F431638

General Info

Members Datasets Scaffolds Average Seq Length
390 166 780 106

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100042661|Ga0070680_1000426612
Length 123
Sequence MTRLTGGSIRADIGYSRGMATVPQTESVTRPAQRPRLVFFYSPLSGRCRRVEGFIAQVLQRRRNHDTFDLVRVSVDRRPDLAEKFGIEEVPTICVVQDRKLRRRIAAPRGCRELEQELEPWLH

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.62
Rhizosphere 95.13
Stem 0
Stem Tuber 0
Unclassified 16.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100042661 3300005336 Bacteria 3682
2 Ga0070658_10030830 3300005327 Bacteria 4307
3 Ga0070658_10373116 3300005327 Unclassified 1223
4 Ga0070683_100039898 3300005329 Bacteria 4313
5 Ga0070680_100112160 3300005336 Bacteria 2270
6 Ga0070680_100640012 3300005336 Bacteria 914
7 Ga0070691_10024463 3300005341 Bacteria 2806
8 Ga0070661_100542360 3300005344 Unclassified 935
9 Ga0070661_100635236 3300005344 Unclassified 866
10 Ga0070659_100061611 3300005366 Bacteria 2964
11 Ga0070709_10023377 3300005434 Bacteria 3628
12 Ga0070709_10036729 3300005434 Bacteria 2987
13 Ga0070714_100008975 3300005435 Bacteria 7827
14 Ga0070714_100016982 3300005435 Bacteria 5889
15 Ga0070714_100022212 3300005435 Bacteria 5201
16 Ga0070714_100025488 3300005435 Bacteria 4880
17 Ga0070714_100290894 3300005435 Unclassified 1520
18 Ga0070714_100857056 3300005435 Bacteria 881
19 Ga0070713_100025595 3300005436 Bacteria 4616
20 Ga0070713_100151066 3300005436 Unclassified 2066
21 Ga0070713_100877808 3300005436 Bacteria 862
22 Ga0070710_10100246 3300005437 Unclassified 1723
23 Ga0070710_10614397 3300005437 Unclassified 758
24 Ga0070711_100016338 3300005439 Bacteria 4712
25 Ga0070711_100600313 3300005439 Bacteria 918
26 Ga0070694_100339956 3300005444 Bacteria 1160
27 Ga0070681_10108549 3300005458 Bacteria 2715
28 Ga0070681_10158397 3300005458 Bacteria 2188
29 Ga0070698_100193039 3300005471 Bacteria 1973
30 Ga0070698_100483713 3300005471 Bacteria 1175
31 Ga0070679_100060222 3300005530 Bacteria 3783
32 Ga0070679_100575522 3300005530 Unclassified 1070
33 Ga0070684_100004597 3300005535 Bacteria 10524
34 Ga0070684_100271721 3300005535 Bacteria 1552
35 Ga0070695_100001141 3300005545 Bacteria 14557
36 Ga0070693_100773588 3300005547 Bacteria 709
37 Ga0068855_100117518 3300005563 Bacteria 3047
38 Ga0068856_100206339 3300005614 Unclassified 1980
39 Ga0068856_100594684 3300005614 Bacteria 1127
40 Ga0068852_100641536 3300005616 Bacteria 1069
41 Ga0068852_101963177 3300005616 Bacteria 607
42 Ga0070717_10073944 3300006028 Bacteria 2849
43 Ga0070717_10239436 3300006028 Bacteria 1600
44 Ga0070717_11327806 3300006028 Bacteria 653
45 Ga0070716_100146344 3300006173 Unclassified 1514
46 Ga0070712_100361068 3300006175 Unclassified 1191
47 Ga0070712_100443462 3300006175 Bacteria 1080
48 Ga0070712_100597985 3300006175 Unclassified 933
49 Ga0070712_101047412 3300006175 Unclassified 707
50 Ga0075436_100063878 3300006914 Bacteria 2544
51 Ga0075436_101372332 3300006914 Bacteria 535
52 Ga0105240_10138467 3300009093 Bacteria 2912
53 Ga0105240_11469887 3300009093 Unclassified 715
54 Ga0105237_10046315 3300009545 Bacteria 4374
55 Ga0105237_10676242 3300009545 Bacteria 1039
56 Ga0105239_10278837 3300010375 Bacteria 1881
57 Ga0157370_10274579 3300013104 Bacteria 1557
58 Ga0157369_10092484 3300013105 Bacteria 3228
59 Ga0157369_10211491 3300013105 Bacteria 2032
60 Ga0157369_10307292 3300013105 Bacteria 1649
61 Ga0157372_10213150 3300013307 Bacteria 2238
62 Ga0157372_10371536 3300013307 Bacteria 1666
63 Ga0157372_10494849 3300013307 Bacteria 1426
64 Ga0157376_11510857 3300014969 Unclassified 705
65 Ga0182007_10214621 3300015262 Unclassified 678
66 Ga0197907_10686202 3300020069 Bacteria 1722
67 Ga0197907_11148690 3300020069 Bacteria 2448
68 Ga0206350_10129454 3300020080 Unclassified 573
69 Ga0224712_10029463 3300022467 Bacteria 1972
70 Ga0224712_10087238 3300022467 Bacteria 1300
71 Ga0207692_10406385 3300025898 Bacteria 850
72 Ga0207699_10011500 3300025906 Bacteria 4473
73 Ga0207699_10527857 3300025906 Unclassified 854
74 Ga0207699_10542666 3300025906 Bacteria 843
75 Ga0207705_11081132 3300025909 Unclassified 618
76 Ga0207707_10016264 3300025912 Bacteria 6490
77 Ga0207707_10960660 3300025912 Unclassified 703
78 Ga0207695_10185541 3300025913 Bacteria 1999
79 Ga0207695_10251981 3300025913 Bacteria 1665
80 Ga0207695_10868457 3300025913 Unclassified 782
81 Ga0207671_10042538 3300025914 Bacteria 3362
82 Ga0207693_10003507 3300025915 Bacteria 13396
83 Ga0207693_10054464 3300025915 Bacteria 3137
84 Ga0207693_10577919 3300025915 Unclassified 875
85 Ga0207663_10019019 3300025916 Bacteria 3861
86 Ga0207660_10023653 3300025917 Bacteria 4152
87 Ga0207660_10126759 3300025917 Bacteria 1939
88 Ga0207660_10546575 3300025917 Bacteria 942
89 Ga0207657_10010685 3300025919 Bacteria 9143
90 Ga0207649_10059224 3300025920 Bacteria 2402
91 Ga0207652_10054182 3300025921 Bacteria 3447
92 Ga0207694_10778276 3300025924 Bacteria 808
93 Ga0207687_10810356 3300025927 Bacteria 799
94 Ga0207700_10403800 3300025928 Unclassified 1198
95 Ga0207664_10015331 3300025929 Bacteria 5557
96 Ga0207664_10053726 3300025929 Bacteria 3190
97 Ga0207664_10072024 3300025929 Bacteria 2785
98 Ga0207664_10238097 3300025929 Unclassified 1584
99 Ga0207664_10298490 3300025929 Bacteria 1417
100 Ga0207664_10469869 3300025929 Bacteria 1124
101 Ga0207664_10794707 3300025929 Bacteria 851
102 Ga0207644_10526940 3300025931 Bacteria 976
103 Ga0207690_10582245 3300025932 Bacteria 912
104 Ga0207665_10212420 3300025939 Unclassified 1414
105 Ga0207665_11258082 3300025939 Bacteria 590
106 Ga0207667_10113886 3300025949 Bacteria 2788
107 Ga0207639_11510328 3300026041 Unclassified 630
108 Ga0207702_10407979 3300026078 Unclassified 1311
109 Ga0207702_10737234 3300026078 Bacteria 972
110 Ga0207674_10430911 3300026116 Bacteria 1274
111 Ga0207698_10739871 3300026142 Bacteria 981
112 Ga0207698_10776646 3300026142 Unclassified 959
113 Ga0265337_1024314 3300028556 Bacteria 1855
114 Ga0265338_10085501 3300028800 Bacteria 2628
115 Ga0265332_10150541 3300031238 Bacteria 973
116 Ga0265339_10051908 3300031249 Bacteria 2235
117 Ga0265339_10312956 3300031249 Bacteria 746
118 Ga0265331_10058255 3300031250 Bacteria 1829
119 Ga0265331_10298381 3300031250 Bacteria 722
120 Ga0265327_10271801 3300031251 Bacteria 751
121 Ga0265316_10094227 3300031344 Bacteria 2281
122 Ga0265314_10095821 3300031711 Bacteria 1920
123 Ga0265342_10060651 3300031712 Bacteria 2230
124 Ga0373926_0355440 3300035083 Unclassified 575
125 Ga0373934_0134367 3300035086 Bacteria 1010
126 Ga0373944_0011609 3300035089 Bacteria 2416
127 Ga0373936_0145918 3300035113 Bacteria 1024
128 Ga0373953_0448990 3300035117 Unclassified 570
129 Ga0373954_0272827 3300035118 Bacteria 834
130 Ga0373954_0371709 3300035118 Bacteria 706
131 Ga0373956_0188573 3300035119 Bacteria 976
132 Ga0373943_0002185 3300035170 Bacteria 8897
133 Ga0373946_0092059 3300035171 Bacteria 1345
134 Ga0373955_0054513 3300035172 Bacteria 2187
135 Ga0373955_0248013 3300035172 Bacteria 1067
136 Ga0373924_0051334 3300035410 Bacteria 1710
137 Ga0373924_0168280 3300035410 Bacteria 963
138 Ga0373931_0144835 3300035691 Bacteria 1380
139 Ga0373927_0040229 3300035695 Bacteria 3034
140 Ga0373933_0113495 3300035724 Bacteria 1692
141 Ga0373933_0245670 3300035724 Bacteria 1152
142 Ga0373933_0295065 3300035724 Bacteria 1049
143 Ga0373947_0001831 3300035725 Bacteria 13012
144 Ga0373937_0000308 3300036401 Bacteria 46115
145 Ga0373937_0844960 3300036401 Unclassified 864
146 Ga0373925_0001399 3300037068 Bacteria 20978
147 Ga0395900_0207206 3300037418 Bacteria 1981
148 Ga0395898_0070355 3300037466 Bacteria 3383
149 Ga0395898_1681625 3300037466 Unclassified 558
150 Ga0395901_0032177 3300038443 Bacteria 5413
151 Ga0466969_0001118 3300044656 Bacteria 14481
152 Ga0466969_0008428 3300044656 Bacteria 5467
153 Ga0466969_0044143 3300044656 Bacteria 2219
154 Ga0466969_0059439 3300044656 Bacteria 1859
155 Ga0466969_0129344 3300044656 Bacteria 1171
156 Ga0466969_0180909 3300044656 Bacteria 965
157 Ga0466965_0057132 3300044683 Bacteria 1944
158 Ga0466965_0109076 3300044683 Bacteria 1421
159 Ga0466965_0296783 3300044683 Bacteria 876
160 Ga0466966_0061836 3300044684 Bacteria 2361
161 Ga0466966_0088643 3300044684 Bacteria 1922
162 Ga0466966_0103550 3300044684 Bacteria 1759
163 Ga0466966_0217497 3300044684 Bacteria 1154
164 Ga0466966_0400975 3300044684 Bacteria 824
165 Ga0466961_0001935 3300044693 Bacteria 12908
166 Ga0466961_0005003 3300044693 Bacteria 8335
167 Ga0466961_0015993 3300044693 Bacteria 4816
168 Ga0466961_0029040 3300044693 Bacteria 3556
169 Ga0466961_0035369 3300044693 Bacteria 3208
170 Ga0466961_0114877 3300044693 Bacteria 1692
171 Ga0466961_0156745 3300044693 Bacteria 1420
172 Ga0466963_0000063 3300044694 Bacteria 36209
173 Ga0466963_0001173 3300044694 Bacteria 13751
174 Ga0466963_0004689 3300044694 Bacteria 7979
175 Ga0466963_0006929 3300044694 Bacteria 6743
176 Ga0466963_0010349 3300044694 Bacteria 5646
177 Ga0466963_0011197 3300044694 Bacteria 5459
178 Ga0466963_0013481 3300044694 Bacteria 5019
179 Ga0466963_0016086 3300044694 Bacteria 4646
180 Ga0466963_0057183 3300044694 Bacteria 2597
181 Ga0466963_0100063 3300044694 Bacteria 1983
182 Ga0466963_0285282 3300044694 Bacteria 1160
183 Ga0466963_0379060 3300044694 Unclassified 997
184 Ga0466963_0388638 3300044694 Bacteria 984
185 Ga0466963_0412436 3300044694 Bacteria 952
186 Ga0466963_0741810 3300044694 Unclassified 693
187 Ga0466964_0010377 3300044706 Bacteria 3514
188 Ga0466964_0022167 3300044706 Bacteria 2461
189 Ga0466964_0025843 3300044706 Bacteria 2295
190 Ga0466964_0152064 3300044706 Bacteria 1074
191 Ga0466964_0177540 3300044706 Bacteria 1007
192 Ga0466964_0439859 3300044706 Unclassified 689
193 Ga0466971_0008678 3300044719 Bacteria 4434
194 Ga0466971_0012914 3300044719 Bacteria 3663
195 Ga0466971_0097736 3300044719 Bacteria 1347
196 Ga0466971_0298409 3300044719 Bacteria 773
197 Ga0466968_0004165 3300044735 Bacteria 5388
198 Ga0466968_0008070 3300044735 Bacteria 4025
199 Ga0466968_0033012 3300044735 Bacteria 2156
200 Ga0466968_0059025 3300044735 Bacteria 1652
201 Ga0466968_0133195 3300044735 Bacteria 1132
202 Ga0466968_0144415 3300044735 Bacteria 1090
203 Ga0466968_0185585 3300044735 Bacteria 969
204 Ga0466968_0229363 3300044735 Bacteria 877
205 Ga0466968_0340370 3300044735 Archaea 727
206 Ga0466970_0028193 3300044765 Bacteria 2949
207 Ga0466970_0375002 3300044765 Bacteria 809
208 Ga0466957_0005605 3300044842 Bacteria 7055
209 Ga0466957_0017834 3300044842 Bacteria 4164
210 Ga0466957_0027287 3300044842 Bacteria 3393
211 Ga0466957_0033886 3300044842 Bacteria 3064
212 Ga0466957_0040495 3300044842 Bacteria 2814
213 Ga0466957_0048335 3300044842 Bacteria 2586
214 Ga0466957_0132014 3300044842 Bacteria 1601
215 Ga0466957_0368887 3300044842 Bacteria 977
216 Ga0466957_0544311 3300044842 Bacteria 808
217 Ga0466960_0049246 3300044901 Bacteria 2028
218 Ga0466960_0219164 3300044901 Unclassified 1046
219 Ga0466960_0267688 3300044901 Bacteria 954
220 Ga0466959_0002510 3300045049 Bacteria 11759
221 Ga0466959_0007364 3300045049 Bacteria 7717
222 Ga0466959_0027876 3300045049 Bacteria 4189
223 Ga0466959_0046851 3300045049 Bacteria 3181
224 Ga0466959_0050460 3300045049 Bacteria 3054
225 Ga0466958_0002452 3300045836 Bacteria 9314
226 Ga0466958_0003539 3300045836 Bacteria 8123
227 Ga0466958_0006209 3300045836 Bacteria 6485
228 Ga0466958_0008111 3300045836 Bacteria 5811
229 Ga0466958_0010125 3300045836 Bacteria 5271
230 Ga0466958_0011741 3300045836 Bacteria 4944
231 Ga0466958_0025985 3300045836 Bacteria 3457
232 Ga0466958_0070526 3300045836 Bacteria 2138
233 Ga0466958_0112053 3300045836 Bacteria 1703
234 Ga0466958_0418375 3300045836 Unclassified 866
235 Ga0466958_0882643 3300045836 Unclassified 583
236 Ga0466967_0010076 3300045976 Bacteria 7064
237 Ga0466967_0011084 3300045976 Bacteria 6807
238 Ga0466967_0018865 3300045976 Bacteria 5530
239 Ga0466967_0022589 3300045976 Bacteria 5136
240 Ga0466967_0028091 3300045976 Bacteria 4691
241 Ga0466967_0042535 3300045976 Bacteria 3927
242 Ga0466967_0058028 3300045976 Bacteria 3419
243 Ga0466967_0069471 3300045976 Bacteria 3148
244 Ga0466967_0102470 3300045976 Bacteria 2618
245 Ga0466967_0129682 3300045976 Bacteria 2339
246 Ga0466967_0177243 3300045976 Bacteria 2008
247 Ga0466967_0223687 3300045976 Bacteria 1789
248 Ga0466967_0348468 3300045976 Bacteria 1433
249 Ga0466967_0353136 3300045976 Bacteria 1423
250 Ga0466967_0368663 3300045976 Bacteria 1392
251 Ga0466967_0546115 3300045976 Bacteria 1140
252 Ga0466967_0645955 3300045976 Bacteria 1046
253 Ga0466967_0829696 3300045976 Bacteria 918
254 Ga0466967_1044171 3300045976 Unclassified 814
255 Ga0466967_1594461 3300045976 Unclassified 650
256 Ga0495592_0000410 3300046454 Bacteria 32753
257 Ga0495592_0122926 3300046454 Bacteria 1824
258 Ga0495592_0429525 3300046454 Bacteria 831
259 Ga0495629_0023903 3300046459 Bacteria 4352
260 Ga0495629_0026042 3300046459 Bacteria 4156
261 Ga0495641_0005629 3300046461 Bacteria 8372
262 Ga0495641_0043617 3300046461 Bacteria 2074
263 Ga0495641_0049424 3300046461 Bacteria 1925
264 Ga0495641_0059508 3300046461 Unclassified 1727
265 Ga0495651_0000034 3300046462 Bacteria 99213
266 Ga0495653_0001634 3300046463 Bacteria 17597
267 Ga0495653_0007842 3300046463 Bacteria 8742
268 Ga0495653_0043772 3300046463 Unclassified 3478
269 Ga0495580_0060479 3300046472 Bacteria 2661
270 Ga0495582_0013890 3300046473 Bacteria 4435
271 Ga0495582_0268866 3300046473 Bacteria 978
272 Ga0495582_0384003 3300046473 Bacteria 809
273 Ga0495639_0004963 3300046475 Bacteria 5706
274 Ga0495662_0005815 3300046476 Bacteria 6172
275 Ga0495662_0300659 3300046476 Bacteria 789
276 Ga0495664_0003716 3300046477 Bacteria 8323
277 Ga0495664_0216257 3300046477 Bacteria 1160
278 Ga0495664_0281734 3300046477 Bacteria 1004
279 Ga0495664_0485460 3300046477 Unclassified 738
280 Ga0495594_0837661 3300046499 Bacteria 518
281 Ga0495608_0001004 3300046511 Bacteria 19861
282 Ga0495608_0009477 3300046511 Bacteria 6803
283 Ga0495608_0177246 3300046511 Unclassified 1350
284 Ga0495618_0008709 3300046514 Bacteria 6132
285 Ga0495618_0010292 3300046514 Bacteria 5658
286 Ga0495618_0261595 3300046514 Bacteria 1083
287 Ga0495628_0004501 3300046516 Bacteria 12347
288 Ga0495628_0465520 3300046516 Bacteria 916
289 Ga0495630_0051981 3300046517 Bacteria 3067
290 Ga0495630_0117703 3300046517 Bacteria 2014
291 Ga0495630_0185143 3300046517 Bacteria 1588
292 Ga0495666_0001186 3300046526 Bacteria 12548
293 Ga0495666_0461620 3300046526 Bacteria 569
294 Ga0495652_0000319 3300046529 Bacteria 56845
295 Ga0495652_0116557 3300046529 Bacteria 2138
296 Ga0495652_0303955 3300046529 Bacteria 1158
297 Ga0495665_0003752 3300046531 Bacteria 8219
298 Ga0495640_0010802 3300046533 Bacteria 7043
299 Ga0495640_0038013 3300046533 Unclassified 3389
300 Ga0495640_0055087 3300046533 Bacteria 2721
301 Ga0495586_0028377 3300046535 Bacteria 2994
302 Ga0495586_0228676 3300046535 Unclassified 1058
303 Ga0495587_0000055 3300046536 Bacteria 97024
304 Ga0495587_0195806 3300046536 Bacteria 1143
305 Ga0495645_0000170 3300046543 Bacteria 45455
306 Ga0495645_0128889 3300046543 Bacteria 1775
307 Ga0495645_0225655 3300046543 Bacteria 1257
308 Ga0495667_0026892 3300046559 Bacteria 3877
309 Ga0495667_1022708 3300046559 Unclassified 503
310 Ga0495634_0045509 3300046642 Bacteria 2965
311 Ga0495634_0360663 3300046642 Unclassified 869
312 Ga0495635_0011475 3300046663 Bacteria 6212
313 Ga0495635_0011569 3300046663 Bacteria 6186
314 Ga0495635_0051587 3300046663 Unclassified 2833
315 Ga0495657_0014781 3300046675 Bacteria 5728
316 Ga0495599_0001220 3300046678 Bacteria 14572
317 Ga0495599_0145157 3300046678 Bacteria 1471
318 Ga0495623_0000149 3300046679 Bacteria 42958
319 Ga0495646_0036349 3300046680 Bacteria 3051
320 Ga0495647_0002686 3300046681 Bacteria 5650
321 Ga0495647_0206589 3300046681 Bacteria 863
322 Ga0495658_0004111 3300046683 Bacteria 7167
323 Ga0495658_0043605 3300046683 Bacteria 2510
324 Ga0495613_0091926 3300046689 Bacteria 2197
325 Ga0495613_0157864 3300046689 Bacteria 1615
326 Ga0495624_0011996 3300046690 Bacteria 5938
327 Ga0495600_0031617 3300046809 Bacteria 3430
328 Ga0495600_0747800 3300046809 Unclassified 585
329 Ga0495581_0005286 3300047315 Bacteria 7468
330 Ga0495581_0330090 3300047315 Bacteria 891
331 Ga0495604_0001048 3300047317 Bacteria 22980
332 Ga0495604_0637691 3300047317 Unclassified 680
333 Ga0495674_0009278 3300047319 Bacteria 9349
334 Ga0495674_0023647 3300047319 Bacteria 5658
335 Ga0495674_0348571 3300047319 Bacteria 1202
336 Ga0495674_1057583 3300047319 Unclassified 619
337 Ga0495676_0034894 3300047321 Bacteria 4214
338 Ga0495676_0478396 3300047321 Bacteria 819
339 Ga0495680_0126315 3300047322 Bacteria 1883
340 Ga0495680_0210678 3300047322 Bacteria 1391
341 Ga0495675_0000029 3300047444 Bacteria 105305
342 Ga0495675_0081328 3300047444 Bacteria 2040
343 Ga0495684_0008421 3300047471 Bacteria 7990
344 Ga0495684_0011049 3300047471 Bacteria 6982
345 Ga0495684_0063160 3300047471 Bacteria 2815
346 Ga0495684_0509036 3300047471 Unclassified 826
347 Ga0495593_0000750 3300047673 Bacteria 18855
348 Ga0495593_0203942 3300047673 Unclassified 994
349 Ga0495602_0000741 3300048088 Bacteria 30911
350 Ga0495602_0237775 3300048088 Bacteria 1364
351 Ga0495614_0000802 3300048089 Bacteria 13308
352 Ga0496101_0288760 3300048904 Unclassified 1283
353 Ga0496101_0506515 3300048904 Unclassified 954
354 Ga0496102_0035214 3300048905 Bacteria 4505
355 Ga0496103_0087820 3300048906 Bacteria 1960
356 Ga0496105_0104055 3300048908 Bacteria 2344
357 Ga0496107_0172702 3300048910 Bacteria 1604
358 Ga0496108_0048445 3300048911 Bacteria 3553
359 Ga0496108_1393794 3300048911 Unclassified 587
360 Ga0496109_0028648 3300048912 Bacteria 4983
361 Ga0496109_0101269 3300048912 Bacteria 2673
362 Ga0496111_0028079 3300048914 Bacteria 3986
363 Ga0496112_0684982 3300048915 Bacteria 953
364 Ga0496114_0023553 3300048917 Bacteria 5025
365 Ga0496115_0053205 3300048918 Bacteria 3248
366 Ga0496115_0211611 3300048918 Unclassified 1601
367 Ga0496115_0531505 3300048918 Bacteria 942
368 Ga0496115_0717056 3300048918 Bacteria 785
369 Ga0496115_0723109 3300048918 Unclassified 781
370 Ga0501067_0310941 3300049583 Bacteria 878
371 nmdc:mga08x19_1211761_c1 3300050514 Bacteria 535
372 nmdc:mga08x19_320156_c1 3300050514 Bacteria 1079
373 Ga0495601_0000082 3300053077 Bacteria 51242
374 Ga0495601_0026834 3300053077 Bacteria 3558
375 Ga0495601_0237359 3300053077 Unclassified 1190
376 Ga0495601_0411895 3300053077 Unclassified 876
377 Ga0495612_0001482 3300053078 Bacteria 9660
378 Ga0495612_0160459 3300053078 Bacteria 981
379 Ga0495595_0034057 3300053084 Bacteria 2302
380 Ga0495595_0125814 3300053084 Unclassified 1250
381 Ga0495619_0004080 3300053085 Bacteria 9348
382 Ga0495619_0006116 3300053085 Bacteria 7624
383 Ga0495619_0029797 3300053085 Bacteria 3528
384 Ga0495619_0869388 3300053085 Unclassified 607
385 Ga0500566_0489808 3300053094 Unclassified 531
386 Ga0466962_0001705 3300061719 Bacteria 10322
387 Ga0466962_0003049 3300061719 Bacteria 7986
388 Ga0466962_0016734 3300061719 Bacteria 3534
389 Ga0466962_0159010 3300061719 Bacteria 1098
390 Ga0466962_0209954 3300061719 Bacteria 952
391 Ga0070680_100042661
392 Ga0070658_10030830
393 Ga0070658_10373116
394 Ga0070683_100039898
395 Ga0070680_100112160
396 Ga0070680_100640012
397 Ga0070691_10024463
398 Ga0070661_100542360
399 Ga0070661_100635236
400 Ga0070659_100061611
401 Ga0070709_10023377
402 Ga0070709_10036729
403 Ga0070714_100008975
404 Ga0070714_100016982
405 Ga0070714_100022212
406 Ga0070714_100025488
407 Ga0070714_100290894
408 Ga0070714_100857056
409 Ga0070713_100025595
410 Ga0070713_100151066
411 Ga0070713_100877808
412 Ga0070710_10100246
413 Ga0070710_10614397
414 Ga0070711_100016338
415 Ga0070711_100600313
416 Ga0070694_100339956
417 Ga0070681_10108549
418 Ga0070681_10158397
419 Ga0070698_100193039
420 Ga0070698_100483713
421 Ga0070679_100060222
422 Ga0070679_100575522
423 Ga0070684_100004597
424 Ga0070684_100271721
425 Ga0070695_100001141
426 Ga0070693_100773588
427 Ga0068855_100117518
428 Ga0068856_100206339
429 Ga0068856_100594684
430 Ga0068852_100641536
431 Ga0068852_101963177
432 Ga0070717_10073944
433 Ga0070717_10239436
434 Ga0070717_11327806
435 Ga0070716_100146344
436 Ga0070712_100361068
437 Ga0070712_100443462
438 Ga0070712_100597985
439 Ga0070712_101047412
440 Ga0075436_100063878
441 Ga0075436_101372332
442 Ga0105240_10138467
443 Ga0105240_11469887
444 Ga0105237_10046315
445 Ga0105237_10676242
446 Ga0105239_10278837
447 Ga0157370_10274579
448 Ga0157369_10092484
449 Ga0157369_10211491
450 Ga0157369_10307292
451 Ga0157372_10213150
452 Ga0157372_10371536
453 Ga0157372_10494849
454 Ga0157376_11510857
455 Ga0182007_10214621
456 Ga0197907_10686202
457 Ga0197907_11148690
458 Ga0206350_10129454
459 Ga0224712_10029463
460 Ga0224712_10087238
461 Ga0207692_10406385
462 Ga0207699_10011500
463 Ga0207699_10527857
464 Ga0207699_10542666
465 Ga0207705_11081132
466 Ga0207707_10016264
467 Ga0207707_10960660
468 Ga0207695_10185541
469 Ga0207695_10251981
470 Ga0207695_10868457
471 Ga0207671_10042538
472 Ga0207693_10003507
473 Ga0207693_10054464
474 Ga0207693_10577919
475 Ga0207663_10019019
476 Ga0207660_10023653
477 Ga0207660_10126759
478 Ga0207660_10546575
479 Ga0207657_10010685
480 Ga0207649_10059224
481 Ga0207652_10054182
482 Ga0207694_10778276
483 Ga0207687_10810356
484 Ga0207700_10403800
485 Ga0207664_10015331
486 Ga0207664_10053726
487 Ga0207664_10072024
488 Ga0207664_10238097
489 Ga0207664_10298490
490 Ga0207664_10469869
491 Ga0207664_10794707
492 Ga0207644_10526940
493 Ga0207690_10582245
494 Ga0207665_10212420
495 Ga0207665_11258082
496 Ga0207667_10113886
497 Ga0207639_11510328
498 Ga0207702_10407979
499 Ga0207702_10737234
500 Ga0207674_10430911
501 Ga0207698_10739871
502 Ga0207698_10776646
503 Ga0265337_1024314
504 Ga0265338_10085501
505 Ga0265332_10150541
506 Ga0265339_10051908
507 Ga0265339_10312956
508 Ga0265331_10058255
509 Ga0265331_10298381
510 Ga0265327_10271801
511 Ga0265316_10094227
512 Ga0265314_10095821
513 Ga0265342_10060651
514 Ga0373926_0355440
515 Ga0373934_0134367
516 Ga0373944_0011609
517 Ga0373936_0145918
518 Ga0373953_0448990
519 Ga0373954_0272827
520 Ga0373954_0371709
521 Ga0373956_0188573
522 Ga0373943_0002185
523 Ga0373946_0092059
524 Ga0373955_0054513
525 Ga0373955_0248013
526 Ga0373924_0051334
527 Ga0373924_0168280
528 Ga0373931_0144835
529 Ga0373927_0040229
530 Ga0373933_0113495
531 Ga0373933_0245670
532 Ga0373933_0295065
533 Ga0373947_0001831
534 Ga0373937_0000308
535 Ga0373937_0844960
536 Ga0373925_0001399
537 Ga0395900_0207206
538 Ga0395898_0070355
539 Ga0395898_1681625
540 Ga0395901_0032177
541 Ga0466969_0001118
542 Ga0466969_0008428
543 Ga0466969_0044143
544 Ga0466969_0059439
545 Ga0466969_0129344
546 Ga0466969_0180909
547 Ga0466965_0057132
548 Ga0466965_0109076
549 Ga0466965_0296783
550 Ga0466966_0061836
551 Ga0466966_0088643
552 Ga0466966_0103550
553 Ga0466966_0217497
554 Ga0466966_0400975
555 Ga0466961_0001935
556 Ga0466961_0005003
557 Ga0466961_0015993
558 Ga0466961_0029040
559 Ga0466961_0035369
560 Ga0466961_0114877
561 Ga0466961_0156745
562 Ga0466963_0000063
563 Ga0466963_0001173
564 Ga0466963_0004689
565 Ga0466963_0006929
566 Ga0466963_0010349
567 Ga0466963_0011197
568 Ga0466963_0013481
569 Ga0466963_0016086
570 Ga0466963_0057183
571 Ga0466963_0100063
572 Ga0466963_0285282
573 Ga0466963_0379060
574 Ga0466963_0388638
575 Ga0466963_0412436
576 Ga0466963_0741810
577 Ga0466964_0010377
578 Ga0466964_0022167
579 Ga0466964_0025843
580 Ga0466964_0152064
581 Ga0466964_0177540
582 Ga0466964_0439859
583 Ga0466971_0008678
584 Ga0466971_0012914
585 Ga0466971_0097736
586 Ga0466971_0298409
587 Ga0466968_0004165
588 Ga0466968_0008070
589 Ga0466968_0033012
590 Ga0466968_0059025
591 Ga0466968_0133195
592 Ga0466968_0144415
593 Ga0466968_0185585
594 Ga0466968_0229363
595 Ga0466968_0340370
596 Ga0466970_0028193
597 Ga0466970_0375002
598 Ga0466957_0005605
599 Ga0466957_0017834
600 Ga0466957_0027287
601 Ga0466957_0033886
602 Ga0466957_0040495
603 Ga0466957_0048335
604 Ga0466957_0132014
605 Ga0466957_0368887
606 Ga0466957_0544311
607 Ga0466960_0049246
608 Ga0466960_0219164
609 Ga0466960_0267688
610 Ga0466959_0002510
611 Ga0466959_0007364
612 Ga0466959_0027876
613 Ga0466959_0046851
614 Ga0466959_0050460
615 Ga0466958_0002452
616 Ga0466958_0003539
617 Ga0466958_0006209
618 Ga0466958_0008111
619 Ga0466958_0010125
620 Ga0466958_0011741
621 Ga0466958_0025985
622 Ga0466958_0070526
623 Ga0466958_0112053
624 Ga0466958_0418375
625 Ga0466958_0882643
626 Ga0466967_0010076
627 Ga0466967_0011084
628 Ga0466967_0018865
629 Ga0466967_0022589
630 Ga0466967_0028091
631 Ga0466967_0042535
632 Ga0466967_0058028
633 Ga0466967_0069471
634 Ga0466967_0102470
635 Ga0466967_0129682
636 Ga0466967_0177243
637 Ga0466967_0223687
638 Ga0466967_0348468
639 Ga0466967_0353136
640 Ga0466967_0368663
641 Ga0466967_0546115
642 Ga0466967_0645955
643 Ga0466967_0829696
644 Ga0466967_1044171
645 Ga0466967_1594461
646 Ga0495592_0000410
647 Ga0495592_0122926
648 Ga0495592_0429525
649 Ga0495629_0023903
650 Ga0495629_0026042
651 Ga0495641_0005629
652 Ga0495641_0043617
653 Ga0495641_0049424
654 Ga0495641_0059508
655 Ga0495651_0000034
656 Ga0495653_0001634
657 Ga0495653_0007842
658 Ga0495653_0043772
659 Ga0495580_0060479
660 Ga0495582_0013890
661 Ga0495582_0268866
662 Ga0495582_0384003
663 Ga0495639_0004963
664 Ga0495662_0005815
665 Ga0495662_0300659
666 Ga0495664_0003716
667 Ga0495664_0216257
668 Ga0495664_0281734
669 Ga0495664_0485460
670 Ga0495594_0837661
671 Ga0495608_0001004
672 Ga0495608_0009477
673 Ga0495608_0177246
674 Ga0495618_0008709
675 Ga0495618_0010292
676 Ga0495618_0261595
677 Ga0495628_0004501
678 Ga0495628_0465520
679 Ga0495630_0051981
680 Ga0495630_0117703
681 Ga0495630_0185143
682 Ga0495666_0001186
683 Ga0495666_0461620
684 Ga0495652_0000319
685 Ga0495652_0116557
686 Ga0495652_0303955
687 Ga0495665_0003752
688 Ga0495640_0010802
689 Ga0495640_0038013
690 Ga0495640_0055087
691 Ga0495586_0028377
692 Ga0495586_0228676
693 Ga0495587_0000055
694 Ga0495587_0195806
695 Ga0495645_0000170
696 Ga0495645_0128889
697 Ga0495645_0225655
698 Ga0495667_0026892
699 Ga0495667_1022708
700 Ga0495634_0045509
701 Ga0495634_0360663
702 Ga0495635_0011475
703 Ga0495635_0011569
704 Ga0495635_0051587
705 Ga0495657_0014781
706 Ga0495599_0001220
707 Ga0495599_0145157
708 Ga0495623_0000149
709 Ga0495646_0036349
710 Ga0495647_0002686
711 Ga0495647_0206589
712 Ga0495658_0004111
713 Ga0495658_0043605
714 Ga0495613_0091926
715 Ga0495613_0157864
716 Ga0495624_0011996
717 Ga0495600_0031617
718 Ga0495600_0747800
719 Ga0495581_0005286
720 Ga0495581_0330090
721 Ga0495604_0001048
722 Ga0495604_0637691
723 Ga0495674_0009278
724 Ga0495674_0023647
725 Ga0495674_0348571
726 Ga0495674_1057583
727 Ga0495676_0034894
728 Ga0495676_0478396
729 Ga0495680_0126315
730 Ga0495680_0210678
731 Ga0495675_0000029
732 Ga0495675_0081328
733 Ga0495684_0008421
734 Ga0495684_0011049
735 Ga0495684_0063160
736 Ga0495684_0509036
737 Ga0495593_0000750
738 Ga0495593_0203942
739 Ga0495602_0000741
740 Ga0495602_0237775
741 Ga0495614_0000802
742 Ga0496101_0288760
743 Ga0496101_0506515
744 Ga0496102_0035214
745 Ga0496103_0087820
746 Ga0496105_0104055
747 Ga0496107_0172702
748 Ga0496108_0048445
749 Ga0496108_1393794
750 Ga0496109_0028648
751 Ga0496109_0101269
752 Ga0496111_0028079
753 Ga0496112_0684982
754 Ga0496114_0023553
755 Ga0496115_0053205
756 Ga0496115_0211611
757 Ga0496115_0531505
758 Ga0496115_0717056
759 Ga0496115_0723109
760 Ga0501067_0310941
761 nmdc:mga08x19_1211761_c1
762 nmdc:mga08x19_320156_c1
763 Ga0495601_0000082
764 Ga0495601_0026834
765 Ga0495601_0237359
766 Ga0495601_0411895
767 Ga0495612_0001482
768 Ga0495612_0160459
769 Ga0495595_0034057
770 Ga0495595_0125814
771 Ga0495619_0004080
772 Ga0495619_0006116
773 Ga0495619_0029797
774 Ga0495619_0869388
775 Ga0500566_0489808
776 Ga0466962_0001705
777 Ga0466962_0003049
778 Ga0466962_0016734
779 Ga0466962_0159010
780 Ga0466962_0209954

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

21

120

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xao-assembly1.cif.gz_B crystal structure of thioredoxin 1 0.9199 17 102
7c3f-assembly4.cif.gz_L crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex 0.917 17 104
3hz4-assembly1.cif.gz_B crystal structure of thioredoxin from methanosarcina mazei 0.9166 16 102
5j7d-assembly7.cif.gz_G computationally designed thioredoxin df106 0.9141 15 88
4pob-assembly1.cif.gz_B crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus 0.914 15 104
ID Description Score Start End Superfamily
1v98B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9117 17 103 3.40.30.10
af_P47938_1_107_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9077 14 88 3.40.30.10
3hz4B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9074 16 103 3.40.30.10
af_Q9SKB6_214_310_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9062 16 87 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8979 16 104 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538D1N8-F1-model_v4 Thioredoxin family protein 0.9844 18 105
AF-A0A538G5E9-F1-model_v4 Thioredoxin family protein 0.9641 8 105
AF-A0A538D1N8-F1-model_v4 Thioredoxin family protein 0.9628 18 105
AF-A0A4Y3QL65-F1-model_v4 Thioredoxin 0.9419 17 105 GO:0005829
GO:0015035
GO:0045454
AF-A0A0G4I2U0-F1-model_v4 Thioredoxin domain-containing protein 0.939 17 101 GO:0005737
GO:0015035

Map