F431646

General Info

Members Datasets Scaffolds Average Seq Length
390 174 780 119

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100017707|Ga0070661_1000177073
Length 137
Sequence VITKALLLLLTSVKGAAERMQIGTKLSEQLARYLDLSVSEVKLTASNMANIDTPGYQTKGFDFAAEMGEALAGIDKGRIAPLHVHEVDGLVTRPDGNNVSMDREGLHLAEAQLRYRTGIALLRIENQRVMDAIHADK

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.36
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 16.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100017707 3300005344 Bacteria 5057
2 JGI24743J22301_10091682 3300001991 Unclassified 648
3 rootH2_10032253 3300003320 Bacteria 1685
4 rootH2_10076183 3300003320 Bacteria 3164
5 rootH1_10175270 3300003323 Bacteria 1189
6 Ga0070658_10414332 3300005327 Bacteria 1158
7 Ga0070658_10419061 3300005327 Bacteria 1151
8 Ga0070658_10488736 3300005327 Bacteria 1062
9 Ga0070658_10829171 3300005327 Unclassified 804
10 Ga0070676_10265352 3300005328 Bacteria 1151
11 Ga0070683_100000586 3300005329 Bacteria 25995
12 Ga0070683_100074526 3300005329 Bacteria 3170
13 Ga0070683_100365450 3300005329 Unclassified 1374
14 Ga0070690_100768053 3300005330 Unclassified 745
15 Ga0070670_100020965 3300005331 Bacteria 5620
16 Ga0068869_100000488 3300005334 Bacteria 21991
17 Ga0070666_10047980 3300005335 Bacteria 2868
18 Ga0070666_10729829 3300005335 Unclassified 727
19 Ga0070680_100320615 3300005336 Bacteria 1315
20 Ga0070680_101853901 3300005336 Unclassified 523
21 Ga0070682_100155655 3300005337 Bacteria 1573
22 Ga0068868_100052997 3300005338 Bacteria 3195
23 Ga0068868_100262926 3300005338 Bacteria 1456
24 Ga0070691_10111253 3300005341 Bacteria 1370
25 Ga0070661_100199272 3300005344 Bacteria 1529
26 Ga0070661_100241985 3300005344 Bacteria 1390
27 Ga0070661_100390707 3300005344 Bacteria 1098
28 Ga0070661_101193539 3300005344 Bacteria 636
29 Ga0070671_100237511 3300005355 Bacteria 1547
30 Ga0070673_100086327 3300005364 Bacteria 2557
31 Ga0070659_100168469 3300005366 Bacteria 1793
32 Ga0070667_100002205 3300005367 Bacteria 17148
33 Ga0070667_100349895 3300005367 Bacteria 1337
34 Ga0070709_11067239 3300005434 Unclassified 645
35 Ga0070714_100008000 3300005435 Bacteria 8239
36 Ga0070713_100178063 3300005436 Bacteria 1909
37 Ga0070713_101229956 3300005436 Bacteria 725
38 Ga0070678_100364940 3300005456 Bacteria 1245
39 Ga0070681_10562100 3300005458 Bacteria 1054
40 Ga0070681_10789541 3300005458 Bacteria 866
41 Ga0070679_100177095 3300005530 Bacteria 2105
42 Ga0070684_100003452 3300005535 Bacteria 11863
43 Ga0070684_100005962 3300005535 Bacteria 9387
44 Ga0070684_100138967 3300005535 Bacteria 2196
45 Ga0070684_100153390 3300005535 Bacteria 2088
46 Ga0068853_100084792 3300005539 Bacteria 2776
47 Ga0068853_100202362 3300005539 Bacteria 1807
48 Ga0068853_100255570 3300005539 Bacteria 1609
49 Ga0068853_100632037 3300005539 Bacteria 1018
50 Ga0070672_100079355 3300005543 Bacteria 2627
51 Ga0070665_100252387 3300005548 Bacteria 1765
52 Ga0070665_100296432 3300005548 Bacteria 1620
53 Ga0070665_100653539 3300005548 Bacteria 1064
54 Ga0068855_100009453 3300005563 Bacteria 11779
55 Ga0068855_100025013 3300005563 Bacteria 7146
56 Ga0068855_100038086 3300005563 Bacteria 5715
57 Ga0068855_100470678 3300005563 Bacteria 1369
58 Ga0068855_100825715 3300005563 Bacteria 984
59 Ga0070664_100291249 3300005564 Unclassified 1474
60 Ga0070664_100425081 3300005564 Bacteria 1217
61 Ga0068857_100015763 3300005577 Bacteria 6613
62 Ga0068857_100018621 3300005577 Bacteria 6093
63 Ga0068857_100084275 3300005577 Bacteria 2840
64 Ga0068854_100519432 3300005578 Unclassified 1005
65 Ga0068856_100007379 3300005614 Bacteria 10731
66 Ga0068856_100008722 3300005614 Bacteria 9864
67 Ga0068856_100031695 3300005614 Bacteria 5173
68 Ga0068856_100080976 3300005614 Bacteria 3221
69 Ga0068856_100197043 3300005614 Bacteria 2028
70 Ga0068856_100358723 3300005614 Bacteria 1476
71 Ga0068856_100811358 3300005614 Unclassified 955
72 Ga0068852_100000021 3300005616 Bacteria 126061
73 Ga0068852_100008264 3300005616 Bacteria 7657
74 Ga0068852_100191798 3300005616 Bacteria 1929
75 Ga0068852_100226545 3300005616 Bacteria 1780
76 Ga0068852_101069944 3300005616 Unclassified 826
77 Ga0068859_100007367 3300005617 Bacteria 11163
78 Ga0068864_100005226 3300005618 Bacteria 10641
79 Ga0068864_100237840 3300005618 Bacteria 1686
80 Ga0068851_10011554 3300005834 Bacteria 4144
81 Ga0068851_10061099 3300005834 Bacteria 1931
82 Ga0068851_10452263 3300005834 Unclassified 763
83 Ga0068851_11004178 3300005834 Unclassified 526
84 Ga0068863_100000774 3300005841 Bacteria 32090
85 Ga0068863_100028063 3300005841 Bacteria 5373
86 Ga0068860_100003993 3300005843 Bacteria 15141
87 Ga0068862_100218585 3300005844 Bacteria 1724
88 Ga0070717_10013032 3300006028 Bacteria 6353
89 Ga0070717_10628209 3300006028 Bacteria 975
90 Ga0070717_11151128 3300006028 Unclassified 706
91 Ga0097621_100004061 3300006237 Bacteria 10155
92 Ga0068871_100000326 3300006358 Bacteria 33216
93 Ga0097620_100007367 3300006931 Bacteria 11163
94 Ga0105240_10000114 3300009093 Bacteria 166405
95 Ga0105240_10001319 3300009093 Bacteria 42818
96 Ga0105240_10016296 3300009093 Bacteria 10066
97 Ga0105240_10022439 3300009093 Bacteria 8366
98 Ga0105240_10219125 3300009093 Bacteria 2218
99 Ga0105240_10485134 3300009093 Bacteria 1377
100 Ga0105240_10517306 3300009093 Bacteria 1325
101 Ga0105240_10593733 3300009093 Unclassified 1220
102 Ga0105240_11699057 3300009093 Unclassified 659
103 Ga0105245_10007393 3300009098 Bacteria 9618
104 Ga0105245_10117783 3300009098 Bacteria 2478
105 Ga0105245_10523642 3300009098 Bacteria 1204
106 Ga0105247_10005055 3300009101 Bacteria 8366
107 Ga0105241_10000605 3300009174 Bacteria 27071
108 Ga0105241_10007952 3300009174 Bacteria 7799
109 Ga0105241_10024249 3300009174 Bacteria 4505
110 Ga0105241_10109717 3300009174 Bacteria 2207
111 Ga0105241_10564360 3300009174 Bacteria 1024
112 Ga0105241_10891069 3300009174 Bacteria 826
113 Ga0105248_10007095 3300009177 Bacteria 12274
114 Ga0105248_10383485 3300009177 Bacteria 1583
115 Ga0105248_11422381 3300009177 Bacteria 785
116 Ga0105248_11455593 3300009177 Unclassified 775
117 Ga0105248_11472958 3300009177 Bacteria 770
118 Ga0105237_10005604 3300009545 Bacteria 14150
119 Ga0105237_10038533 3300009545 Bacteria 4827
120 Ga0105237_10085552 3300009545 Bacteria 3143
121 Ga0105237_10336617 3300009545 Bacteria 1513
122 Ga0105238_10008255 3300009551 Bacteria 10417
123 Ga0105238_10008790 3300009551 Bacteria 10107
124 Ga0105238_10012324 3300009551 Bacteria 8621
125 Ga0105238_10034277 3300009551 Bacteria 5165
126 Ga0105238_10059533 3300009551 Bacteria 3826
127 Ga0105238_10776247 3300009551 Unclassified 973
128 Ga0105238_12031471 3300009551 Unclassified 609
129 Ga0105249_10532175 3300009553 Bacteria 1224
130 Ga0105239_10018249 3300010375 Bacteria 7757
131 Ga0105239_10025292 3300010375 Bacteria 6537
132 Ga0105239_10293923 3300010375 Bacteria 1829
133 Ga0105239_10637920 3300010375 Bacteria 1216
134 Ga0105239_10764678 3300010375 Bacteria 1106
135 Ga0105239_11042981 3300010375 Unclassified 941
136 Ga0105239_11350080 3300010375 Bacteria 823
137 Ga0105246_10002842 3300011119 Bacteria 10492
138 Ga0105246_10248100 3300011119 Bacteria 1411
139 Ga0157373_10199705 3300013100 Bacteria 1410
140 Ga0157373_10406500 3300013100 Unclassified 976
141 Ga0157373_10703221 3300013100 Unclassified 741
142 Ga0157373_10757684 3300013100 Bacteria 714
143 Ga0157371_10244059 3300013102 Bacteria 1292
144 Ga0157370_10000001 3300013104 Bacteria 529517
145 Ga0157370_10271473 3300013104 Bacteria 1567
146 Ga0157370_10513544 3300013104 Bacteria 1100
147 Ga0157370_11458978 3300013104 Unclassified 615
148 Ga0157369_10000066 3300013105 Bacteria 144815
149 Ga0157369_10002792 3300013105 Bacteria 20846
150 Ga0157369_10004892 3300013105 Bacteria 15713
151 Ga0157369_10005306 3300013105 Bacteria 15019
152 Ga0157369_10007428 3300013105 Bacteria 12623
153 Ga0157369_10223149 3300013105 Bacteria 1972
154 Ga0157369_10630490 3300013105 Bacteria 1106
155 Ga0157369_11029700 3300013105 Unclassified 842
156 Ga0157369_12386984 3300013105 Bacteria 536
157 Ga0157374_10002728 3300013296 Bacteria 14828
158 Ga0157374_10004485 3300013296 Bacteria 11724
159 Ga0157374_10295139 3300013296 Bacteria 1603
160 Ga0157374_10705225 3300013296 Unclassified 1022
161 Ga0157374_10949956 3300013296 Bacteria 878
162 Ga0157378_10005979 3300013297 Bacteria 10668
163 Ga0157378_10006109 3300013297 Bacteria 10545
164 Ga0157378_10126807 3300013297 Bacteria 2358
165 Ga0157378_10200022 3300013297 Bacteria 1889
166 Ga0163162_10350719 3300013306 Bacteria 1608
167 Ga0163162_12502915 3300013306 Unclassified 593
168 Ga0157372_10000038 3300013307 Bacteria 167357
169 Ga0157372_10002462 3300013307 Bacteria 20061
170 Ga0157372_10019036 3300013307 Bacteria 7391
171 Ga0157372_10021169 3300013307 Bacteria 7025
172 Ga0157372_10030350 3300013307 Bacteria 5915
173 Ga0157372_10140305 3300013307 Bacteria 2784
174 Ga0157375_10000653 3300013308 Bacteria 30658
175 Ga0157375_10119268 3300013308 Bacteria 2746
176 Ga0157375_10378207 3300013308 Bacteria 1583
177 Ga0157375_11022759 3300013308 Bacteria 965
178 Ga0157375_12085485 3300013308 Unclassified 675
179 Ga0163163_10000746 3300014325 Bacteria 27703
180 Ga0157379_10001682 3300014968 Bacteria 18279
181 Ga0157379_10020227 3300014968 Bacteria 5883
182 Ga0157379_10421794 3300014968 Unclassified 1229
183 Ga0157379_12587232 3300014968 Bacteria 508
184 Ga0157376_10000298 3300014969 Bacteria 33454
185 Ga0157376_10032231 3300014969 Bacteria 4206
186 Ga0157376_11584289 3300014969 Bacteria 689
187 Ga0157376_12641795 3300014969 Unclassified 542
188 Ga0163161_10641916 3300017792 Unclassified 879
189 Ga0207697_10103969 3300025315 Bacteria 1212
190 Ga0207656_10036011 3300025321 Bacteria 2075
191 Ga0207656_10351897 3300025321 Unclassified 735
192 Ga0207710_10001098 3300025900 Bacteria 13888
193 Ga0207688_10165270 3300025901 Bacteria 1314
194 Ga0207680_10066442 3300025903 Bacteria 2218
195 Ga0207647_10095669 3300025904 Bacteria 1768
196 Ga0207699_10917443 3300025906 Unclassified 646
197 Ga0207705_10124821 3300025909 Bacteria 1912
198 Ga0207705_10464122 3300025909 Bacteria 982
199 Ga0207705_10523532 3300025909 Unclassified 921
200 Ga0207705_10555979 3300025909 Bacteria 892
201 Ga0207654_10001744 3300025911 Bacteria 11296
202 Ga0207654_10040224 3300025911 Bacteria 2633
203 Ga0207654_10312994 3300025911 Bacteria 1071
204 Ga0207654_10564216 3300025911 Unclassified 810
205 Ga0207707_10310070 3300025912 Bacteria 1364
206 Ga0207695_10000026 3300025913 Bacteria 624558
207 Ga0207695_10002839 3300025913 Bacteria 25163
208 Ga0207695_10011673 3300025913 Bacteria 10617
209 Ga0207695_10043516 3300025913 Bacteria 4785
210 Ga0207695_10132079 3300025913 Bacteria 2453
211 Ga0207695_10502767 3300025913 Unclassified 1094
212 Ga0207671_10000333 3300025914 Bacteria 69547
213 Ga0207671_10395635 3300025914 Bacteria 1099
214 Ga0207671_11483987 3300025914 Unclassified 524
215 Ga0207660_10051293 3300025917 Bacteria 2933
216 Ga0207649_10014413 3300025920 Bacteria 4425
217 Ga0207649_10202096 3300025920 Bacteria 1404
218 Ga0207649_11640737 3300025920 Bacteria 509
219 Ga0207652_10018119 3300025921 Bacteria 5772
220 Ga0207652_10750582 3300025921 Unclassified 868
221 Ga0207681_10552518 3300025923 Bacteria 948
222 Ga0207694_10000854 3300025924 Bacteria 27105
223 Ga0207694_10015598 3300025924 Bacteria 5730
224 Ga0207694_10093633 3300025924 Bacteria 2373
225 Ga0207694_10144094 3300025924 Bacteria 1917
226 Ga0207694_10160702 3300025924 Bacteria 1814
227 Ga0207694_10428081 3300025924 Bacteria 1103
228 Ga0207650_10014600 3300025925 Bacteria 5456
229 Ga0207650_11165928 3300025925 Unclassified 656
230 Ga0207687_10007718 3300025927 Bacteria 7057
231 Ga0207687_10440786 3300025927 Bacteria 1079
232 Ga0207700_10132556 3300025928 Bacteria 2037
233 Ga0207664_10039395 3300025929 Bacteria 3670
234 Ga0207644_10137948 3300025931 Bacteria 1875
235 Ga0207644_10315907 3300025931 Bacteria 1262
236 Ga0207691_10015093 3300025940 Bacteria 7350
237 Ga0207711_10155672 3300025941 Unclassified 2065
238 Ga0207711_10884373 3300025941 Bacteria 831
239 Ga0207711_11037182 3300025941 Bacteria 760
240 Ga0207711_11659556 3300025941 Unclassified 582
241 Ga0207689_10000805 3300025942 Bacteria 30240
242 Ga0207689_10115920 3300025942 Bacteria 2202
243 Ga0207661_10002135 3300025944 Bacteria 13610
244 Ga0207661_10045826 3300025944 Bacteria 3464
245 Ga0207661_10053479 3300025944 Bacteria 3231
246 Ga0207661_10073840 3300025944 Bacteria 2795
247 Ga0207661_10114554 3300025944 Bacteria 2286
248 Ga0207679_10506769 3300025945 Bacteria 1078
249 Ga0207667_10001453 3300025949 Bacteria 29739
250 Ga0207667_10015346 3300025949 Bacteria 8708
251 Ga0207667_10021216 3300025949 Bacteria 7200
252 Ga0207667_10245862 3300025949 Bacteria 1830
253 Ga0207667_10370938 3300025949 Bacteria 1459
254 Ga0207640_10298967 3300025981 Bacteria 1272
255 Ga0207658_10002152 3300025986 Bacteria 14649
256 Ga0207658_10252810 3300025986 Bacteria 1498
257 Ga0207677_10003152 3300026023 Bacteria 8703
258 Ga0207677_10554259 3300026023 Bacteria 1002
259 Ga0207639_10027344 3300026041 Bacteria 4155
260 Ga0207639_10166952 3300026041 Bacteria 1860
261 Ga0207639_10181998 3300026041 Bacteria 1788
262 Ga0207639_10946106 3300026041 Bacteria 806
263 Ga0207678_10871100 3300026067 Unclassified 796
264 Ga0207702_10004116 3300026078 Bacteria 13051
265 Ga0207702_10196069 3300026078 Bacteria 1869
266 Ga0207702_10230909 3300026078 Bacteria 1729
267 Ga0207702_10404835 3300026078 Bacteria 1317
268 Ga0207702_10559710 3300026078 Unclassified 1119
269 Ga0207641_10001735 3300026088 Bacteria 21043
270 Ga0207641_10051009 3300026088 Bacteria 3503
271 Ga0207676_10011658 3300026095 Bacteria 6287
272 Ga0207676_10122746 3300026095 Bacteria 2194
273 Ga0207674_10003255 3300026116 Bacteria 19989
274 Ga0207674_10009636 3300026116 Bacteria 11018
275 Ga0207674_10152495 3300026116 Bacteria 2267
276 Ga0207674_10278809 3300026116 Bacteria 1619
277 Ga0207683_10006375 3300026121 Bacteria 10104
278 Ga0207683_11591507 3300026121 Unclassified 603
279 Ga0207698_10000016 3300026142 Bacteria 183355
280 Ga0207698_10006609 3300026142 Bacteria 7252
281 Ga0207698_10192235 3300026142 Bacteria 1819
282 Ga0207698_10324881 3300026142 Bacteria 1443
283 Ga0207698_10632385 3300026142 Unclassified 1058
284 Ga0265357_1033376 3300028023 Bacteria 592
285 Ga0268266_10019656 3300028379 Bacteria 5755
286 Ga0268266_10032449 3300028379 Bacteria 4436
287 Ga0268266_10066536 3300028379 Bacteria 3117
288 Ga0268266_10196640 3300028379 Bacteria 1844
289 Ga0268264_10676605 3300028381 Bacteria 1023
290 Ga0265318_10012119 3300028577 Bacteria 3681
291 Ga0265336_10005665 3300028666 Bacteria 4582
292 Ga0265336_10010509 3300028666 Bacteria 3170
293 Ga0265338_10003648 3300028800 Bacteria 21446
294 Ga0265338_10003948 3300028800 Bacteria 20440
295 Ga0265338_10005133 3300028800 Bacteria 17245
296 Ga0265338_10009837 3300028800 Bacteria 11330
297 Ga0265760_10178393 3300031090 Unclassified 708
298 Ga0265330_10013889 3300031235 Bacteria 3744
299 Ga0265330_10034519 3300031235 Bacteria 2259
300 Ga0265328_10005363 3300031239 Bacteria 5491
301 Ga0265328_10023576 3300031239 Bacteria 2333
302 Ga0265328_10125995 3300031239 Unclassified 957
303 Ga0265320_10110070 3300031240 Bacteria 1262
304 Ga0265325_10000341 3300031241 Bacteria 32989
305 Ga0265325_10041954 3300031241 Bacteria 2395
306 Ga0265325_10044834 3300031241 Bacteria 2301
307 Ga0265325_10047770 3300031241 Bacteria 2215
308 Ga0265329_10012083 3300031242 Bacteria 3118
309 Ga0265340_10006098 3300031247 Bacteria 6647
310 Ga0265340_10040768 3300031247 Bacteria 2286
311 Ga0265339_10002181 3300031249 Bacteria 14200
312 Ga0265339_10002344 3300031249 Bacteria 13612
313 Ga0265339_10024382 3300031249 Bacteria 3486
314 Ga0265339_10444992 3300031249 Unclassified 602
315 Ga0265331_10182485 3300031250 Bacteria 948
316 Ga0265316_10016339 3300031344 Bacteria 6441
317 Ga0265316_10021227 3300031344 Bacteria 5508
318 Ga0265316_10088518 3300031344 Bacteria 2364
319 Ga0265313_10001791 3300031595 Bacteria 19621
320 Ga0265313_10046338 3300031595 Bacteria 2111
321 Ga0265313_10343385 3300031595 Unclassified 593
322 Ga0265314_10000081 3300031711 Bacteria 143776
323 Ga0265314_10006624 3300031711 Bacteria 10189
324 Ga0265314_10022144 3300031711 Bacteria 4871
325 Ga0265314_10458135 3300031711 Bacteria 678
326 Ga0265342_10004607 3300031712 Bacteria 10757
327 Ga0265342_10093345 3300031712 Bacteria 1723
328 Ga0265342_10116748 3300031712 Bacteria 1506
329 Ga0307510_10113600 3300033180 Unclassified 2441
330 Ga0373954_0398640 3300035118 Bacteria 680
331 Ga0373955_0303557 3300035172 Bacteria 963
332 Ga0373933_0089457 3300035724 Unclassified 1898
333 Ga0373937_0003128 3300036401 Bacteria 13847
334 Ga0373937_0774498 3300036401 Bacteria 907
335 Ga0373937_1091626 3300036401 Bacteria 747
336 Ga0395898_0319435 3300037466 Bacteria 1481
337 Ga0395901_1003321 3300038443 Bacteria 811
338 Ga0436360_0229674 3300039438 Unclassified 546
339 Ga0453683_0489605 3300044673 Unclassified 798
340 Ga0466961_0013229 3300044693 Bacteria 5281
341 Ga0495629_0121073 3300046459 Bacteria 1823
342 Ga0495629_0842749 3300046459 Bacteria 603
343 Ga0495650_0001606 3300046471 Bacteria 21133
344 Ga0495580_0441266 3300046472 Bacteria 874
345 Ga0495594_0891534 3300046499 Unclassified 500
346 Ga0495630_0413272 3300046517 Bacteria 1034
347 Ga0495587_0203242 3300046536 Bacteria 1120
348 Ga0495625_0000137 3300046660 Bacteria 113398
349 Ga0495625_0455396 3300046660 Bacteria 790
350 Ga0495635_0474352 3300046663 Unclassified 825
351 Ga0495599_0602417 3300046678 Bacteria 640
352 Ga0495646_0357446 3300046680 Bacteria 764
353 Ga0495624_0701701 3300046690 Bacteria 601
354 Ga0495604_0286849 3300047317 Bacteria 1110
355 Ga0495604_0384477 3300047317 Bacteria 927
356 Ga0496100_0147973 3300048903 Bacteria 1672
357 Ga0496100_0773145 3300048903 Bacteria 752
358 Ga0496102_1557997 3300048905 Bacteria 579
359 Ga0496104_0116641 3300048907 Unclassified 2562
360 Ga0496104_0187213 3300048907 Unclassified 1981
361 Ga0496104_1550706 3300048907 Unclassified 565
362 Ga0496105_0149531 3300048908 Bacteria 1920
363 Ga0496105_0508217 3300048908 Unclassified 945
364 Ga0496105_0857598 3300048908 Bacteria 687
365 Ga0496110_0934508 3300048913 Bacteria 774
366 Ga0496110_1162543 3300048913 Bacteria 680
367 Ga0496111_1324491 3300048914 Unclassified 507
368 Ga0496114_0137577 3300048917 Bacteria 2113
369 Ga0496115_0081856 3300048918 Unclassified 2629
370 Ga0496115_0189370 3300048918 Unclassified 1700
371 Ga0496115_0205354 3300048918 Bacteria 1627
372 Ga0496115_0550530 3300048918 Bacteria 922
373 Ga0496126_0147645 3300048929 Unclassified 2018
374 Ga0501032_0055564 3300049569 Bacteria 2663
375 Ga0501033_0004106 3300049570 Bacteria 11734
376 Ga0501034_0045965 3300049571 Bacteria 4411
377 Ga0501036_0018460 3300049572 Bacteria 5844
378 Ga0501037_0011245 3300049573 Bacteria 6589
379 Ga0501038_0004842 3300049574 Bacteria 12508
380 Ga0501039_0059922 3300049575 Bacteria 2948
381 Ga0501043_0002696 3300049579 Bacteria 14890
382 Ga0501046_0000380 3300049580 Bacteria 44450
383 Ga0501047_0001862 3300049581 Bacteria 20309
384 Ga0501068_0263228 3300049584 Bacteria 1100
385 Ga0501073_0029455 3300049589 Bacteria 3923
386 Ga0501080_0013349 3300049742 Bacteria 7553
387 Ga0501035_0006109 3300049822 Bacteria 11337
388 Ga0501044_0019865 3300049823 Bacteria 7175
389 Ga0495601_0062814 3300053077 Bacteria 2360
390 Ga0495595_0535274 3300053084 Unclassified 598
391 Ga0070661_100017707
392 JGI24743J22301_10091682
393 rootH2_10032253
394 rootH2_10076183
395 rootH1_10175270
396 Ga0070658_10414332
397 Ga0070658_10419061
398 Ga0070658_10488736
399 Ga0070658_10829171
400 Ga0070676_10265352
401 Ga0070683_100000586
402 Ga0070683_100074526
403 Ga0070683_100365450
404 Ga0070690_100768053
405 Ga0070670_100020965
406 Ga0068869_100000488
407 Ga0070666_10047980
408 Ga0070666_10729829
409 Ga0070680_100320615
410 Ga0070680_101853901
411 Ga0070682_100155655
412 Ga0068868_100052997
413 Ga0068868_100262926
414 Ga0070691_10111253
415 Ga0070661_100199272
416 Ga0070661_100241985
417 Ga0070661_100390707
418 Ga0070661_101193539
419 Ga0070671_100237511
420 Ga0070673_100086327
421 Ga0070659_100168469
422 Ga0070667_100002205
423 Ga0070667_100349895
424 Ga0070709_11067239
425 Ga0070714_100008000
426 Ga0070713_100178063
427 Ga0070713_101229956
428 Ga0070678_100364940
429 Ga0070681_10562100
430 Ga0070681_10789541
431 Ga0070679_100177095
432 Ga0070684_100003452
433 Ga0070684_100005962
434 Ga0070684_100138967
435 Ga0070684_100153390
436 Ga0068853_100084792
437 Ga0068853_100202362
438 Ga0068853_100255570
439 Ga0068853_100632037
440 Ga0070672_100079355
441 Ga0070665_100252387
442 Ga0070665_100296432
443 Ga0070665_100653539
444 Ga0068855_100009453
445 Ga0068855_100025013
446 Ga0068855_100038086
447 Ga0068855_100470678
448 Ga0068855_100825715
449 Ga0070664_100291249
450 Ga0070664_100425081
451 Ga0068857_100015763
452 Ga0068857_100018621
453 Ga0068857_100084275
454 Ga0068854_100519432
455 Ga0068856_100007379
456 Ga0068856_100008722
457 Ga0068856_100031695
458 Ga0068856_100080976
459 Ga0068856_100197043
460 Ga0068856_100358723
461 Ga0068856_100811358
462 Ga0068852_100000021
463 Ga0068852_100008264
464 Ga0068852_100191798
465 Ga0068852_100226545
466 Ga0068852_101069944
467 Ga0068859_100007367
468 Ga0068864_100005226
469 Ga0068864_100237840
470 Ga0068851_10011554
471 Ga0068851_10061099
472 Ga0068851_10452263
473 Ga0068851_11004178
474 Ga0068863_100000774
475 Ga0068863_100028063
476 Ga0068860_100003993
477 Ga0068862_100218585
478 Ga0070717_10013032
479 Ga0070717_10628209
480 Ga0070717_11151128
481 Ga0097621_100004061
482 Ga0068871_100000326
483 Ga0097620_100007367
484 Ga0105240_10000114
485 Ga0105240_10001319
486 Ga0105240_10016296
487 Ga0105240_10022439
488 Ga0105240_10219125
489 Ga0105240_10485134
490 Ga0105240_10517306
491 Ga0105240_10593733
492 Ga0105240_11699057
493 Ga0105245_10007393
494 Ga0105245_10117783
495 Ga0105245_10523642
496 Ga0105247_10005055
497 Ga0105241_10000605
498 Ga0105241_10007952
499 Ga0105241_10024249
500 Ga0105241_10109717
501 Ga0105241_10564360
502 Ga0105241_10891069
503 Ga0105248_10007095
504 Ga0105248_10383485
505 Ga0105248_11422381
506 Ga0105248_11455593
507 Ga0105248_11472958
508 Ga0105237_10005604
509 Ga0105237_10038533
510 Ga0105237_10085552
511 Ga0105237_10336617
512 Ga0105238_10008255
513 Ga0105238_10008790
514 Ga0105238_10012324
515 Ga0105238_10034277
516 Ga0105238_10059533
517 Ga0105238_10776247
518 Ga0105238_12031471
519 Ga0105249_10532175
520 Ga0105239_10018249
521 Ga0105239_10025292
522 Ga0105239_10293923
523 Ga0105239_10637920
524 Ga0105239_10764678
525 Ga0105239_11042981
526 Ga0105239_11350080
527 Ga0105246_10002842
528 Ga0105246_10248100
529 Ga0157373_10199705
530 Ga0157373_10406500
531 Ga0157373_10703221
532 Ga0157373_10757684
533 Ga0157371_10244059
534 Ga0157370_10000001
535 Ga0157370_10271473
536 Ga0157370_10513544
537 Ga0157370_11458978
538 Ga0157369_10000066
539 Ga0157369_10002792
540 Ga0157369_10004892
541 Ga0157369_10005306
542 Ga0157369_10007428
543 Ga0157369_10223149
544 Ga0157369_10630490
545 Ga0157369_11029700
546 Ga0157369_12386984
547 Ga0157374_10002728
548 Ga0157374_10004485
549 Ga0157374_10295139
550 Ga0157374_10705225
551 Ga0157374_10949956
552 Ga0157378_10005979
553 Ga0157378_10006109
554 Ga0157378_10126807
555 Ga0157378_10200022
556 Ga0163162_10350719
557 Ga0163162_12502915
558 Ga0157372_10000038
559 Ga0157372_10002462
560 Ga0157372_10019036
561 Ga0157372_10021169
562 Ga0157372_10030350
563 Ga0157372_10140305
564 Ga0157375_10000653
565 Ga0157375_10119268
566 Ga0157375_10378207
567 Ga0157375_11022759
568 Ga0157375_12085485
569 Ga0163163_10000746
570 Ga0157379_10001682
571 Ga0157379_10020227
572 Ga0157379_10421794
573 Ga0157379_12587232
574 Ga0157376_10000298
575 Ga0157376_10032231
576 Ga0157376_11584289
577 Ga0157376_12641795
578 Ga0163161_10641916
579 Ga0207697_10103969
580 Ga0207656_10036011
581 Ga0207656_10351897
582 Ga0207710_10001098
583 Ga0207688_10165270
584 Ga0207680_10066442
585 Ga0207647_10095669
586 Ga0207699_10917443
587 Ga0207705_10124821
588 Ga0207705_10464122
589 Ga0207705_10523532
590 Ga0207705_10555979
591 Ga0207654_10001744
592 Ga0207654_10040224
593 Ga0207654_10312994
594 Ga0207654_10564216
595 Ga0207707_10310070
596 Ga0207695_10000026
597 Ga0207695_10002839
598 Ga0207695_10011673
599 Ga0207695_10043516
600 Ga0207695_10132079
601 Ga0207695_10502767
602 Ga0207671_10000333
603 Ga0207671_10395635
604 Ga0207671_11483987
605 Ga0207660_10051293
606 Ga0207649_10014413
607 Ga0207649_10202096
608 Ga0207649_11640737
609 Ga0207652_10018119
610 Ga0207652_10750582
611 Ga0207681_10552518
612 Ga0207694_10000854
613 Ga0207694_10015598
614 Ga0207694_10093633
615 Ga0207694_10144094
616 Ga0207694_10160702
617 Ga0207694_10428081
618 Ga0207650_10014600
619 Ga0207650_11165928
620 Ga0207687_10007718
621 Ga0207687_10440786
622 Ga0207700_10132556
623 Ga0207664_10039395
624 Ga0207644_10137948
625 Ga0207644_10315907
626 Ga0207691_10015093
627 Ga0207711_10155672
628 Ga0207711_10884373
629 Ga0207711_11037182
630 Ga0207711_11659556
631 Ga0207689_10000805
632 Ga0207689_10115920
633 Ga0207661_10002135
634 Ga0207661_10045826
635 Ga0207661_10053479
636 Ga0207661_10073840
637 Ga0207661_10114554
638 Ga0207679_10506769
639 Ga0207667_10001453
640 Ga0207667_10015346
641 Ga0207667_10021216
642 Ga0207667_10245862
643 Ga0207667_10370938
644 Ga0207640_10298967
645 Ga0207658_10002152
646 Ga0207658_10252810
647 Ga0207677_10003152
648 Ga0207677_10554259
649 Ga0207639_10027344
650 Ga0207639_10166952
651 Ga0207639_10181998
652 Ga0207639_10946106
653 Ga0207678_10871100
654 Ga0207702_10004116
655 Ga0207702_10196069
656 Ga0207702_10230909
657 Ga0207702_10404835
658 Ga0207702_10559710
659 Ga0207641_10001735
660 Ga0207641_10051009
661 Ga0207676_10011658
662 Ga0207676_10122746
663 Ga0207674_10003255
664 Ga0207674_10009636
665 Ga0207674_10152495
666 Ga0207674_10278809
667 Ga0207683_10006375
668 Ga0207683_11591507
669 Ga0207698_10000016
670 Ga0207698_10006609
671 Ga0207698_10192235
672 Ga0207698_10324881
673 Ga0207698_10632385
674 Ga0265357_1033376
675 Ga0268266_10019656
676 Ga0268266_10032449
677 Ga0268266_10066536
678 Ga0268266_10196640
679 Ga0268264_10676605
680 Ga0265318_10012119
681 Ga0265336_10005665
682 Ga0265336_10010509
683 Ga0265338_10003648
684 Ga0265338_10003948
685 Ga0265338_10005133
686 Ga0265338_10009837
687 Ga0265760_10178393
688 Ga0265330_10013889
689 Ga0265330_10034519
690 Ga0265328_10005363
691 Ga0265328_10023576
692 Ga0265328_10125995
693 Ga0265320_10110070
694 Ga0265325_10000341
695 Ga0265325_10041954
696 Ga0265325_10044834
697 Ga0265325_10047770
698 Ga0265329_10012083
699 Ga0265340_10006098
700 Ga0265340_10040768
701 Ga0265339_10002181
702 Ga0265339_10002344
703 Ga0265339_10024382
704 Ga0265339_10444992
705 Ga0265331_10182485
706 Ga0265316_10016339
707 Ga0265316_10021227
708 Ga0265316_10088518
709 Ga0265313_10001791
710 Ga0265313_10046338
711 Ga0265313_10343385
712 Ga0265314_10000081
713 Ga0265314_10006624
714 Ga0265314_10022144
715 Ga0265314_10458135
716 Ga0265342_10004607
717 Ga0265342_10093345
718 Ga0265342_10116748
719 Ga0307510_10113600
720 Ga0373954_0398640
721 Ga0373955_0303557
722 Ga0373933_0089457
723 Ga0373937_0003128
724 Ga0373937_0774498
725 Ga0373937_1091626
726 Ga0395898_0319435
727 Ga0395901_1003321
728 Ga0436360_0229674
729 Ga0453683_0489605
730 Ga0466961_0013229
731 Ga0495629_0121073
732 Ga0495629_0842749
733 Ga0495650_0001606
734 Ga0495580_0441266
735 Ga0495594_0891534
736 Ga0495630_0413272
737 Ga0495587_0203242
738 Ga0495625_0000137
739 Ga0495625_0455396
740 Ga0495635_0474352
741 Ga0495599_0602417
742 Ga0495646_0357446
743 Ga0495624_0701701
744 Ga0495604_0286849
745 Ga0495604_0384477
746 Ga0496100_0147973
747 Ga0496100_0773145
748 Ga0496102_1557997
749 Ga0496104_0116641
750 Ga0496104_0187213
751 Ga0496104_1550706
752 Ga0496105_0149531
753 Ga0496105_0508217
754 Ga0496105_0857598
755 Ga0496110_0934508
756 Ga0496110_1162543
757 Ga0496111_1324491
758 Ga0496114_0137577
759 Ga0496115_0081856
760 Ga0496115_0189370
761 Ga0496115_0205354
762 Ga0496115_0550530
763 Ga0496126_0147645
764 Ga0501032_0055564
765 Ga0501033_0004106
766 Ga0501034_0045965
767 Ga0501036_0018460
768 Ga0501037_0011245
769 Ga0501038_0004842
770 Ga0501039_0059922
771 Ga0501043_0002696
772 Ga0501046_0000380
773 Ga0501047_0001862
774 Ga0501068_0263228
775 Ga0501073_0029455
776 Ga0501080_0013349
777 Ga0501035_0006109
778 Ga0501044_0019865
779 Ga0495601_0062814
780 Ga0495595_0535274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nvg-assembly1.cif.gz_q2 salmonella flagellar basal body refined in c1 map 0.9998 11 40
7cgo-assembly1.cif.gz_R cryo-em structure of the flagellar motor-hook complex from salmonella 0.9963 11 41
7cbm-assembly1.cif.gz_U cryo-em structure of the flagellar distal rod with partial hook from salmonella 0.9854 5 40
7cgo-assembly1.cif.gz_P cryo-em structure of the flagellar motor-hook complex from salmonella 0.9803 5 40
7cgo-assembly1.cif.gz_l cryo-em structure of the flagellar motor-hook complex from salmonella 0.9652 10 114
ID Description Score Start End Superfamily
3tagA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.6346 8 117 1.10.287.690
3taeB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.6162 8 117 1.10.287.690
2dtuB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.6075 8 117 1.10.287.690
2ozsA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.6037 8 117 1.10.287.690
af_Q9VCF1_1_233_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5914 6 104 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A388RJ11-F1-model_v4 deleted 0.9532 6 115
AF-A0A7C4AKB9-F1-model_v4 Flagellar basal body rod protein FlgB 0.9509 4 118 GO:0030694
GO:0071978
AF-A0A4Q1SER3-F1-model_v4 Flagellar basal body rod protein FlgB 0.9503 1 117 GO:0030694
GO:0071973
AF-A0A1H5NDI7-F1-model_v4 Flagellar basal body rod protein FlgB 0.9487 8 116 GO:0030694
GO:0071973
AF-A0A3E0WZ67-F1-model_v4 Flagellar basal body rod protein FlgB 0.9473 7 116 GO:0030694
GO:0071973

Map