F431745

General Info

Members Datasets Scaffolds Average Seq Length
390 189 780 317

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10036783|Ga0207695_100367832
Length 361
Sequence MPARLDFADEGTALSGLEPVEQALPPGTARGVIAVRCYPRNFMPDFDVLGIGLNATDTLILVSHFPAYAGKVAFEDEILSPGGQVASAMATCARLGLRVKYIGTVGDDERARIQMDSLRETGIDLSDVEIREGCPNQTAYILIDQSTGERTVLWRRLDCLRLDPSSITPEKITRARLLHIDGHDTPAVARAAEIARKHSIPVTVDVDTIYHGFDRVLPNVDYLVASSEFPLQWTSERDPFKALELIQEEYKIPVAAMTLGAHGALARVGERFIYSPAFVVNCVDTTGAGDVFHGAFCYSVLQKMTIAEALEFSNAMAALNCTRIGARGGIATVEAARALMERAERRPLKDFEQRVAGRAGS

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.28
Rhizosphere 97.18
Stem 0
Stem Tuber 0
Unclassified 19.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10036783 3300025913 Bacteria 5288
2 Ga0070658_10263814 3300005327 Unclassified 1463
3 Ga0070658_10404913 3300005327 Bacteria 1172
4 Ga0070683_100000011 3300005329 Bacteria 283682
5 Ga0070683_100002992 3300005329 Bacteria 13560
6 Ga0070683_100101881 3300005329 Bacteria 2704
7 Ga0070683_100185019 3300005329 Bacteria 1977
8 Ga0070683_100284216 3300005329 Unclassified 1574
9 Ga0070683_100319467 3300005329 Bacteria 1478
10 Ga0070690_100005421 3300005330 Bacteria 7165
11 Ga0070670_100339516 3300005331 Bacteria 1318
12 Ga0068869_100028075 3300005334 Unclassified 3928
13 Ga0070680_100004118 3300005336 Bacteria 10892
14 Ga0070680_100017373 3300005336 Bacteria 5672
15 Ga0070680_100430311 3300005336 Unclassified 1126
16 Ga0068868_100503099 3300005338 Unclassified 1062
17 Ga0070660_100019795 3300005339 Bacteria 4937
18 Ga0070689_100308023 3300005340 Bacteria 1320
19 Ga0070691_10001029 3300005341 Bacteria 11450
20 Ga0070661_100015712 3300005344 Bacteria 5344
21 Ga0070661_100087447 3300005344 Bacteria 2305
22 Ga0070675_100423223 3300005354 Bacteria 1191
23 Ga0070673_100045611 3300005364 Bacteria 3400
24 Ga0070673_100105473 3300005364 Unclassified 2328
25 Ga0070659_100097426 3300005366 Unclassified 2364
26 Ga0070659_100222201 3300005366 Bacteria 1559
27 Ga0070659_100255433 3300005366 Bacteria 1453
28 Ga0070667_100164164 3300005367 Unclassified 1958
29 Ga0070709_10107059 3300005434 Bacteria 1873
30 Ga0070714_100001081 3300005435 Bacteria 19492
31 Ga0070713_100001090 3300005436 Bacteria 17386
32 Ga0070713_100005675 3300005436 Bacteria 8565
33 Ga0070713_100031319 3300005436 Bacteria 4236
34 Ga0070713_100283614 3300005436 Bacteria 1520
35 Ga0070710_10162734 3300005437 Bacteria 1385
36 Ga0070711_100007343 3300005439 Bacteria 6707
37 Ga0070711_100035120 3300005439 Bacteria 3349
38 Ga0070711_100091998 3300005439 Unclassified 2188
39 Ga0070678_100365672 3300005456 Bacteria 1244
40 Ga0070662_100027781 3300005457 Unclassified 3933
41 Ga0070662_100399564 3300005457 Unclassified 1134
42 Ga0070681_10011198 3300005458 Bacteria 8874
43 Ga0070681_10011385 3300005458 Bacteria 8801
44 Ga0070681_10250709 3300005458 Unclassified 1683
45 Ga0068867_100094320 3300005459 Unclassified 2275
46 Ga0068867_100261889 3300005459 Bacteria 1410
47 Ga0070679_100001176 3300005530 Bacteria 22920
48 Ga0070679_100189508 3300005530 Bacteria 2026
49 Ga0070684_100000001 3300005535 Bacteria 300240
50 Ga0070684_100006209 3300005535 Bacteria 9221
51 Ga0070684_100097169 3300005535 Bacteria 2626
52 Ga0070684_100182466 3300005535 Unclassified 1908
53 Ga0070684_100594324 3300005535 Bacteria 1029
54 Ga0070697_100077178 3300005536 Bacteria 2740
55 Ga0070695_100114868 3300005545 Bacteria 1833
56 Ga0070696_100014592 3300005546 Bacteria 5274
57 Ga0070693_100071314 3300005547 Bacteria 2047
58 Ga0070693_100219184 3300005547 Unclassified 1246
59 Ga0068855_100025432 3300005563 Bacteria 7083
60 Ga0068855_100031293 3300005563 Bacteria 6355
61 Ga0068855_100041465 3300005563 Bacteria 5455
62 Ga0068855_100051450 3300005563 Unclassified 4852
63 Ga0068855_100058965 3300005563 Bacteria 4493
64 Ga0068855_100246481 3300005563 Bacteria 1994
65 Ga0070664_100012931 3300005564 Bacteria 6790
66 Ga0068857_100000835 3300005577 Bacteria 23082
67 Ga0068857_100068354 3300005577 Bacteria 3162
68 Ga0068854_100019641 3300005578 Unclassified 4557
69 Ga0068856_100011585 3300005614 Bacteria 8553
70 Ga0068856_100024576 3300005614 Bacteria 5865
71 Ga0068856_100038790 3300005614 Bacteria 4676
72 Ga0068856_100061218 3300005614 Bacteria 3718
73 Ga0068856_100327466 3300005614 Unclassified 1550
74 Ga0068852_100011087 3300005616 Bacteria 6768
75 Ga0068852_100022873 3300005616 Bacteria 5022
76 Ga0068852_100132471 3300005616 Unclassified 2297
77 Ga0068852_100185682 3300005616 Unclassified 1958
78 Ga0068863_100031591 3300005841 Bacteria 5052
79 Ga0068858_100150107 3300005842 Bacteria 2191
80 Ga0068860_100016132 3300005843 Bacteria 7289
81 Ga0068860_100219383 3300005843 Unclassified 1847
82 Ga0070717_10046322 3300006028 Unclassified 3558
83 Ga0070712_100137611 3300006175 Bacteria 1859
84 Ga0097621_100005098 3300006237 Bacteria 9223
85 Ga0068871_100022727 3300006358 Unclassified 4839
86 Ga0068871_100082499 3300006358 Unclassified 2666
87 Ga0075428_100102003 3300006844 Unclassified 3128
88 Ga0075430_100238698 3300006846 Bacteria 1506
89 Ga0075430_100410569 3300006846 Unclassified 1118
90 Ga0075431_100002094 3300006847 Bacteria 19059
91 Ga0075431_100078126 3300006847 Bacteria 3416
92 Ga0075429_100237493 3300006880 Unclassified 1596
93 Ga0075436_100007299 3300006914 Bacteria 7556
94 Ga0105240_10005180 3300009093 Bacteria 19500
95 Ga0105240_10012343 3300009093 Bacteria 11798
96 Ga0105240_10024864 3300009093 Bacteria 7884
97 Ga0105240_10030746 3300009093 Bacteria 6975
98 Ga0105240_10033686 3300009093 Bacteria 6615
99 Ga0105240_10048683 3300009093 Bacteria 5355
100 Ga0105240_10078990 3300009093 Unclassified 4051
101 Ga0105240_10089308 3300009093 Bacteria 3769
102 Ga0105240_10112271 3300009093 Bacteria 3295
103 Ga0105240_10117286 3300009093 Unclassified 3210
104 Ga0105240_10360166 3300009093 Bacteria 1648
105 Ga0111539_10022437 3300009094 Bacteria 7756
106 Ga0105245_10005191 3300009098 Bacteria 11435
107 Ga0105245_10005364 3300009098 Bacteria 11262
108 Ga0105245_10052706 3300009098 Bacteria 3649
109 Ga0105245_10064061 3300009098 Bacteria 3322
110 Ga0105245_10076652 3300009098 Bacteria 3046
111 Ga0105245_10111599 3300009098 Unclassified 2543
112 Ga0105243_10049508 3300009148 Bacteria 3315
113 Ga0105243_10242546 3300009148 Bacteria 1604
114 Ga0105241_10005977 3300009174 Bacteria 8978
115 Ga0105241_10088826 3300009174 Unclassified 2434
116 Ga0105242_10017683 3300009176 Bacteria 5561
117 Ga0105242_10098608 3300009176 Bacteria 2471
118 Ga0105242_10225037 3300009176 Bacteria 1679
119 Ga0105242_10329581 3300009176 Unclassified 1403
120 Ga0105242_10428261 3300009176 Bacteria 1242
121 Ga0105248_10007425 3300009177 Bacteria 12028
122 Ga0105248_10114949 3300009177 Bacteria 3035
123 Ga0105248_10120751 3300009177 Bacteria 2956
124 Ga0105248_10129925 3300009177 Bacteria 2842
125 Ga0105248_10244347 3300009177 Bacteria 2020
126 Ga0105237_10015533 3300009545 Bacteria 7921
127 Ga0105237_10019976 3300009545 Bacteria 6916
128 Ga0105237_10061593 3300009545 Bacteria 3751
129 Ga0105237_10264872 3300009545 Bacteria 1722
130 Ga0105238_10008318 3300009551 Bacteria 10376
131 Ga0105238_10023711 3300009551 Bacteria 6254
132 Ga0105238_10033397 3300009551 Bacteria 5237
133 Ga0105238_10039428 3300009551 Bacteria 4790
134 Ga0105238_10089607 3300009551 Bacteria 3063
135 Ga0105249_10017530 3300009553 Bacteria 6359
136 Ga0105239_10011983 3300010375 Bacteria 9668
137 Ga0105239_10026387 3300010375 Bacteria 6393
138 Ga0105239_10088342 3300010375 Unclassified 3418
139 Ga0105239_10228218 3300010375 Unclassified 2089
140 Ga0105246_10000753 3300011119 Bacteria 18477
141 Ga0105246_10109690 3300011119 Unclassified 2025
142 Ga0157373_10062721 3300013100 Bacteria 2632
143 Ga0157370_10017800 3300013104 Bacteria 7161
144 Ga0157370_10065616 3300013104 Bacteria 3434
145 Ga0157369_10003629 3300013105 Bacteria 18314
146 Ga0157369_10003773 3300013105 Bacteria 18011
147 Ga0157369_10067233 3300013105 Bacteria 3854
148 Ga0157369_10172584 3300013105 Bacteria 2278
149 Ga0157374_10010786 3300013296 Bacteria 7879
150 Ga0157374_10072114 3300013296 Bacteria 3258
151 Ga0157374_10147442 3300013296 Unclassified 2286
152 Ga0157378_10000887 3300013297 Bacteria 27608
153 Ga0163162_10239784 3300013306 Bacteria 1944
154 Ga0163162_10463654 3300013306 Unclassified 1398
155 Ga0157372_10002788 3300013307 Bacteria 18879
156 Ga0157372_10034551 3300013307 Bacteria 5559
157 Ga0157372_10057624 3300013307 Bacteria 4343
158 Ga0157372_10098298 3300013307 Unclassified 3339
159 Ga0157372_10100926 3300013307 Bacteria 3294
160 Ga0157372_10261720 3300013307 Bacteria 2009
161 Ga0157375_10004544 3300013308 Bacteria 12055
162 Ga0157375_10148626 3300013308 Unclassified 2476
163 Ga0157375_10917530 3300013308 Unclassified 1019
164 Ga0163163_10046766 3300014325 Bacteria 4250
165 Ga0163163_10132128 3300014325 Bacteria 2537
166 Ga0163163_10191322 3300014325 Bacteria 2095
167 Ga0157379_10018960 3300014968 Bacteria 6073
168 Ga0157379_10133328 3300014968 Unclassified 2237
169 Ga0157376_10073842 3300014969 Unclassified 2905
170 Ga0157376_10364828 3300014969 Bacteria 1386
171 Ga0213875_10003781 3300021388 Bacteria 8520
172 Ga0207684_10191227 3300025910 Bacteria 1766
173 Ga0207654_10060930 3300025911 Bacteria 2206
174 Ga0207707_10004293 3300025912 Bacteria 12620
175 Ga0207707_10015348 3300025912 Bacteria 6671
176 Ga0207707_10268431 3300025912 Bacteria 1479
177 Ga0207695_10001639 3300025913 Bacteria 36154
178 Ga0207695_10002416 3300025913 Bacteria 27666
179 Ga0207695_10004208 3300025913 Bacteria 19770
180 Ga0207695_10009071 3300025913 Bacteria 12357
181 Ga0207695_10054251 3300025913 Unclassified 4187
182 Ga0207695_10060683 3300025913 Bacteria 3913
183 Ga0207695_10065662 3300025913 Unclassified 3730
184 Ga0207671_10009843 3300025914 Bacteria 7951
185 Ga0207671_10026863 3300025914 Bacteria 4307
186 Ga0207671_10141703 3300025914 Bacteria 1852
187 Ga0207671_10211710 3300025914 Unclassified 1516
188 Ga0207663_10104524 3300025916 Bacteria 1910
189 Ga0207660_10003120 3300025917 Bacteria 10837
190 Ga0207660_10012234 3300025917 Bacteria 5608
191 Ga0207657_10020025 3300025919 Bacteria 6337
192 Ga0207657_10058344 3300025919 Bacteria 3322
193 Ga0207657_10123740 3300025919 Bacteria 2126
194 Ga0207652_10008335 3300025921 Bacteria 8333
195 Ga0207652_10186657 3300025921 Bacteria 1864
196 Ga0207694_10001085 3300025924 Bacteria 23569
197 Ga0207694_10120514 3300025924 Bacteria 2094
198 Ga0207694_10125989 3300025924 Unclassified 2049
199 Ga0207659_10202142 3300025926 Bacteria 1588
200 Ga0207687_10001345 3300025927 Bacteria 16811
201 Ga0207687_10008491 3300025927 Bacteria 6714
202 Ga0207687_10066416 3300025927 Bacteria 2563
203 Ga0207687_10070042 3300025927 Unclassified 2503
204 Ga0207700_10003123 3300025928 Bacteria 9565
205 Ga0207700_10041124 3300025928 Bacteria 3380
206 Ga0207700_10060815 3300025928 Bacteria 2862
207 Ga0207664_10011470 3300025929 Bacteria 6303
208 Ga0207664_10040581 3300025929 Bacteria 3621
209 Ga0207664_10074563 3300025929 Bacteria 2742
210 Ga0207644_10088273 3300025931 Bacteria 2306
211 Ga0207690_10073023 3300025932 Unclassified 2371
212 Ga0207690_10106862 3300025932 Unclassified 2009
213 Ga0207690_10205370 3300025932 Bacteria 1499
214 Ga0207706_10102577 3300025933 Bacteria 2517
215 Ga0207686_10011531 3300025934 Bacteria 4843
216 Ga0207686_10021842 3300025934 Unclassified 3679
217 Ga0207686_10039377 3300025934 Bacteria 2868
218 Ga0207709_10077425 3300025935 Bacteria 2132
219 Ga0207711_10018491 3300025941 Bacteria 5795
220 Ga0207711_10033016 3300025941 Bacteria 4378
221 Ga0207711_10529283 3300025941 Unclassified 1099
222 Ga0207689_10019443 3300025942 Bacteria 5725
223 Ga0207661_10000016 3300025944 Bacteria 305159
224 Ga0207661_10021641 3300025944 Bacteria 4821
225 Ga0207661_10100568 3300025944 Unclassified 2427
226 Ga0207661_10369618 3300025944 Unclassified 1296
227 Ga0207667_10000483 3300025949 Bacteria 52728
228 Ga0207667_10028612 3300025949 Bacteria 6051
229 Ga0207667_10051591 3300025949 Bacteria 4335
230 Ga0207667_10100962 3300025949 Bacteria 2976
231 Ga0207667_10136411 3300025949 Bacteria 2527
232 Ga0207667_10144936 3300025949 Bacteria 2445
233 Ga0207667_10193605 3300025949 Bacteria 2086
234 Ga0207667_10206495 3300025949 Bacteria 2014
235 Ga0207667_10538835 3300025949 Bacteria 1181
236 Ga0207651_10077826 3300025960 Bacteria 2376
237 Ga0207712_10025955 3300025961 Bacteria 3898
238 Ga0207658_10509291 3300025986 Unclassified 1073
239 Ga0207677_10018345 3300026023 Unclassified 4197
240 Ga0207703_10124543 3300026035 Bacteria 2217
241 Ga0207703_10127127 3300026035 Unclassified 2196
242 Ga0207702_10011538 3300026078 Bacteria 7362
243 Ga0207702_10062805 3300026078 Bacteria 3174
244 Ga0207702_10072235 3300026078 Bacteria 2973
245 Ga0207702_10083129 3300026078 Bacteria 2785
246 Ga0207702_10138515 3300026078 Unclassified 2199
247 Ga0207702_10176313 3300026078 Bacteria 1965
248 Ga0207648_10049010 3300026089 Bacteria 3698
249 Ga0207648_10087686 3300026089 Bacteria 2716
250 Ga0207648_10304227 3300026089 Bacteria 1430
251 Ga0207676_10072006 3300026095 Unclassified 2777
252 Ga0207674_10000097 3300026116 Bacteria 98549
253 Ga0207674_10001062 3300026116 Bacteria 35740
254 Ga0207674_10193749 3300026116 Unclassified 1982
255 Ga0207683_10462093 3300026121 Bacteria 1171
256 Ga0207698_10029077 3300026142 Bacteria 3952
257 Ga0207698_10032716 3300026142 Bacteria 3771
258 Ga0207698_10045693 3300026142 Unclassified 3301
259 Ga0207698_10163920 3300026142 Unclassified 1948
260 Ga0207428_10006421 3300027907 Bacteria 10861
261 Ga0268264_10138571 3300028381 Bacteria 2166
262 Ga0268264_10281353 3300028381 Unclassified 1558
263 Ga0265323_10000651 3300028653 Bacteria 18917
264 Ga0265338_10279612 3300028800 Bacteria 1220
265 Ga0265332_10045379 3300031238 Bacteria 1894
266 Ga0265325_10098952 3300031241 Bacteria 1430
267 Ga0265331_10049073 3300031250 Bacteria 2028
268 Ga0265331_10058165 3300031250 Bacteria 1831
269 Ga0265316_10003860 3300031344 Bacteria 15027
270 Ga0265316_10038002 3300031344 Bacteria 3882
271 Ga0265316_10060942 3300031344 Bacteria 2932
272 Ga0265316_10066911 3300031344 Bacteria 2779
273 Ga0265316_10070811 3300031344 Bacteria 2689
274 Ga0265316_10116467 3300031344 Bacteria 2020
275 Ga0265314_10000538 3300031711 Bacteria 48732
276 Ga0265342_10027529 3300031712 Bacteria 3551
277 Ga0373934_0001088 3300035086 Bacteria 9840
278 Ga0373934_0074267 3300035086 Bacteria 1362
279 Ga0373934_0093099 3300035086 Unclassified 1216
280 Ga0373923_0024857 3300035111 Unclassified 2368
281 Ga0373953_0023348 3300035117 Bacteria 2340
282 Ga0373953_0050338 3300035117 Unclassified 1682
283 Ga0373954_0004932 3300035118 Bacteria 5762
284 Ga0373954_0005389 3300035118 Bacteria 5528
285 Ga0373954_0072260 3300035118 Bacteria 1641
286 Ga0373955_0012514 3300035172 Bacteria 4078
287 Ga0373931_0209291 3300035691 Bacteria 1169
288 Ga0373935_0017894 3300035692 Bacteria 4305
289 Ga0373935_0125748 3300035692 Bacteria 1718
290 Ga0373927_0000640 3300035695 Bacteria 26525
291 Ga0373927_0001291 3300035695 Bacteria 18961
292 Ga0373927_0010073 3300035695 Bacteria 6329
293 Ga0373927_0017060 3300035695 Bacteria 4784
294 Ga0373927_0065650 3300035695 Bacteria 2347
295 Ga0373927_0170119 3300035695 Bacteria 1428
296 Ga0373927_0229337 3300035695 Bacteria 1220
297 Ga0373933_0010926 3300035724 Bacteria 4986
298 Ga0373933_0012027 3300035724 Bacteria 4779
299 Ga0373933_0031415 3300035724 Bacteria 3081
300 Ga0373947_0004230 3300035725 Bacteria 8418
301 Ga0373947_0055170 3300035725 Unclassified 2399
302 Ga0373947_0097094 3300035725 Bacteria 1846
303 Ga0373947_0309489 3300035725 Unclassified 1055
304 Ga0373937_0003748 3300036401 Bacteria 12848
305 Ga0373937_0013064 3300036401 Bacteria 7314
306 Ga0373937_0020227 3300036401 Bacteria 5966
307 Ga0373937_0056969 3300036401 Unclassified 3589
308 Ga0373937_0095612 3300036401 Bacteria 2755
309 Ga0373937_0212884 3300036401 Bacteria 1819
310 Ga0373937_0549205 3300036401 Bacteria 1097
311 Ga0373925_0000470 3300037068 Bacteria 40239
312 Ga0373925_0021886 3300037068 Bacteria 4660
313 Ga0436364_0940248 3300037853 Bacteria 592364
314 Ga0436364_1151258 3300037853 Bacteria 35036
315 Ga0436364_1459148 3300037853 Unclassified 1145
316 Ga0436365_0271402 3300039437 Bacteria 4263
317 Ga0436362_0744250 3300039453 Bacteria 1609
318 Ga0453683_0097148 3300044673 Bacteria 1848
319 Ga0466961_0175703 3300044693 Bacteria 1331
320 Ga0453684_0281421 3300044712 Bacteria 1897
321 Ga0466957_0204654 3300044842 Unclassified 1298
322 Ga0451576_0079689 3300045051 Bacteria 3408
323 Ga0451576_0414474 3300045051 Bacteria 1413
324 Ga0495651_0022530 3300046462 Bacteria 4896
325 Ga0495653_0105211 3300046463 Bacteria 2038
326 Ga0495580_0000579 3300046472 Bacteria 30897
327 Ga0495580_0001498 3300046472 Bacteria 20522
328 Ga0495580_0030831 3300046472 Bacteria 3879
329 Ga0495580_0192647 3300046472 Bacteria 1406
330 Ga0495580_0220241 3300046472 Bacteria 1304
331 Ga0495582_0005106 3300046473 Bacteria 7352
332 Ga0495664_0148711 3300046477 Bacteria 1421
333 Ga0495594_0067512 3300046499 Bacteria 1985
334 Ga0495630_0174413 3300046517 Bacteria 1639
335 Ga0495630_0225294 3300046517 Bacteria 1432
336 Ga0495652_0207165 3300046529 Bacteria 1484
337 Ga0495665_0055565 3300046531 Bacteria 2090
338 Ga0495665_0085070 3300046531 Bacteria 1662
339 Ga0495587_0008875 3300046536 Bacteria 6452
340 Ga0495587_0061707 3300046536 Unclassified 2196
341 Ga0495587_0091338 3300046536 Bacteria 1759
342 Ga0495645_0013151 3300046543 Bacteria 5851
343 Ga0495667_0110602 3300046559 Bacteria 1775
344 Ga0495623_0034028 3300046679 Bacteria 3269
345 Ga0495613_0169153 3300046689 Bacteria 1552
346 Ga0495613_0204778 3300046689 Bacteria 1390
347 Ga0495600_0172257 3300046809 Bacteria 1397
348 Ga0495604_0046189 3300047317 Bacteria 3396
349 Ga0495636_0063325 3300047318 Bacteria 1567
350 Ga0495674_0038136 3300047319 Bacteria 4315
351 Ga0495674_0116831 3300047319 Bacteria 2257
352 Ga0495674_0250392 3300047319 Bacteria 1458
353 Ga0495680_0298913 3300047322 Unclassified 1131
354 Ga0495675_0232470 3300047444 Unclassified 1112
355 Ga0495684_0001648 3300047471 Bacteria 17929
356 Ga0496104_0427232 3300048907 Bacteria 1237
357 Ga0496112_0028396 3300048915 Bacteria 5400
358 Ga0496112_0030853 3300048915 Bacteria 5193
359 Ga0496112_0205858 3300048915 Bacteria 1926
360 Ga0496115_0016274 3300048918 Bacteria 5659
361 Ga0501036_0000411 3300049572 Bacteria 30265
362 Ga0501038_0001839 3300049574 Bacteria 19628
363 Ga0501039_0077595 3300049575 Bacteria 2583
364 Ga0501043_0003879 3300049579 Bacteria 12279
365 Ga0501046_0009458 3300049580 Bacteria 8422
366 Ga0501047_0009153 3300049581 Bacteria 9350
367 Ga0501048_0007805 3300049582 Bacteria 8111
368 Ga0501067_0006651 3300049583 Bacteria 6414
369 Ga0501068_0000479 3300049584 Bacteria 20231
370 Ga0501069_0002876 3300049585 Bacteria 8834
371 Ga0501070_0010119 3300049586 Bacteria 7983
372 Ga0501072_0001476 3300049588 Bacteria 17626
373 Ga0501073_0001445 3300049589 Bacteria 17556
374 Ga0501074_0150079 3300049590 Unclassified 1666
375 Ga0501079_0000098 3300049741 Bacteria 43658
376 Ga0501080_0004808 3300049742 Bacteria 12044
377 Ga0501083_0002706 3300049744 Bacteria 12231
378 Ga0501035_0010755 3300049822 Bacteria 8472
379 Ga0501045_0212890 3300049824 Unclassified 1440
380 nmdc:mga05p37_109168_c1 3300050507 Bacteria 3404
381 nmdc:mga0qj67_50441_c2 3300050509 Unclassified 1892
382 nmdc:mga06r32_197907_c1 3300050510 Bacteria 1997
383 nmdc:mga08y16_41204_c1 3300050511 Bacteria 4839
384 nmdc:mga0rr50_87197_c1 3300050513 Bacteria 2422
385 nmdc:mga08x19_5438_c1 3300050514 Bacteria 7537
386 nmdc:mga0a205_336233_c1 3300050515 Bacteria 1379
387 Ga0500568_0033805 3300053139 Bacteria 2095
388 Ga0501084_0008255 3300054114 Bacteria 8591
389 Ga0501082_0001585 3300060353 Bacteria 20064
390 Ga0501082_0007662 3300060353 Bacteria 9317
391 Ga0207695_10036783
392 Ga0070658_10263814
393 Ga0070658_10404913
394 Ga0070683_100000011
395 Ga0070683_100002992
396 Ga0070683_100101881
397 Ga0070683_100185019
398 Ga0070683_100284216
399 Ga0070683_100319467
400 Ga0070690_100005421
401 Ga0070670_100339516
402 Ga0068869_100028075
403 Ga0070680_100004118
404 Ga0070680_100017373
405 Ga0070680_100430311
406 Ga0068868_100503099
407 Ga0070660_100019795
408 Ga0070689_100308023
409 Ga0070691_10001029
410 Ga0070661_100015712
411 Ga0070661_100087447
412 Ga0070675_100423223
413 Ga0070673_100045611
414 Ga0070673_100105473
415 Ga0070659_100097426
416 Ga0070659_100222201
417 Ga0070659_100255433
418 Ga0070667_100164164
419 Ga0070709_10107059
420 Ga0070714_100001081
421 Ga0070713_100001090
422 Ga0070713_100005675
423 Ga0070713_100031319
424 Ga0070713_100283614
425 Ga0070710_10162734
426 Ga0070711_100007343
427 Ga0070711_100035120
428 Ga0070711_100091998
429 Ga0070678_100365672
430 Ga0070662_100027781
431 Ga0070662_100399564
432 Ga0070681_10011198
433 Ga0070681_10011385
434 Ga0070681_10250709
435 Ga0068867_100094320
436 Ga0068867_100261889
437 Ga0070679_100001176
438 Ga0070679_100189508
439 Ga0070684_100000001
440 Ga0070684_100006209
441 Ga0070684_100097169
442 Ga0070684_100182466
443 Ga0070684_100594324
444 Ga0070697_100077178
445 Ga0070695_100114868
446 Ga0070696_100014592
447 Ga0070693_100071314
448 Ga0070693_100219184
449 Ga0068855_100025432
450 Ga0068855_100031293
451 Ga0068855_100041465
452 Ga0068855_100051450
453 Ga0068855_100058965
454 Ga0068855_100246481
455 Ga0070664_100012931
456 Ga0068857_100000835
457 Ga0068857_100068354
458 Ga0068854_100019641
459 Ga0068856_100011585
460 Ga0068856_100024576
461 Ga0068856_100038790
462 Ga0068856_100061218
463 Ga0068856_100327466
464 Ga0068852_100011087
465 Ga0068852_100022873
466 Ga0068852_100132471
467 Ga0068852_100185682
468 Ga0068863_100031591
469 Ga0068858_100150107
470 Ga0068860_100016132
471 Ga0068860_100219383
472 Ga0070717_10046322
473 Ga0070712_100137611
474 Ga0097621_100005098
475 Ga0068871_100022727
476 Ga0068871_100082499
477 Ga0075428_100102003
478 Ga0075430_100238698
479 Ga0075430_100410569
480 Ga0075431_100002094
481 Ga0075431_100078126
482 Ga0075429_100237493
483 Ga0075436_100007299
484 Ga0105240_10005180
485 Ga0105240_10012343
486 Ga0105240_10024864
487 Ga0105240_10030746
488 Ga0105240_10033686
489 Ga0105240_10048683
490 Ga0105240_10078990
491 Ga0105240_10089308
492 Ga0105240_10112271
493 Ga0105240_10117286
494 Ga0105240_10360166
495 Ga0111539_10022437
496 Ga0105245_10005191
497 Ga0105245_10005364
498 Ga0105245_10052706
499 Ga0105245_10064061
500 Ga0105245_10076652
501 Ga0105245_10111599
502 Ga0105243_10049508
503 Ga0105243_10242546
504 Ga0105241_10005977
505 Ga0105241_10088826
506 Ga0105242_10017683
507 Ga0105242_10098608
508 Ga0105242_10225037
509 Ga0105242_10329581
510 Ga0105242_10428261
511 Ga0105248_10007425
512 Ga0105248_10114949
513 Ga0105248_10120751
514 Ga0105248_10129925
515 Ga0105248_10244347
516 Ga0105237_10015533
517 Ga0105237_10019976
518 Ga0105237_10061593
519 Ga0105237_10264872
520 Ga0105238_10008318
521 Ga0105238_10023711
522 Ga0105238_10033397
523 Ga0105238_10039428
524 Ga0105238_10089607
525 Ga0105249_10017530
526 Ga0105239_10011983
527 Ga0105239_10026387
528 Ga0105239_10088342
529 Ga0105239_10228218
530 Ga0105246_10000753
531 Ga0105246_10109690
532 Ga0157373_10062721
533 Ga0157370_10017800
534 Ga0157370_10065616
535 Ga0157369_10003629
536 Ga0157369_10003773
537 Ga0157369_10067233
538 Ga0157369_10172584
539 Ga0157374_10010786
540 Ga0157374_10072114
541 Ga0157374_10147442
542 Ga0157378_10000887
543 Ga0163162_10239784
544 Ga0163162_10463654
545 Ga0157372_10002788
546 Ga0157372_10034551
547 Ga0157372_10057624
548 Ga0157372_10098298
549 Ga0157372_10100926
550 Ga0157372_10261720
551 Ga0157375_10004544
552 Ga0157375_10148626
553 Ga0157375_10917530
554 Ga0163163_10046766
555 Ga0163163_10132128
556 Ga0163163_10191322
557 Ga0157379_10018960
558 Ga0157379_10133328
559 Ga0157376_10073842
560 Ga0157376_10364828
561 Ga0213875_10003781
562 Ga0207684_10191227
563 Ga0207654_10060930
564 Ga0207707_10004293
565 Ga0207707_10015348
566 Ga0207707_10268431
567 Ga0207695_10001639
568 Ga0207695_10002416
569 Ga0207695_10004208
570 Ga0207695_10009071
571 Ga0207695_10054251
572 Ga0207695_10060683
573 Ga0207695_10065662
574 Ga0207671_10009843
575 Ga0207671_10026863
576 Ga0207671_10141703
577 Ga0207671_10211710
578 Ga0207663_10104524
579 Ga0207660_10003120
580 Ga0207660_10012234
581 Ga0207657_10020025
582 Ga0207657_10058344
583 Ga0207657_10123740
584 Ga0207652_10008335
585 Ga0207652_10186657
586 Ga0207694_10001085
587 Ga0207694_10120514
588 Ga0207694_10125989
589 Ga0207659_10202142
590 Ga0207687_10001345
591 Ga0207687_10008491
592 Ga0207687_10066416
593 Ga0207687_10070042
594 Ga0207700_10003123
595 Ga0207700_10041124
596 Ga0207700_10060815
597 Ga0207664_10011470
598 Ga0207664_10040581
599 Ga0207664_10074563
600 Ga0207644_10088273
601 Ga0207690_10073023
602 Ga0207690_10106862
603 Ga0207690_10205370
604 Ga0207706_10102577
605 Ga0207686_10011531
606 Ga0207686_10021842
607 Ga0207686_10039377
608 Ga0207709_10077425
609 Ga0207711_10018491
610 Ga0207711_10033016
611 Ga0207711_10529283
612 Ga0207689_10019443
613 Ga0207661_10000016
614 Ga0207661_10021641
615 Ga0207661_10100568
616 Ga0207661_10369618
617 Ga0207667_10000483
618 Ga0207667_10028612
619 Ga0207667_10051591
620 Ga0207667_10100962
621 Ga0207667_10136411
622 Ga0207667_10144936
623 Ga0207667_10193605
624 Ga0207667_10206495
625 Ga0207667_10538835
626 Ga0207651_10077826
627 Ga0207712_10025955
628 Ga0207658_10509291
629 Ga0207677_10018345
630 Ga0207703_10124543
631 Ga0207703_10127127
632 Ga0207702_10011538
633 Ga0207702_10062805
634 Ga0207702_10072235
635 Ga0207702_10083129
636 Ga0207702_10138515
637 Ga0207702_10176313
638 Ga0207648_10049010
639 Ga0207648_10087686
640 Ga0207648_10304227
641 Ga0207676_10072006
642 Ga0207674_10000097
643 Ga0207674_10001062
644 Ga0207674_10193749
645 Ga0207683_10462093
646 Ga0207698_10029077
647 Ga0207698_10032716
648 Ga0207698_10045693
649 Ga0207698_10163920
650 Ga0207428_10006421
651 Ga0268264_10138571
652 Ga0268264_10281353
653 Ga0265323_10000651
654 Ga0265338_10279612
655 Ga0265332_10045379
656 Ga0265325_10098952
657 Ga0265331_10049073
658 Ga0265331_10058165
659 Ga0265316_10003860
660 Ga0265316_10038002
661 Ga0265316_10060942
662 Ga0265316_10066911
663 Ga0265316_10070811
664 Ga0265316_10116467
665 Ga0265314_10000538
666 Ga0265342_10027529
667 Ga0373934_0001088
668 Ga0373934_0074267
669 Ga0373934_0093099
670 Ga0373923_0024857
671 Ga0373953_0023348
672 Ga0373953_0050338
673 Ga0373954_0004932
674 Ga0373954_0005389
675 Ga0373954_0072260
676 Ga0373955_0012514
677 Ga0373931_0209291
678 Ga0373935_0017894
679 Ga0373935_0125748
680 Ga0373927_0000640
681 Ga0373927_0001291
682 Ga0373927_0010073
683 Ga0373927_0017060
684 Ga0373927_0065650
685 Ga0373927_0170119
686 Ga0373927_0229337
687 Ga0373933_0010926
688 Ga0373933_0012027
689 Ga0373933_0031415
690 Ga0373947_0004230
691 Ga0373947_0055170
692 Ga0373947_0097094
693 Ga0373947_0309489
694 Ga0373937_0003748
695 Ga0373937_0013064
696 Ga0373937_0020227
697 Ga0373937_0056969
698 Ga0373937_0095612
699 Ga0373937_0212884
700 Ga0373937_0549205
701 Ga0373925_0000470
702 Ga0373925_0021886
703 Ga0436364_0940248
704 Ga0436364_1151258
705 Ga0436364_1459148
706 Ga0436365_0271402
707 Ga0436362_0744250
708 Ga0453683_0097148
709 Ga0466961_0175703
710 Ga0453684_0281421
711 Ga0466957_0204654
712 Ga0451576_0079689
713 Ga0451576_0414474
714 Ga0495651_0022530
715 Ga0495653_0105211
716 Ga0495580_0000579
717 Ga0495580_0001498
718 Ga0495580_0030831
719 Ga0495580_0192647
720 Ga0495580_0220241
721 Ga0495582_0005106
722 Ga0495664_0148711
723 Ga0495594_0067512
724 Ga0495630_0174413
725 Ga0495630_0225294
726 Ga0495652_0207165
727 Ga0495665_0055565
728 Ga0495665_0085070
729 Ga0495587_0008875
730 Ga0495587_0061707
731 Ga0495587_0091338
732 Ga0495645_0013151
733 Ga0495667_0110602
734 Ga0495623_0034028
735 Ga0495613_0169153
736 Ga0495613_0204778
737 Ga0495600_0172257
738 Ga0495604_0046189
739 Ga0495636_0063325
740 Ga0495674_0038136
741 Ga0495674_0116831
742 Ga0495674_0250392
743 Ga0495680_0298913
744 Ga0495675_0232470
745 Ga0495684_0001648
746 Ga0496104_0427232
747 Ga0496112_0028396
748 Ga0496112_0030853
749 Ga0496112_0205858
750 Ga0496115_0016274
751 Ga0501036_0000411
752 Ga0501038_0001839
753 Ga0501039_0077595
754 Ga0501043_0003879
755 Ga0501046_0009458
756 Ga0501047_0009153
757 Ga0501048_0007805
758 Ga0501067_0006651
759 Ga0501068_0000479
760 Ga0501069_0002876
761 Ga0501070_0010119
762 Ga0501072_0001476
763 Ga0501073_0001445
764 Ga0501074_0150079
765 Ga0501079_0000098
766 Ga0501080_0004808
767 Ga0501083_0002706
768 Ga0501035_0010755
769 Ga0501045_0212890
770 nmdc:mga05p37_109168_c1
771 nmdc:mga0qj67_50441_c2
772 nmdc:mga06r32_197907_c1
773 nmdc:mga08y16_41204_c1
774 nmdc:mga0rr50_87197_c1
775 nmdc:mga08x19_5438_c1
776 nmdc:mga0a205_336233_c1
777 Ga0500568_0033805
778 Ga0501084_0008255
779 Ga0501082_0001585
780 Ga0501082_0007662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

51

332

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7agh-assembly1.cif.gz_B crystal structure of sf kinase yihv from e. coli in complex with amppnp-mg 0.9368 5 302
7agh-assembly2.cif.gz_A crystal structure of sf kinase yihv from e. coli in complex with amppnp-mg 0.9339 5 301
7agh-assembly1.cif.gz_B crystal structure of sf kinase yihv from e. coli in complex with amppnp-mg 0.9337 5 302
7agh-assembly2.cif.gz_A crystal structure of sf kinase yihv from e. coli in complex with amppnp-mg 0.9247 5 301
2rbc-assembly1.cif.gz_A-2 crystal structure of a putative ribokinase from agrobacterium tumefaciens 0.9214 6 301
ID Description Score Start End Superfamily
af_F4K7C7_15_348_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9142 9 287 3.40.1190.20
2rbcA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9057 6 301 3.40.1190.20
af_P32143_2_297_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8927 8 301 3.40.1190.20
af_Q9VW84_5_299_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8863 7 287 3.40.1190.20
2rbcA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8828 6 301 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7X2TT44-F1-model_v4 Ribokinase 0.987 104 317 GO:0016301
AF-A0A2V9K4Z0-F1-model_v4 Ribokinase 0.9858 6 309 GO:0016301
AF-A0A7C7UN35-F1-model_v4 Carbohydrate kinase family protein 0.975 152 300 GO:0016301
AF-A0A7X2TT44-F1-model_v4 Ribokinase 0.9691 104 317 GO:0016301
AF-A0A2V9BMC9-F1-model_v4 Carbohydrate kinase family protein 0.9676 2 274 GO:0016301

Map