F431814

General Info

Members Datasets Scaffolds Average Seq Length
390 173 778 213

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0049399|Ga0495653_0049399_2358_3086
Length 242
Sequence VAPSYVWLYRIRTGPRAWYWLDLGHARLKLDATKLQKKVYAGYAKAALRIGPLFNVFRPSDPLNPLGFGPIVTLNASFNAEDMTYGRPNKYGKPTWYCLVDGTQTMVGDYLINDIQTFFIAAMQPILPILAVDCNRTINVLRPQQQTGVGAVGYGGDTDGNETLLMSGWPASVLQGTKGEKNETNLPGDVRNPWWQILFPAFPGVVIRTADIITDDIDRRYIVSSAELTDLGWRLTAQSAQT

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
37 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
169 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
170 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
171 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
172 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
173 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.26
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0.26
Rhizoplane 1.28
Rhizosphere 90.51
Stem 0
Stem Tuber 0
Unclassified 14.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0049399 3300046463 Viruses 3241
2 JGI25154J39366_1003685 3300002738 Bacteria 3088
3 Ga0007409J51694_1030723 3300003575 Bacteria 4058
4 Ga0055538_1000347 3300003751 Bacteria 20503
5 Ga0055539_1000348 3300003752 Bacteria 20503
6 Ga0055533_1000340 3300003756 Bacteria 20503
7 Ga0055532_1000419 3300003758 Bacteria 20503
8 Ga0055525_1000490 3300003759 Bacteria 20503
9 Ga0055535_1014762 3300003761 Bacteria 1112
10 Ga0055541_1000240 3300003841 Bacteria 20503
11 Ga0065714_10064791 3300005288 Bacteria 18761
12 Ga0070683_100666223 3300005329 Unclassified 996
13 Ga0070680_100920798 3300005336 Unclassified 754
14 Ga0068868_100278273 3300005338 Unclassified 1416
15 Ga0070714_100154031 3300005435 Bacteria 2074
16 Ga0070713_100006876 3300005436 Bacteria 7931
17 Ga0070713_100068446 3300005436 Viruses 2991
18 Ga0070710_10059456 3300005437 Bacteria 2171
19 Ga0070711_100209897 3300005439 Unclassified 1507
20 Ga0070678_100518242 3300005456 Unclassified 1054
21 Ga0070662_100260718 3300005457 Bacteria 1396
22 Ga0070664_100310766 3300005564 Unclassified 1426
23 Ga0068857_100806941 3300005577 Unclassified 896
24 Ga0068856_100101162 3300005614 Bacteria 2875
25 Ga0068860_100944500 3300005843 Unclassified 879
26 Ga0081455_10159051 3300005937 Bacteria 1733
27 Ga0070712_100012638 3300006175 Bacteria 5372
28 Ga0105244_10000146 3300009036 Bacteria 73754
29 Ga0105244_10021115 3300009036 Bacteria 3606
30 Ga0105239_11377490 3300010375 Unclassified 814
31 Ga0157371_10001156 3300013102 Bacteria 28392
32 Ga0157374_10067525 3300013296 Bacteria 3362
33 Ga0182008_10009905 3300014497 Bacteria 5125
34 Ga0182008_10329267 3300014497 Unclassified 805
35 Ga0182006_1000275 3300015261 Bacteria 46004
36 Ga0182007_10000542 3300015262 Bacteria 22232
37 Ga0163161_10036894 3300017792 Bacteria 3502
38 Ga0213872_10000257 3300021361 Bacteria 46166
39 Ga0209435_100943 3300025206 Bacteria 4286
40 Ga0209784_100368 3300025224 Bacteria 21333
41 Ga0209566_100664 3300025225 Bacteria 20588
42 Ga0209674_100420 3300025226 Bacteria 20588
43 Ga0209147_100549 3300025229 Bacteria 21319
44 Ga0209563_100296 3300025230 Bacteria 20588
45 Ga0209437_100053 3300025233 Bacteria 375580
46 Ga0209258_100754 3300025242 Bacteria 20482
47 Ga0209646_1000464 3300025246 Bacteria 20587
48 Ga0209677_100561 3300025253 Bacteria 20588
49 Ga0209759_1007801 3300025256 Bacteria 3398
50 Ga0209455_1001833 3300025272 Viruses 8915
51 Ga0207655_1002677 3300025728 Bacteria 14005
52 Ga0207692_10045333 3300025898 Bacteria 2199
53 Ga0207693_10019528 3300025915 Bacteria 5390
54 Ga0207700_10038506 3300025928 Bacteria 3471
55 Ga0207700_10050351 3300025928 Viruses 3104
56 Ga0207700_10091827 3300025928 Bacteria 2399
57 Ga0207700_10435568 3300025928 Unclassified 1153
58 Ga0207664_10055278 3300025929 Bacteria 3150
59 Ga0207667_10142599 3300025949 Unclassified 2467
60 Ga0207683_10322957 3300026121 Bacteria 1414
61 Ga0209371_1003737 3300027312 Bacteria 7131
62 Ga0268264_10763661 3300028381 Unclassified 964
63 Ga0265338_10136242 3300028800 Unclassified 1930
64 Ga0268256_1003433 3300030500 Bacteria 7131
65 Ga0307511_10260436 3300030521 Bacteria 823
66 Ga0265320_10129807 3300031240 Bacteria 1145
67 Ga0373926_0046386 3300035083 Unclassified 1559
68 Ga0373954_0108967 3300035118 Unclassified 1339
69 Ga0373956_0023443 3300035119 Viruses 2649
70 Ga0373943_0114450 3300035170 Unclassified 1427
71 Ga0373955_0007604 3300035172 Viruses 4991
72 Ga0373955_0240690 3300035172 Bacteria 1084
73 Ga0373924_0007309 3300035410 Viruses 3984
74 Ga0373935_0033435 3300035692 Bacteria 3200
75 Ga0373927_0115259 3300035695 Unclassified 1752
76 Ga0373927_0135670 3300035695 Unclassified 1608
77 Ga0373927_0329117 3300035695 Unclassified 1006
78 Ga0373933_0096914 3300035724 Bacteria 1826
79 Ga0373947_0549542 3300035725 Unclassified 786
80 Ga0373937_0004348 3300036401 Bacteria 12023
81 Ga0373937_0027353 3300036401 Bacteria 5157
82 Ga0373937_0055802 3300036401 Viruses 3627
83 Ga0373925_0055760 3300037068 Bacteria 2959
84 Ga0373925_0421937 3300037068 Bacteria 1090
85 Ga0395899_0120242 3300037312 Bacteria 1882
86 Ga0395900_0001054 3300037418 Bacteria 35349
87 Ga0395898_0008663 3300037466 Bacteria 10732
88 Ga0395905_0271627 3300037471 Bacteria 1581
89 Ga0436364_0349215 3300037853 Bacteria 2179
90 Ga0395901_0001323 3300038443 Bacteria 26089
91 Ga0395901_0434145 3300038443 Bacteria 1345
92 Ga0436360_1154307 3300039438 Unclassified 1154
93 Ga0436361_0125110 3300039447 Bacteria 71341
94 Ga0439456_000035 3300042013 Bacteria 50951
95 Ga0466970_0205490 3300044765 Bacteria 1096
96 Ga0466959_0000080 3300045049 Bacteria 60034
97 Ga0495592_0000171 3300046454 Bacteria 57306
98 Ga0495592_0006650 3300046454 Bacteria 8619
99 Ga0495592_0125460 3300046454 Bacteria 1802
100 Ga0495603_0000108 3300046455 Bacteria 39270
101 Ga0495603_0000402 3300046455 Bacteria 23804
102 Ga0495603_0016842 3300046455 Bacteria 4423
103 Ga0495590_0000466 3300046457 Bacteria 20007
104 Ga0495590_0011477 3300046457 Bacteria 3312
105 Ga0495591_003572 3300046458 Bacteria 7940
106 Ga0495629_0000706 3300046459 Bacteria 27015
107 Ga0495629_0000881 3300046459 Bacteria 24205
108 Ga0495629_0003937 3300046459 Bacteria 11166
109 Ga0495629_0027580 3300046459 Viruses 4032
110 Ga0495638_0000372 3300046460 Bacteria 55671
111 Ga0495651_0000268 3300046462 Bacteria 40453
112 Ga0495651_0205399 3300046462 Unclassified 1375
113 Ga0495651_0230087 3300046462 Bacteria 1277
114 Ga0495653_0000181 3300046463 Bacteria 51564
115 Ga0495653_0000251 3300046463 Bacteria 43006
116 Ga0495653_0000312 3300046463 Bacteria 39561
117 Ga0495653_0000393 3300046463 Bacteria 35033
118 Ga0495653_0000539 3300046463 Bacteria 28993
119 Ga0495653_0000574 3300046463 Bacteria 28196
120 Ga0495653_0007324 3300046463 Bacteria 9035
121 Ga0495653_0020389 3300046463 Bacteria 5375
122 Ga0495653_0025411 3300046463 Bacteria 4760
123 Ga0495653_0206757 3300046463 Unclassified 1328
124 Ga0495653_0302098 3300046463 Bacteria 1044
125 Ga0495582_0002429 3300046473 Bacteria 10401
126 Ga0495605_0000111 3300046474 Bacteria 104320
127 Ga0495605_0000269 3300046474 Bacteria 59375
128 Ga0495605_0000434 3300046474 Bacteria 37796
129 Ga0495662_0000095 3300046476 Bacteria 32118
130 Ga0495662_0000144 3300046476 Bacteria 27715
131 Ga0495662_0001615 3300046476 Bacteria 11204
132 Ga0495662_0043084 3300046476 Bacteria 2179
133 Ga0495662_0109972 3300046476 Unclassified 1350
134 Ga0495664_0000061 3300046477 Bacteria 51775
135 Ga0495664_0010653 3300046477 Bacteria 5160
136 Ga0495664_0012137 3300046477 Bacteria 4874
137 Ga0495664_0012906 3300046477 Bacteria 4734
138 Ga0495664_0099562 3300046477 Bacteria 1750
139 Ga0495664_0119411 3300046477 Bacteria 1594
140 Ga0495594_0003644 3300046499 Bacteria 7918
141 Ga0495594_0006775 3300046499 Bacteria 5892
142 Ga0495596_0000195 3300046500 Bacteria 41977
143 Ga0495607_0001894 3300046501 Bacteria 17751
144 Ga0495607_0014876 3300046501 Bacteria 5056
145 Ga0495583_0000621 3300046506 Bacteria 47668
146 Ga0495606_0000651 3300046507 Bacteria 54697
147 Ga0495606_0000658 3300046507 Bacteria 54222
148 Ga0495606_0001534 3300046507 Bacteria 30541
149 Ga0495606_0001695 3300046507 Bacteria 28467
150 Ga0495606_0013734 3300046507 Bacteria 6375
151 Ga0495608_0019627 3300046511 Bacteria 4651
152 Ga0495608_0053643 3300046511 Bacteria 2667
153 Ga0495608_0064657 3300046511 Bacteria 2397
154 Ga0495608_0165909 3300046511 Unclassified 1402
155 Ga0495608_0182923 3300046511 Unclassified 1325
156 Ga0495610_0001650 3300046512 Bacteria 19630
157 Ga0495616_0020232 3300046513 Bacteria 3623
158 Ga0495618_0069755 3300046514 Bacteria 2234
159 Ga0495620_0000176 3300046515 Bacteria 50146
160 Ga0495620_0072420 3300046515 Bacteria 1407
161 Ga0495628_0000178 3300046516 Bacteria 55923
162 Ga0495628_0004746 3300046516 Bacteria 11983
163 Ga0495628_0014835 3300046516 Bacteria 6517
164 Ga0495628_0029334 3300046516 Bacteria 4462
165 Ga0495630_0000160 3300046517 Bacteria 52668
166 Ga0495630_0000169 3300046517 Bacteria 51128
167 Ga0495630_0000184 3300046517 Bacteria 48504
168 Ga0495630_0000296 3300046517 Bacteria 40004
169 Ga0495630_0000976 3300046517 Bacteria 19908
170 Ga0495630_0000992 3300046517 Bacteria 19745
171 Ga0495630_0001596 3300046517 Bacteria 15751
172 Ga0495630_0003622 3300046517 Bacteria 10768
173 Ga0495630_0138542 3300046517 Bacteria 1849
174 Ga0495643_0000439 3300046522 Bacteria 53744
175 Ga0495644_0000313 3300046523 Bacteria 22424
176 Ga0495648_0000578 3300046524 Bacteria 39201
177 Ga0495648_0017082 3300046524 Bacteria 5203
178 Ga0495666_0000026 3300046526 Bacteria 55811
179 Ga0495666_0000028 3300046526 Bacteria 54995
180 Ga0495666_0004575 3300046526 Bacteria 6994
181 Ga0495666_0005376 3300046526 Bacteria 6450
182 Ga0495652_0000330 3300046529 Bacteria 55923
183 Ga0495652_0003405 3300046529 Bacteria 15722
184 Ga0495652_0003759 3300046529 Bacteria 14850
185 Ga0495652_0010408 3300046529 Bacteria 8430
186 Ga0495652_0042712 3300046529 Bacteria 3908
187 Ga0495652_0119412 3300046529 Bacteria 2106
188 Ga0495652_0164927 3300046529 Unclassified 1715
189 Ga0495652_0232842 3300046529 Bacteria 1376
190 Ga0495654_0000232 3300046530 Bacteria 52153
191 Ga0495665_0000036 3300046531 Bacteria 52578
192 Ga0495665_0003009 3300046531 Bacteria 9109
193 Ga0495665_0005404 3300046531 Bacteria 6884
194 Ga0495665_0005409 3300046531 Bacteria 6883
195 Ga0495665_0013052 3300046531 Bacteria 4498
196 Ga0495665_0029151 3300046531 Bacteria 2957
197 Ga0495665_0057191 3300046531 Bacteria 2058
198 Ga0495665_0072134 3300046531 Unclassified 1818
199 Ga0495640_0014267 3300046533 Bacteria 6019
200 Ga0495640_0128594 3300046533 Bacteria 1641
201 Ga0495640_0218526 3300046533 Unclassified 1202
202 Ga0495586_0000101 3300046535 Bacteria 52672
203 Ga0495586_0003460 3300046535 Bacteria 8465
204 Ga0495586_0008013 3300046535 Bacteria 5634
205 Ga0495586_0014932 3300046535 Bacteria 4126
206 Ga0495587_0000146 3300046536 Bacteria 52893
207 Ga0495587_0000274 3300046536 Bacteria 36875
208 Ga0495587_0000300 3300046536 Bacteria 35367
209 Ga0495587_0002835 3300046536 Bacteria 11611
210 Ga0495587_0028247 3300046536 Viruses 3412
211 Ga0495645_0000117 3300046543 Bacteria 53952
212 Ga0495645_0018590 3300046543 Bacteria 4994
213 Ga0495645_0020426 3300046543 Bacteria 4777
214 Ga0495645_0034992 3300046543 Viruses 3662
215 Ga0495645_0041661 3300046543 Bacteria 3348
216 Ga0495645_0084490 3300046543 Bacteria 2273
217 Ga0495622_0000467 3300046557 Bacteria 25849
218 Ga0495633_0081537 3300046558 Unclassified 1505
219 Ga0495667_0045589 3300046559 Bacteria 2902
220 Ga0495667_0048273 3300046559 Bacteria 2811
221 Ga0495667_0052680 3300046559 Viruses 2680
222 Ga0495656_0030692 3300046615 Unclassified 2174
223 Ga0495634_0000201 3300046642 Bacteria 55431
224 Ga0495634_0000227 3300046642 Bacteria 52633
225 Ga0495634_0000230 3300046642 Bacteria 52102
226 Ga0495634_0000441 3300046642 Bacteria 41394
227 Ga0495634_0006172 3300046642 Bacteria 9125
228 Ga0495634_0007996 3300046642 Bacteria 7889
229 Ga0495634_0322832 3300046642 Unclassified 929
230 Ga0495611_0000325 3300046648 Bacteria 31466
231 Ga0495635_0000173 3300046663 Bacteria 40335
232 Ga0495635_0003461 3300046663 Bacteria 10904
233 Ga0495635_0012834 3300046663 Bacteria 5868
234 Ga0495635_0076557 3300046663 Viruses 2293
235 Ga0495661_0000222 3300046665 Bacteria 65323
236 Ga0495661_0000381 3300046665 Bacteria 47498
237 Ga0495588_0000231 3300046674 Bacteria 49904
238 Ga0495588_0000317 3300046674 Bacteria 32716
239 Ga0495588_0005430 3300046674 Bacteria 5673
240 Ga0495599_0000109 3300046678 Bacteria 56046
241 Ga0495599_0002745 3300046678 Bacteria 10272
242 Ga0495599_0021031 3300046678 Viruses 4068
243 Ga0495623_0000406 3300046679 Bacteria 28439
244 Ga0495623_0001417 3300046679 Bacteria 16249
245 Ga0495623_0011256 3300046679 Bacteria 5786
246 Ga0495623_0029126 3300046679 Bacteria 3554
247 Ga0495623_0042889 3300046679 Bacteria 2879
248 Ga0495646_0000060 3300046680 Bacteria 52182
249 Ga0495646_0000063 3300046680 Bacteria 51220
250 Ga0495646_0011328 3300046680 Bacteria 5662
251 Ga0495646_0024575 3300046680 Bacteria 3793
252 Ga0495646_0100052 3300046680 Unclassified 1663
253 Ga0495646_0106622 3300046680 Unclassified 1599
254 Ga0495646_0133793 3300046680 Unclassified 1393
255 Ga0495646_0295806 3300046680 Unclassified 857
256 Ga0495669_0000133 3300046684 Bacteria 47748
257 Ga0495613_0000182 3300046689 Bacteria 61411
258 Ga0495613_0000235 3300046689 Bacteria 52929
259 Ga0495613_0313621 3300046689 Unclassified 1083
260 Ga0495613_0549748 3300046689 Bacteria 773
261 Ga0495624_0000126 3300046690 Bacteria 53679
262 Ga0495624_0004819 3300046690 Bacteria 9811
263 Ga0495624_0016014 3300046690 Bacteria 5046
264 Ga0495624_0040676 3300046690 Bacteria 2976
265 Ga0495624_0057477 3300046690 Bacteria 2445
266 Ga0495624_0065709 3300046690 Bacteria 2265
267 Ga0495624_0129952 3300046690 Unclassified 1544
268 Ga0495624_0145691 3300046690 Unclassified 1449
269 Ga0495624_0628378 3300046690 Unclassified 639
270 Ga0495671_0000235 3300046692 Bacteria 47645
271 Ga0495671_0004457 3300046692 Bacteria 8373
272 Ga0495649_0000191 3300046694 Bacteria 53975
273 Ga0495649_0000234 3300046694 Bacteria 48727
274 Ga0495589_0000374 3300046794 Bacteria 34286
275 Ga0495589_0001126 3300046794 Bacteria 15905
276 Ga0495589_0078780 3300046794 Unclassified 1604
277 Ga0495600_0001272 3300046809 Bacteria 13922
278 Ga0495600_0001837 3300046809 Bacteria 11896
279 Ga0495600_0036991 3300046809 Bacteria 3172
280 Ga0495600_0047196 3300046809 Viruses 2809
281 Ga0495600_0144942 3300046809 Bacteria 1539
282 Ga0495600_0213148 3300046809 Bacteria 1237
283 Ga0495660_0007341 3300046810 Bacteria 6476
284 Ga0495581_0000021 3300047315 Bacteria 56637
285 Ga0495581_0000136 3300047315 Bacteria 31982
286 Ga0495581_0000603 3300047315 Bacteria 18820
287 Ga0495581_0000745 3300047315 Bacteria 17301
288 Ga0495581_0009131 3300047315 Bacteria 5736
289 Ga0495581_0015874 3300047315 Bacteria 4376
290 Ga0495581_0264139 3300047315 Unclassified 1006
291 Ga0495604_0000182 3300047317 Bacteria 55923
292 Ga0495604_0002094 3300047317 Bacteria 16054
293 Ga0495604_0006809 3300047317 Bacteria 9058
294 Ga0495604_0057930 3300047317 Bacteria 2976
295 Ga0495604_0081185 3300047317 Bacteria 2428
296 Ga0495604_0087655 3300047317 Bacteria 2317
297 Ga0495604_0185569 3300047317 Unclassified 1452
298 Ga0495604_0186169 3300047317 Unclassified 1449
299 Ga0495674_0000083 3300047319 Bacteria 65482
300 Ga0495674_0000156 3300047319 Bacteria 52669
301 Ga0495674_0000721 3300047319 Bacteria 31277
302 Ga0495674_0000930 3300047319 Bacteria 27999
303 Ga0495674_0010389 3300047319 Bacteria 8814
304 Ga0495674_0101607 3300047319 Unclassified 2446
305 Ga0495674_0270096 3300047319 Unclassified 1395
306 Ga0495674_0601033 3300047319 Bacteria 871
307 Ga0495676_0057884 3300047321 Viruses 3053
308 Ga0495676_0192342 3300047321 Bacteria 1422
309 Ga0495676_0375567 3300047321 Unclassified 946
310 Ga0495676_0376857 3300047321 Unclassified 944
311 Ga0495680_0000330 3300047322 Bacteria 52957
312 Ga0495680_0000420 3300047322 Bacteria 47532
313 Ga0495680_0001168 3300047322 Bacteria 28909
314 Ga0495680_0001170 3300047322 Bacteria 28903
315 Ga0495680_0001578 3300047322 Bacteria 24397
316 Ga0495680_0030172 3300047322 Bacteria 4430
317 Ga0495680_0184966 3300047322 Unclassified 1501
318 Ga0495680_0212725 3300047322 Bacteria 1383
319 Ga0495683_0000162 3300047323 Bacteria 65345
320 Ga0495683_0000252 3300047323 Bacteria 48423
321 Ga0495683_0011979 3300047323 Bacteria 4556
322 Ga0495683_0014600 3300047323 Bacteria 4092
323 Ga0495683_0027267 3300047323 Bacteria 2921
324 Ga0495683_0039842 3300047323 Bacteria 2374
325 Ga0495687_065301 3300047443 Bacteria 1482
326 Ga0495675_0000143 3300047444 Bacteria 49905
327 Ga0495675_0000792 3300047444 Bacteria 19495
328 Ga0495675_0004624 3300047444 Bacteria 8358
329 Ga0495675_0016034 3300047444 Bacteria 4737
330 Ga0495675_0026220 3300047444 Viruses 3717
331 Ga0495675_0085700 3300047444 Unclassified 1980
332 Ga0495675_0109876 3300047444 Bacteria 1721
333 Ga0495675_0135112 3300047444 Bacteria 1531
334 Ga0495679_007227 3300047446 Bacteria 4659
335 Ga0495673_0000410 3300047469 Bacteria 50134
336 Ga0495673_0000912 3300047469 Bacteria 26978
337 Ga0495681_0000097 3300047470 Bacteria 76004
338 Ga0495681_0000215 3300047470 Bacteria 47888
339 Ga0495684_0336403 3300047471 Bacteria 1076
340 Ga0495686_0042390 3300047472 Bacteria 2895
341 Ga0495593_0000036 3300047673 Bacteria 53664
342 Ga0495593_0000187 3300047673 Bacteria 32391
343 Ga0495593_0009339 3300047673 Bacteria 5692
344 Ga0495593_0044562 3300047673 Bacteria 2372
345 Ga0495593_0068480 3300047673 Bacteria 1846
346 Ga0495593_0069436 3300047673 Bacteria 1832
347 Ga0495593_0072574 3300047673 Bacteria 1786
348 Ga0495593_0079986 3300047673 Bacteria 1691
349 Ga0495593_0106179 3300047673 Bacteria 1436
350 Ga0495593_0135319 3300047673 Unclassified 1249
351 Ga0495602_0000100 3300048088 Bacteria 81273
352 Ga0495602_0000259 3300048088 Bacteria 48721
353 Ga0495602_0000435 3300048088 Bacteria 39286
354 Ga0495602_0025922 3300048088 Bacteria 5666
355 Ga0495602_0049400 3300048088 Viruses 3768
356 Ga0495602_0058142 3300048088 Bacteria 3387
357 Ga0495602_0181375 3300048088 Unclassified 1623
358 Ga0495614_0000020 3300048089 Bacteria 46223
359 Ga0495614_0000130 3300048089 Bacteria 26394
360 Ga0495614_0011990 3300048089 Bacteria 3807
361 Ga0495614_0040096 3300048089 Viruses 2010
362 Ga0495614_0054208 3300048089 Unclassified 1719
363 Ga0495614_0064456 3300048089 Unclassified 1575
364 Ga0495614_0123188 3300048089 Unclassified 1144
365 Ga0495626_0000232 3300048091 Bacteria 65473
366 Ga0496102_0022616 3300048905 Bacteria 5571
367 Ga0496102_0305253 3300048905 Unclassified 1500
368 Ga0496108_0053472 3300048911 Viruses 3387
369 Ga0496109_0166379 3300048912 Bacteria 2068
370 Ga0496115_0000454 3300048918 Bacteria 32856
371 Ga0496122_0099070 3300048925 Bacteria 1956
372 Ga0496123_0063987 3300048926 Bacteria 2346
373 Ga0496124_0000852 3300048927 Bacteria 49759
374 Ga0496124_0020568 3300048927 Bacteria 6093
375 Ga0496125_0015871 3300048928 Bacteria 7256
376 Ga0495678_002323 3300049459 Bacteria 13099
377 Ga0495682_0001182 3300049460 Bacteria 14889
378 Ga0495682_0003717 3300049460 Bacteria 6724
379 Ga0495601_0003305 3300053077 Bacteria 9224
380 Ga0495601_0012282 3300053077 Bacteria 5135
381 Ga0495612_0051033 3300053078 Bacteria 1699
382 Ga0495619_0252033 3300053085 Unclassified 1223
383 Ga0495619_0730325 3300053085 Bacteria 672
384 2738670208 2738541265 Bacteria 6594665
385 2738748601 2738541282 Bacteria 6593925
386 2738857643 2738541303 Bacteria 6591772
387 2819593335 2818991445 Bacteria 4955017
388 2843692813 2843690924 Bacteria 5169057
389 2921644865 2921643360 Bacteria 11448031
390 Ga0495653_0049399
391 JGI25154J39366_1003685
392 Ga0007409J51694_1030723
393 Ga0055538_1000347
394 Ga0055539_1000348
395 Ga0055533_1000340
396 Ga0055532_1000419
397 Ga0055525_1000490
398 Ga0055535_1014762
399 Ga0055541_1000240
400 Ga0065714_10064791
401 Ga0070683_100666223
402 Ga0070680_100920798
403 Ga0068868_100278273
404 Ga0070714_100154031
405 Ga0070713_100006876
406 Ga0070713_100068446
407 Ga0070710_10059456
408 Ga0070711_100209897
409 Ga0070678_100518242
410 Ga0070662_100260718
411 Ga0070664_100310766
412 Ga0068857_100806941
413 Ga0068856_100101162
414 Ga0068860_100944500
415 Ga0081455_10159051
416 Ga0070712_100012638
417 Ga0105244_10000146
418 Ga0105244_10021115
419 Ga0105239_11377490
420 Ga0157371_10001156
421 Ga0157374_10067525
422 Ga0182008_10009905
423 Ga0182008_10329267
424 Ga0182006_1000275
425 Ga0182007_10000542
426 Ga0163161_10036894
427 Ga0213872_10000257
428 Ga0209435_100943
429 Ga0209784_100368
430 Ga0209566_100664
431 Ga0209674_100420
432 Ga0209147_100549
433 Ga0209563_100296
434 Ga0209437_100053
435 Ga0209258_100754
436 Ga0209646_1000464
437 Ga0209677_100561
438 Ga0209759_1007801
439 Ga0209455_1001833
440 Ga0207655_1002677
441 Ga0207692_10045333
442 Ga0207693_10019528
443 Ga0207700_10038506
444 Ga0207700_10050351
445 Ga0207700_10091827
446 Ga0207700_10435568
447 Ga0207664_10055278
448 Ga0207667_10142599
449 Ga0207683_10322957
450 Ga0209371_1003737
451 Ga0268264_10763661
452 Ga0265338_10136242
453 Ga0268256_1003433
454 Ga0307511_10260436
455 Ga0265320_10129807
456 Ga0373926_0046386
457 Ga0373954_0108967
458 Ga0373956_0023443
459 Ga0373943_0114450
460 Ga0373955_0007604
461 Ga0373955_0240690
462 Ga0373924_0007309
463 Ga0373935_0033435
464 Ga0373927_0115259
465 Ga0373927_0135670
466 Ga0373927_0329117
467 Ga0373933_0096914
468 Ga0373947_0549542
469 Ga0373937_0004348
470 Ga0373937_0027353
471 Ga0373937_0055802
472 Ga0373925_0055760
473 Ga0373925_0421937
474 Ga0395899_0120242
475 Ga0395900_0001054
476 Ga0395898_0008663
477 Ga0395905_0271627
478 Ga0436364_0349215
479 Ga0395901_0001323
480 Ga0395901_0434145
481 Ga0436360_1154307
482 Ga0436361_0125110
483 Ga0439456_000035
484 Ga0466970_0205490
485 Ga0466959_0000080
486 Ga0495592_0000171
487 Ga0495592_0006650
488 Ga0495592_0125460
489 Ga0495603_0000108
490 Ga0495603_0000402
491 Ga0495603_0016842
492 Ga0495590_0000466
493 Ga0495590_0011477
494 Ga0495591_003572
495 Ga0495629_0000706
496 Ga0495629_0000881
497 Ga0495629_0003937
498 Ga0495629_0027580
499 Ga0495638_0000372
500 Ga0495651_0000268
501 Ga0495651_0205399
502 Ga0495651_0230087
503 Ga0495653_0000181
504 Ga0495653_0000251
505 Ga0495653_0000312
506 Ga0495653_0000393
507 Ga0495653_0000539
508 Ga0495653_0000574
509 Ga0495653_0007324
510 Ga0495653_0020389
511 Ga0495653_0025411
512 Ga0495653_0206757
513 Ga0495653_0302098
514 Ga0495582_0002429
515 Ga0495605_0000111
516 Ga0495605_0000269
517 Ga0495605_0000434
518 Ga0495662_0000095
519 Ga0495662_0000144
520 Ga0495662_0001615
521 Ga0495662_0043084
522 Ga0495662_0109972
523 Ga0495664_0000061
524 Ga0495664_0010653
525 Ga0495664_0012137
526 Ga0495664_0012906
527 Ga0495664_0099562
528 Ga0495664_0119411
529 Ga0495594_0003644
530 Ga0495594_0006775
531 Ga0495596_0000195
532 Ga0495607_0001894
533 Ga0495607_0014876
534 Ga0495583_0000621
535 Ga0495606_0000651
536 Ga0495606_0000658
537 Ga0495606_0001534
538 Ga0495606_0001695
539 Ga0495606_0013734
540 Ga0495608_0019627
541 Ga0495608_0053643
542 Ga0495608_0064657
543 Ga0495608_0165909
544 Ga0495608_0182923
545 Ga0495610_0001650
546 Ga0495616_0020232
547 Ga0495618_0069755
548 Ga0495620_0000176
549 Ga0495620_0072420
550 Ga0495628_0000178
551 Ga0495628_0004746
552 Ga0495628_0014835
553 Ga0495628_0029334
554 Ga0495630_0000160
555 Ga0495630_0000169
556 Ga0495630_0000184
557 Ga0495630_0000296
558 Ga0495630_0000976
559 Ga0495630_0000992
560 Ga0495630_0001596
561 Ga0495630_0003622
562 Ga0495630_0138542
563 Ga0495643_0000439
564 Ga0495644_0000313
565 Ga0495648_0000578
566 Ga0495648_0017082
567 Ga0495666_0000026
568 Ga0495666_0000028
569 Ga0495666_0004575
570 Ga0495666_0005376
571 Ga0495652_0000330
572 Ga0495652_0003405
573 Ga0495652_0003759
574 Ga0495652_0010408
575 Ga0495652_0042712
576 Ga0495652_0119412
577 Ga0495652_0164927
578 Ga0495652_0232842
579 Ga0495654_0000232
580 Ga0495665_0000036
581 Ga0495665_0003009
582 Ga0495665_0005404
583 Ga0495665_0005409
584 Ga0495665_0013052
585 Ga0495665_0029151
586 Ga0495665_0057191
587 Ga0495665_0072134
588 Ga0495640_0014267
589 Ga0495640_0128594
590 Ga0495640_0218526
591 Ga0495586_0000101
592 Ga0495586_0003460
593 Ga0495586_0008013
594 Ga0495586_0014932
595 Ga0495587_0000146
596 Ga0495587_0000274
597 Ga0495587_0000300
598 Ga0495587_0002835
599 Ga0495587_0028247
600 Ga0495645_0000117
601 Ga0495645_0018590
602 Ga0495645_0020426
603 Ga0495645_0034992
604 Ga0495645_0041661
605 Ga0495645_0084490
606 Ga0495622_0000467
607 Ga0495633_0081537
608 Ga0495667_0045589
609 Ga0495667_0048273
610 Ga0495667_0052680
611 Ga0495656_0030692
612 Ga0495634_0000201
613 Ga0495634_0000227
614 Ga0495634_0000230
615 Ga0495634_0000441
616 Ga0495634_0006172
617 Ga0495634_0007996
618 Ga0495634_0322832
619 Ga0495611_0000325
620 Ga0495635_0000173
621 Ga0495635_0003461
622 Ga0495635_0012834
623 Ga0495635_0076557
624 Ga0495661_0000222
625 Ga0495661_0000381
626 Ga0495588_0000231
627 Ga0495588_0000317
628 Ga0495588_0005430
629 Ga0495599_0000109
630 Ga0495599_0002745
631 Ga0495599_0021031
632 Ga0495623_0000406
633 Ga0495623_0001417
634 Ga0495623_0011256
635 Ga0495623_0029126
636 Ga0495623_0042889
637 Ga0495646_0000060
638 Ga0495646_0000063
639 Ga0495646_0011328
640 Ga0495646_0024575
641 Ga0495646_0100052
642 Ga0495646_0106622
643 Ga0495646_0133793
644 Ga0495646_0295806
645 Ga0495669_0000133
646 Ga0495613_0000182
647 Ga0495613_0000235
648 Ga0495613_0313621
649 Ga0495613_0549748
650 Ga0495624_0000126
651 Ga0495624_0004819
652 Ga0495624_0016014
653 Ga0495624_0040676
654 Ga0495624_0057477
655 Ga0495624_0065709
656 Ga0495624_0129952
657 Ga0495624_0145691
658 Ga0495624_0628378
659 Ga0495671_0000235
660 Ga0495671_0004457
661 Ga0495649_0000191
662 Ga0495649_0000234
663 Ga0495589_0000374
664 Ga0495589_0001126
665 Ga0495589_0078780
666 Ga0495600_0001272
667 Ga0495600_0001837
668 Ga0495600_0036991
669 Ga0495600_0047196
670 Ga0495600_0144942
671 Ga0495600_0213148
672 Ga0495660_0007341
673 Ga0495581_0000021
674 Ga0495581_0000136
675 Ga0495581_0000603
676 Ga0495581_0000745
677 Ga0495581_0009131
678 Ga0495581_0015874
679 Ga0495581_0264139
680 Ga0495604_0000182
681 Ga0495604_0002094
682 Ga0495604_0006809
683 Ga0495604_0057930
684 Ga0495604_0081185
685 Ga0495604_0087655
686 Ga0495604_0185569
687 Ga0495604_0186169
688 Ga0495674_0000083
689 Ga0495674_0000156
690 Ga0495674_0000721
691 Ga0495674_0000930
692 Ga0495674_0010389
693 Ga0495674_0101607
694 Ga0495674_0270096
695 Ga0495674_0601033
696 Ga0495676_0057884
697 Ga0495676_0192342
698 Ga0495676_0375567
699 Ga0495676_0376857
700 Ga0495680_0000330
701 Ga0495680_0000420
702 Ga0495680_0001168
703 Ga0495680_0001170
704 Ga0495680_0001578
705 Ga0495680_0030172
706 Ga0495680_0184966
707 Ga0495680_0212725
708 Ga0495683_0000162
709 Ga0495683_0000252
710 Ga0495683_0011979
711 Ga0495683_0014600
712 Ga0495683_0027267
713 Ga0495683_0039842
714 Ga0495687_065301
715 Ga0495675_0000143
716 Ga0495675_0000792
717 Ga0495675_0004624
718 Ga0495675_0016034
719 Ga0495675_0026220
720 Ga0495675_0085700
721 Ga0495675_0109876
722 Ga0495675_0135112
723 Ga0495679_007227
724 Ga0495673_0000410
725 Ga0495673_0000912
726 Ga0495681_0000097
727 Ga0495681_0000215
728 Ga0495684_0336403
729 Ga0495686_0042390
730 Ga0495593_0000036
731 Ga0495593_0000187
732 Ga0495593_0009339
733 Ga0495593_0044562
734 Ga0495593_0068480
735 Ga0495593_0069436
736 Ga0495593_0072574
737 Ga0495593_0079986
738 Ga0495593_0106179
739 Ga0495593_0135319
740 Ga0495602_0000100
741 Ga0495602_0000259
742 Ga0495602_0000435
743 Ga0495602_0025922
744 Ga0495602_0049400
745 Ga0495602_0058142
746 Ga0495602_0181375
747 Ga0495614_0000020
748 Ga0495614_0000130
749 Ga0495614_0011990
750 Ga0495614_0040096
751 Ga0495614_0054208
752 Ga0495614_0064456
753 Ga0495614_0123188
754 Ga0495626_0000232
755 Ga0496102_0022616
756 Ga0496102_0305253
757 Ga0496108_0053472
758 Ga0496109_0166379
759 Ga0496115_0000454
760 Ga0496122_0099070
761 Ga0496123_0063987
762 Ga0496124_0000852
763 Ga0496124_0020568
764 Ga0496125_0015871
765 Ga0495678_002323
766 Ga0495682_0001182
767 Ga0495682_0003717
768 Ga0495601_0003305
769 Ga0495601_0012282
770 Ga0495612_0051033
771 Ga0495619_0252033
772 Ga0495619_0730325
773 2738670208
774 2738748601
775 2738857643
776 2819593335
777 2843692813
778 2921644865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kjk-assembly1.cif.gz_A4 the neck region of phage xm1 (6-fold symmetry) 0.6636 106 210
6tba-assembly1.cif.gz_3A virion of native gene transfer agent (gta) particle 0.635 103 212
6tba-assembly1.cif.gz_3A virion of native gene transfer agent (gta) particle 0.62 103 212
3f3b-assembly1.cif.gz_A structure of the phage-like element pbsx protein xkdh from bacillus subtilus. northeast structural genomics consortium target sr352. 0.5748 103 209
3gs9-assembly1.cif.gz_A crystal structure of prophage tail protein gp18 (np_465809.1) from listeria monocytogenes egd-e at 1.70 a resolution 0.561 107 209
ID Description Score Start End Superfamily
3f3bA00 Mainly Beta;Beta Barrel;Thrombin, subunit H;Protein of unknown function DUF3599 0.5995 106 209 2.40.10.370
af_Q2FX59_1_100_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5977 106 211 3.30.200.20
af_Q2FX59_1_100_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5668 106 211 3.30.200.20
3f3bA00 Mainly Beta;Beta Barrel;Thrombin, subunit H;Protein of unknown function DUF3599 0.5518 106 209 2.40.10.370
af_Q4E630_22_103_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.5513 166 211 2.40.10.10
ID Description Score Start End GO Terms
AF-D8MV51-F1-model_v4 Putative phage protein 0.9576 1 212
AF-D8MV51-F1-model_v4 Putative phage protein 0.9532 1 212
AF-A0A0D6PFZ2-F1-model_v4 Phage protein 0.9394 1 212
AF-A0A0D6PFZ2-F1-model_v4 Phage protein 0.9351 1 212
AF-A0A6I2KWS3-F1-model_v4 Uncharacterized protein 0.9343 7 212

Map