331 3300046538 Ga0495609_0003010 Ga0495609_0003010_8299_9609 416
332 3300046538 Ga0495609_0053162 Ga0495609_0053162_152_1462 416
333 3300046542 Ga0495597_0000586 Ga0495597_0000586_23765_25075 416
334 3300046542 Ga0495597_0000622 Ga0495597_0000622_13797_15107 416
335 3300046542 Ga0495597_0006329 Ga0495597_0006329_3698_5008 416
336 3300046543 Ga0495645_0014039 Ga0495645_0014039_725_2032 416
337 3300046558 Ga0495633_0001325 Ga0495633_0001325_4953_6263 416
338 3300046616 Ga0495668_0000435 Ga0495668_0000435_12403_13713 416
339 3300046616 Ga0495668_0043621 Ga0495668_0043621_11_1321 416
340 3300046616 Ga0495668_0076613 Ga0495668_0076613_276_1586 416
341 3300046648 Ga0495611_0002429 Ga0495611_0002429_2380_3690 416
342 3300046665 Ga0495661_0000164 Ga0495661_0000164_14272_15579 416
343 3300046665 Ga0495661_0002204 Ga0495661_0002204_9232_10545 416
344 3300046665 Ga0495661_0003932 Ga0495661_0003932_7216_8541 416
345 3300046665 Ga0495661_0037952 Ga0495661_0037952_972_2282 416
346 3300046665 Ga0495661_0053418 Ga0495661_0053418_490_1800 416
347 3300046665 Ga0495661_0078431 Ga0495661_0078431_316_1626 416
348 3300046665 Ga0495661_0104157 Ga0495661_0104157_19_1326 416
349 3300046674 Ga0495588_0000070 Ga0495588_0000070_83510_84817 416
350 3300046674 Ga0495588_0021230 Ga0495588_0021230_1671_2981 416
351 3300046674 Ga0495588_0055768 Ga0495588_0055768_147_1457 416
352 3300046674 Ga0495588_0089774 Ga0495588_0089774_228_1538 416
353 3300046684 Ga0495669_0055332 Ga0495669_0055332_346_1656 416
354 3300046689 Ga0495613_0075979 Ga0495613_0075979_1119_2429 416
355 3300046694 Ga0495649_0000236 Ga0495649_0000236_37574_38884 416
356 3300046794 Ga0495589_0000036 Ga0495589_0000036_63074_64381 416
357 3300046794 Ga0495589_0001431 Ga0495589_0001431_2380_3690 416
358 3300046810 Ga0495660_0006024 Ga0495660_0006024_5605_6915 416
359 3300046810 Ga0495660_0027256 Ga0495660_0027256_31_1341 416
360 3300047317 Ga0495604_0073606 Ga0495604_0073606_1051_2361 416
361 3300047320 Ga0495672_0000086 Ga0495672_0000086_47779_49089 416
362 3300047320 Ga0495672_0000576 Ga0495672_0000576_31467_32777 416
363 3300047323 Ga0495683_0001928 Ga0495683_0001928_2586_3896 416
364 3300047443 Ga0495687_000074 Ga0495687_000074_63213_64520 416
365 3300047445 Ga0495677_0000037 Ga0495677_0000037_14319_15626 416
366 3300047445 Ga0495677_0000348 Ga0495677_0000348_11089_12399 416
367 3300047445 Ga0495677_0002089 Ga0495677_0002089_5117_6442 416
368 3300047447 Ga0495685_004426 Ga0495685_004426_2775_4085 416
369 3300047470 Ga0495681_0001268 Ga0495681_0001268_5017_6339 416
370 3300047673 Ga0495593_0043579 Ga0495593_0043579_522_1832 416
371 3300048089 Ga0495614_0023325 Ga0495614_0023325_1038_2348 416
372 3300048091 Ga0495626_0000454 Ga0495626_0000454_33590_34897 416
373 3300048091 Ga0495626_0001945 Ga0495626_0001945_10220_11530 416
374 3300048091 Ga0495626_0004706 Ga0495626_0004706_6302_7612 416
375 3300048091 Ga0495626_0007723 Ga0495626_0007723_3837_5162 416
376 3300048091 Ga0495626_0014299 Ga0495626_0014299_1848_3158 416
377 3300048091 Ga0495626_0072655 Ga0495626_0072655_145_1455 416
378 3300048906 Ga0496103_0094184 Ga0496103_0094184_175_1482 416
379 3300048906 Ga0496103_0100593 Ga0496103_0100593_358_1668 416
380 3300048907 Ga0496104_0181696 Ga0496104_0181696_337_1647 416
381 3300048908 Ga0496105_0151083 Ga0496105_0151083_18_1325 416
382 3300048909 Ga0496106_0029913 Ga0496106_0029913_877_2184 416
383 3300048916 Ga0496113_0030220 Ga0496113_0030220_1739_3046 416
384 3300048918 Ga0496115_0122292 Ga0496115_0122292_300_1610 416
385 3300048925 Ga0496122_0056113 Ga0496122_0056113_869_2176 416
386 3300048927 Ga0496124_0124157 Ga0496124_0124157_287_1597 416
387 3300049459 Ga0495678_000064 Ga0495678_000064_71835_73145 416
388 3300049459 Ga0495678_000467 Ga0495678_000467_5369_6679 416
389 3300049822 Ga0501035_0003533 Ga0501035_0003533_3888_5195 416
390 3300049823 Ga0501044_0066442 Ga0501044_0066442_1756_3063 416

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

62

416

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8316 14 363
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8217 20 368
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8173 20 365
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.8165 22 373
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8152 20 365
ID Description Score Start End Superfamily
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9271 11 194 1.20.1250.20
af_K7ML12_100_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9093 22 192 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9087 11 189 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9085 12 192 1.20.1250.20
af_A0A1L1SUI3_3_201_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9069 6 194 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A846S1G7-F1-model_v4 MFS family permease 0.9224 17 194 GO:0016020
GO:0022857
AF-A0A2W6DG54-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9103 2 192 GO:0005886
GO:0022857
AF-A0A6H9P481-F1-model_v4 deleted 0.9061 20 160
AF-A0A4S4MZP5-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9045 11 180 GO:0005886
GO:0022857
AF-A0A425I806-F1-model_v4 Transporter, major facilitator family protein 0.9009 20 189 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
73.54 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map