F431809

General Info

Members Datasets Scaffolds Average Seq Length
390 218 780 138

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0169531|Ga0466958_0169531_165_617
Length 150
Sequence VARARIAACDDDRMSRFVHEVHMRWSDMDAYRHVNNSAYLAYLEQARVAMFFYRHEGFSSGTVIARHEIDYLRPVVYHPEPLRLELWIEDVRGARFTVRYEVYDGDVLAARAATLCVPFDFAIDRPRRITAEEREILAGYADDEQSSARS

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
170 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
173 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.03
Rhizosphere 84.87
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0169531 3300045836 Bacteria 1382
2 Ga0070676_10586796 3300005328 Bacteria 802
3 Ga0070690_100247909 3300005330 Bacteria 1258
4 Ga0068869_100016509 3300005334 Bacteria 4978
5 Ga0070666_10002575 3300005335 Bacteria 10953
6 Ga0070680_100845912 3300005336 Bacteria 789
7 Ga0070682_100037784 3300005337 Unclassified 2958
8 Ga0070682_100163084 3300005337 Bacteria 1541
9 Ga0068868_100030935 3300005338 Bacteria 4107
10 Ga0068868_100309707 3300005338 Unclassified 1343
11 Ga0070660_100125146 3300005339 Bacteria 2054
12 Ga0070660_100479940 3300005339 Bacteria 1033
13 Ga0070691_10011781 3300005341 Bacteria 4000
14 Ga0070687_100026373 3300005343 Bacteria 2797
15 Ga0070661_100403682 3300005344 Bacteria 1081
16 Ga0070661_101121027 3300005344 Bacteria 656
17 Ga0070692_10093061 3300005345 Bacteria 1641
18 Ga0070668_100175395 3300005347 Bacteria 1747
19 Ga0070669_100072785 3300005353 Bacteria 2545
20 Ga0070671_100010993 3300005355 Bacteria 7263
21 Ga0070674_100109119 3300005356 Bacteria 2029
22 Ga0070667_101827872 3300005367 Bacteria 572
23 Ga0070703_10029994 3300005406 Bacteria 1636
24 Ga0070709_10021724 3300005434 Bacteria 3742
25 Ga0070714_100000008 3300005435 Bacteria 278734
26 Ga0070714_100071446 3300005435 Bacteria 3001
27 Ga0070714_100114696 3300005435 Bacteria 2390
28 Ga0070714_101882043 3300005435 Bacteria 584
29 Ga0070701_10310864 3300005438 Bacteria 972
30 Ga0070705_100032867 3300005440 Bacteria 2886
31 Ga0070700_100000012 3300005441 Bacteria 171410
32 Ga0070694_100016279 3300005444 Bacteria 4680
33 Ga0070663_100034095 3300005455 Bacteria 3522
34 Ga0070663_101877866 3300005455 Bacteria 538
35 Ga0070678_100026227 3300005456 Bacteria 3936
36 Ga0070678_100197876 3300005456 Unclassified 1656
37 Ga0070681_10244397 3300005458 Bacteria 1708
38 Ga0070685_10071501 3300005466 Bacteria 2057
39 Ga0070707_100670358 3300005468 Bacteria 1000
40 Ga0070698_101024983 3300005471 Bacteria 773
41 Ga0070684_100078779 3300005535 Bacteria 2912
42 Ga0070697_100061402 3300005536 Bacteria 3066
43 Ga0068853_100511496 3300005539 Bacteria 1134
44 Ga0070672_100774783 3300005543 Bacteria 843
45 Ga0070686_100029933 3300005544 Bacteria 3316
46 Ga0070695_100010148 3300005545 Bacteria 5616
47 Ga0070696_100061622 3300005546 Bacteria 2624
48 Ga0070693_100158495 3300005547 Bacteria 1439
49 Ga0070665_100002494 3300005548 Bacteria 20259
50 Ga0070665_100345646 3300005548 Bacteria 1492
51 Ga0070665_100614101 3300005548 Bacteria 1100
52 Ga0070704_100030429 3300005549 Bacteria 3617
53 Ga0068855_100056412 3300005563 Bacteria 4609
54 Ga0068855_100135527 3300005563 Bacteria 2810
55 Ga0068855_100212504 3300005563 Bacteria 2173
56 Ga0068855_100581793 3300005563 Bacteria 1209
57 Ga0070664_100408263 3300005564 Bacteria 1243
58 Ga0068854_100030109 3300005578 Bacteria 3762
59 Ga0068856_100018351 3300005614 Bacteria 6780
60 Ga0068856_100196927 3300005614 Bacteria 2029
61 Ga0068856_100288368 3300005614 Bacteria 1658
62 Ga0068856_100469246 3300005614 Bacteria 1279
63 Ga0070702_100001526 3300005615 Bacteria 9531
64 Ga0068852_100024980 3300005616 Bacteria 4836
65 Ga0068852_100158540 3300005616 Bacteria 2111
66 Ga0068852_100215576 3300005616 Bacteria 1823
67 Ga0068852_101016674 3300005616 Bacteria 848
68 Ga0068859_100006354 3300005617 Bacteria 11992
69 Ga0068859_100081388 3300005617 Bacteria 3281
70 Ga0068864_100051276 3300005618 Bacteria 3554
71 Ga0068861_100861192 3300005719 Bacteria 855
72 Ga0068870_10041570 3300005840 Bacteria 2389
73 Ga0068863_100002894 3300005841 Bacteria 17005
74 Ga0068863_100108936 3300005841 Bacteria 2636
75 Ga0068858_100004333 3300005842 Bacteria 13926
76 Ga0068858_100159238 3300005842 Bacteria 2125
77 Ga0068860_100000017 3300005843 Bacteria 307083
78 Ga0068862_100312220 3300005844 Bacteria 1449
79 Ga0081455_10010165 3300005937 Bacteria 9582
80 Ga0081540_1002807 3300005983 Bacteria 14102
81 Ga0081540_1066400 3300005983 Bacteria 1691
82 Ga0081540_1189829 3300005983 Bacteria 759
83 Ga0070717_10210807 3300006028 Bacteria 1705
84 Ga0070717_11183178 3300006028 Bacteria 696
85 Ga0075432_10059425 3300006058 Bacteria 1359
86 Ga0070715_10307104 3300006163 Bacteria 851
87 Ga0070716_100019737 3300006173 Bacteria 3527
88 Ga0070712_100060740 3300006175 Bacteria 2667
89 Ga0097621_100222450 3300006237 Unclassified 1645
90 Ga0068871_100064497 3300006358 Bacteria 2999
91 Ga0075433_10067675 3300006852 Bacteria 3135
92 Ga0075434_100052774 3300006871 Bacteria 4040
93 Ga0068865_100044542 3300006881 Bacteria 3037
94 Ga0097620_100006354 3300006931 Bacteria 11992
95 Ga0097620_100081391 3300006931 Bacteria 3281
96 Ga0075435_100762988 3300007076 Bacteria 842
97 Ga0105251_10088809 3300009011 Bacteria 1422
98 Ga0105250_10267003 3300009092 Bacteria 734
99 Ga0105240_10157161 3300009093 Bacteria 2703
100 Ga0105240_10290711 3300009093 Bacteria 1874
101 Ga0111539_10052945 3300009094 Bacteria 4831
102 Ga0105245_10074023 3300009098 Bacteria 3099
103 Ga0105245_10106229 3300009098 Bacteria 2605
104 Ga0105245_10114352 3300009098 Bacteria 2513
105 Ga0105245_11505971 3300009098 Bacteria 724
106 Ga0105247_10001103 3300009101 Bacteria 20106
107 Ga0105247_10016648 3300009101 Bacteria 4408
108 Ga0105243_10174683 3300009148 Unclassified 1864
109 Ga0105243_10771479 3300009148 Bacteria 945
110 Ga0105241_10075065 3300009174 Bacteria 2634
111 Ga0105241_10993560 3300009174 Bacteria 785
112 Ga0105241_11166737 3300009174 Bacteria 728
113 Ga0105242_10050493 3300009176 Bacteria 3386
114 Ga0105248_10201243 3300009177 Bacteria 2244
115 Ga0105248_10433139 3300009177 Bacteria 1481
116 Ga0105248_10905006 3300009177 Bacteria 996
117 Ga0105237_10016070 3300009545 Bacteria 7784
118 Ga0105237_10030758 3300009545 Bacteria 5450
119 Ga0105237_10581670 3300009545 Bacteria 1127
120 Ga0105237_11010370 3300009545 Bacteria 838
121 Ga0105237_12597282 3300009545 Bacteria 517
122 Ga0105249_10008544 3300009553 Bacteria 8927
123 Ga0105249_10057537 3300009553 Bacteria 3562
124 Ga0105249_11052392 3300009553 Bacteria 883
125 Ga0105239_10042552 3300010375 Bacteria 4977
126 Ga0105239_10120511 3300010375 Bacteria 2913
127 Ga0105239_10408670 3300010375 Bacteria 1537
128 Ga0105246_10066533 3300011119 Bacteria 2523
129 Ga0157373_10364662 3300013100 Bacteria 1032
130 Ga0157371_10316564 3300013102 Bacteria 1132
131 Ga0157370_10079506 3300013104 Bacteria 3087
132 Ga0157369_10489930 3300013105 Bacteria 1272
133 Ga0157369_10778411 3300013105 Bacteria 984
134 Ga0157369_11610324 3300013105 Bacteria 660
135 Ga0157374_10115335 3300013296 Bacteria 2587
136 Ga0157374_10221955 3300013296 Bacteria 1855
137 Ga0157374_11015491 3300013296 Bacteria 849
138 Ga0157372_10783887 3300013307 Unclassified 1108
139 Ga0157375_11006253 3300013308 Bacteria 973
140 Ga0163163_10066534 3300014325 Bacteria 3579
141 Ga0163163_11117331 3300014325 Bacteria 851
142 Ga0182008_10068972 3300014497 Bacteria 1740
143 Ga0157377_10172256 3300014745 Bacteria 1355
144 Ga0157379_10013820 3300014968 Bacteria 7075
145 Ga0157379_10065934 3300014968 Bacteria 3237
146 Ga0157376_10819726 3300014969 Unclassified 944
147 Ga0157376_10876075 3300014969 Unclassified 915
148 Ga0157376_10951367 3300014969 Bacteria 879
149 Ga0163161_10052023 3300017792 Bacteria 2969
150 Ga0197907_10000035 3300020069 Bacteria 747
151 Ga0206353_10449831 3300020082 Bacteria 1606
152 Ga0206353_11666821 3300020082 Bacteria 1378
153 Ga0213875_10017901 3300021388 Bacteria 3419
154 Ga0207653_10035281 3300025885 Bacteria 1626
155 Ga0207692_10571727 3300025898 Bacteria 724
156 Ga0207692_10925456 3300025898 Bacteria 574
157 Ga0207710_10067864 3300025900 Bacteria 1630
158 Ga0207688_10011310 3300025901 Bacteria 4858
159 Ga0207680_10027850 3300025903 Bacteria 3154
160 Ga0207647_10056948 3300025904 Bacteria 2397
161 Ga0207647_10077726 3300025904 Bacteria 1994
162 Ga0207647_10278060 3300025904 Bacteria 956
163 Ga0207647_10280351 3300025904 Bacteria 951
164 Ga0207699_10364810 3300025906 Bacteria 1022
165 Ga0207643_10040526 3300025908 Bacteria 2623
166 Ga0207705_10031121 3300025909 Bacteria 3808
167 Ga0207654_10047150 3300025911 Bacteria 2461
168 Ga0207654_10151550 3300025911 Bacteria 1489
169 Ga0207654_11154120 3300025911 Bacteria 564
170 Ga0207695_11290942 3300025913 Bacteria 610
171 Ga0207671_10028572 3300025914 Bacteria 4166
172 Ga0207671_10470617 3300025914 Bacteria 1001
173 Ga0207671_10592046 3300025914 Bacteria 884
174 Ga0207671_11212429 3300025914 Bacteria 590
175 Ga0207693_10002350 3300025915 Bacteria 16433
176 Ga0207663_10823084 3300025916 Bacteria 740
177 Ga0207660_10993971 3300025917 Bacteria 684
178 Ga0207657_10201278 3300025919 Bacteria 1602
179 Ga0207681_10136187 3300025923 Bacteria 1823
180 Ga0207694_10982666 3300025924 Bacteria 714
181 Ga0207687_10015664 3300025927 Bacteria 4975
182 Ga0207700_10030207 3300025928 Bacteria 3834
183 Ga0207664_10000002 3300025929 Bacteria 657053
184 Ga0207664_10132278 3300025929 Bacteria 2101
185 Ga0207664_11715192 3300025929 Bacteria 550
186 Ga0207644_10047387 3300025931 Bacteria 3067
187 Ga0207690_10376609 3300025932 Bacteria 1127
188 Ga0207706_10053245 3300025933 Bacteria 3573
189 Ga0207686_10137304 3300025934 Bacteria 1685
190 Ga0207709_10238994 3300025935 Unclassified 1320
191 Ga0207669_10086276 3300025937 Bacteria 2029
192 Ga0207704_10104619 3300025938 Bacteria 1896
193 Ga0207665_10028486 3300025939 Bacteria 3689
194 Ga0207691_10230817 3300025940 Bacteria 1603
195 Ga0207689_10107318 3300025942 Bacteria 2295
196 Ga0207661_10115143 3300025944 Bacteria 2281
197 Ga0207661_10510200 3300025944 Bacteria 1099
198 Ga0207661_10824874 3300025944 Bacteria 854
199 Ga0207667_10012701 3300025949 Bacteria 9678
200 Ga0207667_10055993 3300025949 Bacteria 4144
201 Ga0207667_10092373 3300025949 Bacteria 3126
202 Ga0207667_10586968 3300025949 Bacteria 1124
203 Ga0207667_10684468 3300025949 Bacteria 1029
204 Ga0207667_10767905 3300025949 Bacteria 962
205 Ga0207651_10699775 3300025960 Bacteria 893
206 Ga0207712_10016242 3300025961 Bacteria 4817
207 Ga0207712_10084354 3300025961 Bacteria 2321
208 Ga0207668_10012629 3300025972 Bacteria 5177
209 Ga0207668_10019299 3300025972 Bacteria 4307
210 Ga0207640_10790493 3300025981 Bacteria 821
211 Ga0207658_10003360 3300025986 Bacteria 11344
212 Ga0207658_10489789 3300025986 Bacteria 1094
213 Ga0207677_10015866 3300026023 Bacteria 4445
214 Ga0207677_10256395 3300026023 Bacteria 1423
215 Ga0207703_10006250 3300026035 Bacteria 9525
216 Ga0207703_10089282 3300026035 Bacteria 2588
217 Ga0207639_10341699 3300026041 Bacteria 1335
218 Ga0207678_10032027 3300026067 Bacteria 4583
219 Ga0207708_10000062 3300026075 Bacteria 89274
220 Ga0207702_10056895 3300026078 Bacteria 3321
221 Ga0207702_10140307 3300026078 Bacteria 2186
222 Ga0207702_10180692 3300026078 Bacteria 1943
223 Ga0207702_10377601 3300026078 Bacteria 1362
224 Ga0207641_10003448 3300026088 Bacteria 14004
225 Ga0207641_10303758 3300026088 Bacteria 1508
226 Ga0207648_10458297 3300026089 Bacteria 1162
227 Ga0207676_11026025 3300026095 Bacteria 813
228 Ga0207675_100061300 3300026118 Bacteria 3512
229 Ga0207683_10011092 3300026121 Bacteria 7680
230 Ga0207683_10135225 3300026121 Unclassified 2219
231 Ga0207698_10009431 3300026142 Bacteria 6225
232 Ga0207698_10122344 3300026142 Bacteria 2205
233 Ga0207698_12156789 3300026142 Bacteria 570
234 Ga0268266_10000281 3300028379 Bacteria 83806
235 Ga0268266_10389593 3300028379 Bacteria 1316
236 Ga0268265_11554303 3300028380 Bacteria 666
237 Ga0268264_10000033 3300028381 Bacteria 404123
238 Ga0268264_10167227 3300028381 Bacteria 1986
239 Ga0373928_0009907 3300035084 Bacteria 1866
240 Ga0373929_0047915 3300035085 Bacteria 969
241 Ga0373940_0021793 3300035088 Bacteria 1641
242 Ga0373949_0016437 3300035090 Bacteria 1659
243 Ga0373952_0037609 3300035092 Bacteria 1105
244 Ga0373932_0005504 3300035112 Bacteria 2980
245 Ga0373941_0017260 3300035115 Bacteria 1975
246 Ga0373960_0032804 3300035121 Bacteria 1460
247 Ga0373946_0722262 3300035171 Bacteria 522
248 Ga0373942_0026028 3300035207 Bacteria 1512
249 Ga0373931_0006252 3300035691 Bacteria 5554
250 Ga0436364_0767630 3300037853 Bacteria 4459
251 Ga0436363_0937559 3300039450 Bacteria 674
252 Ga0451789_1121063 3300041443 Unclassified 2045
253 Ga0451791_1150515 3300041451 Bacteria 5288
254 Ga0451793_0031402 3300041452 Bacteria 7330
255 Ga0451795_0845638 3300041456 Unclassified 2475
256 Ga0451837_1867714 3300041494 Unclassified 2024
257 Ga0451839_0348422 3300041496 Bacteria 1866
258 Ga0451841_1078032 3300041498 Unclassified 2486
259 Ga0451855_1164541 3300041511 Bacteria 776
260 Ga0451853_1246420 3300041512 Unclassified 2124
261 Ga0466969_0194358 3300044656 Bacteria 926
262 Ga0466972_0013419 3300044658 Bacteria 4114
263 Ga0466972_0121091 3300044658 Bacteria 1234
264 Ga0466972_0614541 3300044658 Bacteria 514
265 Ga0466972_0630470 3300044658 Bacteria 507
266 Ga0466965_0041079 3300044683 Bacteria 2278
267 Ga0466966_0019498 3300044684 Bacteria 4462
268 Ga0466966_0081197 3300044684 Bacteria 2019
269 Ga0466966_0137638 3300044684 Bacteria 1493
270 Ga0466966_0636755 3300044684 Bacteria 642
271 Ga0466966_0655708 3300044684 Bacteria 632
272 Ga0466961_0030895 3300044693 Bacteria 3442
273 Ga0466961_0035556 3300044693 Bacteria 3199
274 Ga0466961_0123571 3300044693 Bacteria 1624
275 Ga0466961_0138863 3300044693 Bacteria 1522
276 Ga0466961_0156440 3300044693 Bacteria 1422
277 Ga0466961_0307136 3300044693 Bacteria 968
278 Ga0466963_0023065 3300044694 Bacteria 3947
279 Ga0466963_0040529 3300044694 Bacteria 3053
280 Ga0466963_0077823 3300044694 Bacteria 2241
281 Ga0466963_0094081 3300044694 Bacteria 2043
282 Ga0466963_0327024 3300044694 Bacteria 1079
283 Ga0466963_0442873 3300044694 Bacteria 917
284 Ga0466963_0611494 3300044694 Bacteria 769
285 Ga0466964_0008772 3300044706 Bacteria 3801
286 Ga0466964_0045372 3300044706 Bacteria 1788
287 Ga0466964_0212426 3300044706 Bacteria 935
288 Ga0466964_0358389 3300044706 Bacteria 751
289 Ga0466964_0479136 3300044706 Bacteria 665
290 Ga0466971_0105431 3300044719 Bacteria 1298
291 Ga0466971_0191313 3300044719 Bacteria 964
292 Ga0466968_0107076 3300044735 Bacteria 1254
293 Ga0466968_0374590 3300044735 Bacteria 695
294 Ga0466968_0502220 3300044735 Bacteria 604
295 Ga0466968_0516471 3300044735 Bacteria 596
296 Ga0466970_0086692 3300044765 Bacteria 1697
297 Ga0466957_0083041 3300044842 Bacteria 1997
298 Ga0466957_0115120 3300044842 Bacteria 1709
299 Ga0466957_0301982 3300044842 Bacteria 1076
300 Ga0466957_0313588 3300044842 Bacteria 1057
301 Ga0466957_0420542 3300044842 Bacteria 917
302 Ga0466957_0590176 3300044842 Bacteria 777
303 Ga0466957_1296778 3300044842 Bacteria 528
304 Ga0466957_1429796 3300044842 Bacteria 504
305 Ga0466960_0043398 3300044901 Bacteria 2138
306 Ga0466960_0694342 3300044901 Bacteria 610
307 Ga0466960_0953141 3300044901 Bacteria 525
308 Ga0466959_0014346 3300045049 Bacteria 5752
309 Ga0466959_0346500 3300045049 Bacteria 1013
310 Ga0466959_0491395 3300045049 Bacteria 830
311 Ga0466959_0662706 3300045049 Bacteria 700
312 Ga0466959_1149144 3300045049 Bacteria 516
313 Ga0466958_0008021 3300045836 Bacteria 5839
314 Ga0466958_0017433 3300045836 Bacteria 4151
315 Ga0466958_0022235 3300045836 Bacteria 3713
316 Ga0466958_0377304 3300045836 Bacteria 914
317 Ga0466958_0584883 3300045836 Bacteria 726
318 Ga0466967_0001625 3300045976 Bacteria 13273
319 Ga0466967_0002579 3300045976 Bacteria 11378
320 Ga0466967_0007968 3300045976 Bacteria 7708
321 Ga0466967_0068712 3300045976 Bacteria 3164
322 Ga0466967_0112289 3300045976 Bacteria 2505
323 Ga0466967_0131244 3300045976 Bacteria 2326
324 Ga0466967_0155383 3300045976 Bacteria 2142
325 Ga0466967_0276164 3300045976 Bacteria 1611
326 Ga0466967_0325055 3300045976 Bacteria 1484
327 Ga0466967_0329502 3300045976 Bacteria 1474
328 Ga0466967_0420265 3300045976 Bacteria 1303
329 Ga0466967_0458014 3300045976 Bacteria 1247
330 Ga0495588_0269606 3300046674 Bacteria 897
331 Ga0495624_0019771 3300046690 Bacteria 4489
332 Ga0496100_0421444 3300048903 Bacteria 1019
333 Ga0496101_0082949 3300048904 Bacteria 2372
334 Ga0496101_0582803 3300048904 Bacteria 884
335 Ga0496102_0000059 3300048905 Bacteria 168633
336 Ga0496102_0001260 3300048905 Bacteria 22839
337 Ga0496102_0138736 3300048905 Bacteria 2279
338 Ga0496102_0215042 3300048905 Bacteria 1812
339 Ga0496102_0312032 3300048905 Bacteria 1482
340 Ga0496102_0532421 3300048905 Bacteria 1097
341 Ga0496102_1011011 3300048905 Bacteria 752
342 Ga0496103_0000063 3300048906 Bacteria 128503
343 Ga0496103_0052714 3300048906 Bacteria 2520
344 Ga0496103_0271750 3300048906 Bacteria 1090
345 Ga0496103_0409368 3300048906 Bacteria 871
346 Ga0496104_0064876 3300048907 Bacteria 3464
347 Ga0496104_0212117 3300048907 Bacteria 1848
348 Ga0496104_0250751 3300048907 Bacteria 1683
349 Ga0496104_1139276 3300048907 Bacteria 683
350 Ga0496105_0006452 3300048908 Bacteria 9018
351 Ga0496108_0012673 3300048911 Bacteria 6869
352 Ga0496108_0105761 3300048911 Bacteria 2403
353 Ga0496108_0416741 3300048911 Bacteria 1173
354 Ga0496109_0015398 3300048912 Bacteria 6663
355 Ga0496109_0133617 3300048912 Bacteria 2317
356 Ga0496109_0141700 3300048912 Bacteria 2248
357 Ga0496109_0292263 3300048912 Bacteria 1536
358 Ga0496110_0013378 3300048913 Bacteria 6782
359 Ga0496110_0018973 3300048913 Bacteria 5779
360 Ga0496110_0489414 3300048913 Bacteria 1120
361 Ga0496111_0084690 3300048914 Unclassified 2318
362 Ga0496111_0285737 3300048914 Bacteria 1223
363 Ga0496112_0041649 3300048915 Bacteria 4493
364 Ga0496113_0025908 3300048916 Bacteria 4187
365 Ga0496113_0984444 3300048916 Bacteria 665
366 Ga0496114_0054504 3300048917 Bacteria 3334
367 Ga0496114_0192629 3300048917 Bacteria 1784
368 Ga0496115_0046118 3300048918 Bacteria 3482
369 Ga0496115_0046419 3300048918 Bacteria 3471
370 Ga0496115_0129130 3300048918 Bacteria 2083
371 Ga0496117_0197397 3300048920 Bacteria 1140
372 Ga0496118_0009378 3300048921 Bacteria 9903
373 Ga0496118_0048939 3300048921 Bacteria 3259
374 Ga0496118_0154834 3300048921 Bacteria 1428
375 Ga0496119_0000153 3300048922 Bacteria 95945
376 Ga0496119_0067381 3300048922 Bacteria 2111
377 Ga0496120_0002612 3300048923 Bacteria 17853
378 Ga0496126_0094233 3300048929 Bacteria 2628
379 Ga0501043_0848042 3300049579 Bacteria 658
380 Ga0501047_0491451 3300049581 Bacteria 1054
381 Ga0501073_0898097 3300049589 Bacteria 610
382 Ga0501074_1286658 3300049590 Bacteria 512
383 Ga0501079_1446182 3300049741 Bacteria 541
384 Ga0501035_0084150 3300049822 Bacteria 2806
385 nmdc:mga0rr50_502869_c1 3300050513 Bacteria 1031
386 nmdc:mga0a205_593815_c1 3300050515 Bacteria 961
387 Ga0466962_0018115 3300061719 Bacteria 3387
388 Ga0466962_0083244 3300061719 Bacteria 1530
389 Ga0466962_0130939 3300061719 Bacteria 1212
390 Ga0466962_0376200 3300061719 Bacteria 709
391 Ga0466958_0169531
392 Ga0070676_10586796
393 Ga0070690_100247909
394 Ga0068869_100016509
395 Ga0070666_10002575
396 Ga0070680_100845912
397 Ga0070682_100037784
398 Ga0070682_100163084
399 Ga0068868_100030935
400 Ga0068868_100309707
401 Ga0070660_100125146
402 Ga0070660_100479940
403 Ga0070691_10011781
404 Ga0070687_100026373
405 Ga0070661_100403682
406 Ga0070661_101121027
407 Ga0070692_10093061
408 Ga0070668_100175395
409 Ga0070669_100072785
410 Ga0070671_100010993
411 Ga0070674_100109119
412 Ga0070667_101827872
413 Ga0070703_10029994
414 Ga0070709_10021724
415 Ga0070714_100000008
416 Ga0070714_100071446
417 Ga0070714_100114696
418 Ga0070714_101882043
419 Ga0070701_10310864
420 Ga0070705_100032867
421 Ga0070700_100000012
422 Ga0070694_100016279
423 Ga0070663_100034095
424 Ga0070663_101877866
425 Ga0070678_100026227
426 Ga0070678_100197876
427 Ga0070681_10244397
428 Ga0070685_10071501
429 Ga0070707_100670358
430 Ga0070698_101024983
431 Ga0070684_100078779
432 Ga0070697_100061402
433 Ga0068853_100511496
434 Ga0070672_100774783
435 Ga0070686_100029933
436 Ga0070695_100010148
437 Ga0070696_100061622
438 Ga0070693_100158495
439 Ga0070665_100002494
440 Ga0070665_100345646
441 Ga0070665_100614101
442 Ga0070704_100030429
443 Ga0068855_100056412
444 Ga0068855_100135527
445 Ga0068855_100212504
446 Ga0068855_100581793
447 Ga0070664_100408263
448 Ga0068854_100030109
449 Ga0068856_100018351
450 Ga0068856_100196927
451 Ga0068856_100288368
452 Ga0068856_100469246
453 Ga0070702_100001526
454 Ga0068852_100024980
455 Ga0068852_100158540
456 Ga0068852_100215576
457 Ga0068852_101016674
458 Ga0068859_100006354
459 Ga0068859_100081388
460 Ga0068864_100051276
461 Ga0068861_100861192
462 Ga0068870_10041570
463 Ga0068863_100002894
464 Ga0068863_100108936
465 Ga0068858_100004333
466 Ga0068858_100159238
467 Ga0068860_100000017
468 Ga0068862_100312220
469 Ga0081455_10010165
470 Ga0081540_1002807
471 Ga0081540_1066400
472 Ga0081540_1189829
473 Ga0070717_10210807
474 Ga0070717_11183178
475 Ga0075432_10059425
476 Ga0070715_10307104
477 Ga0070716_100019737
478 Ga0070712_100060740
479 Ga0097621_100222450
480 Ga0068871_100064497
481 Ga0075433_10067675
482 Ga0075434_100052774
483 Ga0068865_100044542
484 Ga0097620_100006354
485 Ga0097620_100081391
486 Ga0075435_100762988
487 Ga0105251_10088809
488 Ga0105250_10267003
489 Ga0105240_10157161
490 Ga0105240_10290711
491 Ga0111539_10052945
492 Ga0105245_10074023
493 Ga0105245_10106229
494 Ga0105245_10114352
495 Ga0105245_11505971
496 Ga0105247_10001103
497 Ga0105247_10016648
498 Ga0105243_10174683
499 Ga0105243_10771479
500 Ga0105241_10075065
501 Ga0105241_10993560
502 Ga0105241_11166737
503 Ga0105242_10050493
504 Ga0105248_10201243
505 Ga0105248_10433139
506 Ga0105248_10905006
507 Ga0105237_10016070
508 Ga0105237_10030758
509 Ga0105237_10581670
510 Ga0105237_11010370
511 Ga0105237_12597282
512 Ga0105249_10008544
513 Ga0105249_10057537
514 Ga0105249_11052392
515 Ga0105239_10042552
516 Ga0105239_10120511
517 Ga0105239_10408670
518 Ga0105246_10066533
519 Ga0157373_10364662
520 Ga0157371_10316564
521 Ga0157370_10079506
522 Ga0157369_10489930
523 Ga0157369_10778411
524 Ga0157369_11610324
525 Ga0157374_10115335
526 Ga0157374_10221955
527 Ga0157374_11015491
528 Ga0157372_10783887
529 Ga0157375_11006253
530 Ga0163163_10066534
531 Ga0163163_11117331
532 Ga0182008_10068972
533 Ga0157377_10172256
534 Ga0157379_10013820
535 Ga0157379_10065934
536 Ga0157376_10819726
537 Ga0157376_10876075
538 Ga0157376_10951367
539 Ga0163161_10052023
540 Ga0197907_10000035
541 Ga0206353_10449831
542 Ga0206353_11666821
543 Ga0213875_10017901
544 Ga0207653_10035281
545 Ga0207692_10571727
546 Ga0207692_10925456
547 Ga0207710_10067864
548 Ga0207688_10011310
549 Ga0207680_10027850
550 Ga0207647_10056948
551 Ga0207647_10077726
552 Ga0207647_10278060
553 Ga0207647_10280351
554 Ga0207699_10364810
555 Ga0207643_10040526
556 Ga0207705_10031121
557 Ga0207654_10047150
558 Ga0207654_10151550
559 Ga0207654_11154120
560 Ga0207695_11290942
561 Ga0207671_10028572
562 Ga0207671_10470617
563 Ga0207671_10592046
564 Ga0207671_11212429
565 Ga0207693_10002350
566 Ga0207663_10823084
567 Ga0207660_10993971
568 Ga0207657_10201278
569 Ga0207681_10136187
570 Ga0207694_10982666
571 Ga0207687_10015664
572 Ga0207700_10030207
573 Ga0207664_10000002
574 Ga0207664_10132278
575 Ga0207664_11715192
576 Ga0207644_10047387
577 Ga0207690_10376609
578 Ga0207706_10053245
579 Ga0207686_10137304
580 Ga0207709_10238994
581 Ga0207669_10086276
582 Ga0207704_10104619
583 Ga0207665_10028486
584 Ga0207691_10230817
585 Ga0207689_10107318
586 Ga0207661_10115143
587 Ga0207661_10510200
588 Ga0207661_10824874
589 Ga0207667_10012701
590 Ga0207667_10055993
591 Ga0207667_10092373
592 Ga0207667_10586968
593 Ga0207667_10684468
594 Ga0207667_10767905
595 Ga0207651_10699775
596 Ga0207712_10016242
597 Ga0207712_10084354
598 Ga0207668_10012629
599 Ga0207668_10019299
600 Ga0207640_10790493
601 Ga0207658_10003360
602 Ga0207658_10489789
603 Ga0207677_10015866
604 Ga0207677_10256395
605 Ga0207703_10006250
606 Ga0207703_10089282
607 Ga0207639_10341699
608 Ga0207678_10032027
609 Ga0207708_10000062
610 Ga0207702_10056895
611 Ga0207702_10140307
612 Ga0207702_10180692
613 Ga0207702_10377601
614 Ga0207641_10003448
615 Ga0207641_10303758
616 Ga0207648_10458297
617 Ga0207676_11026025
618 Ga0207675_100061300
619 Ga0207683_10011092
620 Ga0207683_10135225
621 Ga0207698_10009431
622 Ga0207698_10122344
623 Ga0207698_12156789
624 Ga0268266_10000281
625 Ga0268266_10389593
626 Ga0268265_11554303
627 Ga0268264_10000033
628 Ga0268264_10167227
629 Ga0373928_0009907
630 Ga0373929_0047915
631 Ga0373940_0021793
632 Ga0373949_0016437
633 Ga0373952_0037609
634 Ga0373932_0005504
635 Ga0373941_0017260
636 Ga0373960_0032804
637 Ga0373946_0722262
638 Ga0373942_0026028
639 Ga0373931_0006252
640 Ga0436364_0767630
641 Ga0436363_0937559
642 Ga0451789_1121063
643 Ga0451791_1150515
644 Ga0451793_0031402
645 Ga0451795_0845638
646 Ga0451837_1867714
647 Ga0451839_0348422
648 Ga0451841_1078032
649 Ga0451855_1164541
650 Ga0451853_1246420
651 Ga0466969_0194358
652 Ga0466972_0013419
653 Ga0466972_0121091
654 Ga0466972_0614541
655 Ga0466972_0630470
656 Ga0466965_0041079
657 Ga0466966_0019498
658 Ga0466966_0081197
659 Ga0466966_0137638
660 Ga0466966_0636755
661 Ga0466966_0655708
662 Ga0466961_0030895
663 Ga0466961_0035556
664 Ga0466961_0123571
665 Ga0466961_0138863
666 Ga0466961_0156440
667 Ga0466961_0307136
668 Ga0466963_0023065
669 Ga0466963_0040529
670 Ga0466963_0077823
671 Ga0466963_0094081
672 Ga0466963_0327024
673 Ga0466963_0442873
674 Ga0466963_0611494
675 Ga0466964_0008772
676 Ga0466964_0045372
677 Ga0466964_0212426
678 Ga0466964_0358389
679 Ga0466964_0479136
680 Ga0466971_0105431
681 Ga0466971_0191313
682 Ga0466968_0107076
683 Ga0466968_0374590
684 Ga0466968_0502220
685 Ga0466968_0516471
686 Ga0466970_0086692
687 Ga0466957_0083041
688 Ga0466957_0115120
689 Ga0466957_0301982
690 Ga0466957_0313588
691 Ga0466957_0420542
692 Ga0466957_0590176
693 Ga0466957_1296778
694 Ga0466957_1429796
695 Ga0466960_0043398
696 Ga0466960_0694342
697 Ga0466960_0953141
698 Ga0466959_0014346
699 Ga0466959_0346500
700 Ga0466959_0491395
701 Ga0466959_0662706
702 Ga0466959_1149144
703 Ga0466958_0008021
704 Ga0466958_0017433
705 Ga0466958_0022235
706 Ga0466958_0377304
707 Ga0466958_0584883
708 Ga0466967_0001625
709 Ga0466967_0002579
710 Ga0466967_0007968
711 Ga0466967_0068712
712 Ga0466967_0112289
713 Ga0466967_0131244
714 Ga0466967_0155383
715 Ga0466967_0276164
716 Ga0466967_0325055
717 Ga0466967_0329502
718 Ga0466967_0420265
719 Ga0466967_0458014
720 Ga0495588_0269606
721 Ga0495624_0019771
722 Ga0496100_0421444
723 Ga0496101_0082949
724 Ga0496101_0582803
725 Ga0496102_0000059
726 Ga0496102_0001260
727 Ga0496102_0138736
728 Ga0496102_0215042
729 Ga0496102_0312032
730 Ga0496102_0532421
731 Ga0496102_1011011
732 Ga0496103_0000063
733 Ga0496103_0052714
734 Ga0496103_0271750
735 Ga0496103_0409368
736 Ga0496104_0064876
737 Ga0496104_0212117
738 Ga0496104_0250751
739 Ga0496104_1139276
740 Ga0496105_0006452
741 Ga0496108_0012673
742 Ga0496108_0105761
743 Ga0496108_0416741
744 Ga0496109_0015398
745 Ga0496109_0133617
746 Ga0496109_0141700
747 Ga0496109_0292263
748 Ga0496110_0013378
749 Ga0496110_0018973
750 Ga0496110_0489414
751 Ga0496111_0084690
752 Ga0496111_0285737
753 Ga0496112_0041649
754 Ga0496113_0025908
755 Ga0496113_0984444
756 Ga0496114_0054504
757 Ga0496114_0192629
758 Ga0496115_0046118
759 Ga0496115_0046419
760 Ga0496115_0129130
761 Ga0496117_0197397
762 Ga0496118_0009378
763 Ga0496118_0048939
764 Ga0496118_0154834
765 Ga0496119_0000153
766 Ga0496119_0067381
767 Ga0496120_0002612
768 Ga0496126_0094233
769 Ga0501043_0848042
770 Ga0501047_0491451
771 Ga0501073_0898097
772 Ga0501074_1286658
773 Ga0501079_1446182
774 Ga0501035_0084150
775 nmdc:mga0rr50_502869_c1
776 nmdc:mga0a205_593815_c1
777 Ga0466962_0018115
778 Ga0466962_0083244
779 Ga0466962_0130939
780 Ga0466962_0376200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

31

110

0.89

PF13279

4HBT_2

Thioesterase-like superfamily

23

137

0.87

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

11

81

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9419 4 105
2egi-assembly2.cif.gz_I crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9281 4 108
2oaf-assembly1.cif.gz_B crystal structure of thioesterase superfamily (yp_508616.1) from jannaschia sp. ccs1 at 2.00 a resolution 0.9159 2 130
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9092 4 125
2cye-assembly3.cif.gz_B crystal structure of thioesterase complexed with coenzyme a and zn from thermus thermophilus hb8 0.9083 5 128
ID Description Score Start End Superfamily
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9419 4 105 3.10.129.10
2oafA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9096 2 130 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9049 4 105 3.10.129.10
af_I6Y9E8_2_136_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8998 1 128 3.10.129.10
4gwhA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8971 49 105 2.40.160.210
ID Description Score Start End GO Terms
AF-A0A1M5PLN5-F1-model_v4 Acyl-CoA thioester hydrolase 0.9763 1 131 GO:0047617
AF-A0A4D4LXZ2-F1-model_v4 Uncharacterized protein 0.9747 51 131
AF-A0A1S8C5G7-F1-model_v4 Thioesterase 0.9653 3 131 GO:0047617
AF-A0A7W0JD07-F1-model_v4 Acyl-CoA thioesterase 0.9612 45 131
AF-S2WLC1-F1-model_v4 YbgC/YbaW family acyl-CoA thioester hydrolase 0.9597 3 130 GO:0047617

Map