F431638
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 390 | 166 | 780 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100042661|Ga0070680_1000426612 |
| Length | 123 |
| Sequence | MTRLTGGSIRADIGYSRGMATVPQTESVTRPAQRPRLVFFYSPLSGRCRRVEGFIAQVLQRRRNHDTFDLVRVSVDRRPDLAEKFGIEEVPTICVVQDRKLRRRIAAPRGCRELEQELEPWLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 26 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 34 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 35 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 37 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 62 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 63 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 64 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 65 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 66 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 67 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 68 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 70 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 71 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 72 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 73 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 74 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 75 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 76 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 77 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 78 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 79 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 80 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 81 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 82 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 83 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 84 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 85 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 86 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 88 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 89 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 90 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 91 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 92 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 93 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 94 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 95 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 96 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 97 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 98 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 99 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 100 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 103 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 104 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 158 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 159 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 166 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 4.62 |
| Rhizosphere | 95.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100042661 | 3300005336 | Bacteria | 3682 |
| 2 | Ga0070658_10030830 | 3300005327 | Bacteria | 4307 |
| 3 | Ga0070658_10373116 | 3300005327 | Unclassified | 1223 |
| 4 | Ga0070683_100039898 | 3300005329 | Bacteria | 4313 |
| 5 | Ga0070680_100112160 | 3300005336 | Bacteria | 2270 |
| 6 | Ga0070680_100640012 | 3300005336 | Bacteria | 914 |
| 7 | Ga0070691_10024463 | 3300005341 | Bacteria | 2806 |
| 8 | Ga0070661_100542360 | 3300005344 | Unclassified | 935 |
| 9 | Ga0070661_100635236 | 3300005344 | Unclassified | 866 |
| 10 | Ga0070659_100061611 | 3300005366 | Bacteria | 2964 |
| 11 | Ga0070709_10023377 | 3300005434 | Bacteria | 3628 |
| 12 | Ga0070709_10036729 | 3300005434 | Bacteria | 2987 |
| 13 | Ga0070714_100008975 | 3300005435 | Bacteria | 7827 |
| 14 | Ga0070714_100016982 | 3300005435 | Bacteria | 5889 |
| 15 | Ga0070714_100022212 | 3300005435 | Bacteria | 5201 |
| 16 | Ga0070714_100025488 | 3300005435 | Bacteria | 4880 |
| 17 | Ga0070714_100290894 | 3300005435 | Unclassified | 1520 |
| 18 | Ga0070714_100857056 | 3300005435 | Bacteria | 881 |
| 19 | Ga0070713_100025595 | 3300005436 | Bacteria | 4616 |
| 20 | Ga0070713_100151066 | 3300005436 | Unclassified | 2066 |
| 21 | Ga0070713_100877808 | 3300005436 | Bacteria | 862 |
| 22 | Ga0070710_10100246 | 3300005437 | Unclassified | 1723 |
| 23 | Ga0070710_10614397 | 3300005437 | Unclassified | 758 |
| 24 | Ga0070711_100016338 | 3300005439 | Bacteria | 4712 |
| 25 | Ga0070711_100600313 | 3300005439 | Bacteria | 918 |
| 26 | Ga0070694_100339956 | 3300005444 | Bacteria | 1160 |
| 27 | Ga0070681_10108549 | 3300005458 | Bacteria | 2715 |
| 28 | Ga0070681_10158397 | 3300005458 | Bacteria | 2188 |
| 29 | Ga0070698_100193039 | 3300005471 | Bacteria | 1973 |
| 30 | Ga0070698_100483713 | 3300005471 | Bacteria | 1175 |
| 31 | Ga0070679_100060222 | 3300005530 | Bacteria | 3783 |
| 32 | Ga0070679_100575522 | 3300005530 | Unclassified | 1070 |
| 33 | Ga0070684_100004597 | 3300005535 | Bacteria | 10524 |
| 34 | Ga0070684_100271721 | 3300005535 | Bacteria | 1552 |
| 35 | Ga0070695_100001141 | 3300005545 | Bacteria | 14557 |
| 36 | Ga0070693_100773588 | 3300005547 | Bacteria | 709 |
| 37 | Ga0068855_100117518 | 3300005563 | Bacteria | 3047 |
| 38 | Ga0068856_100206339 | 3300005614 | Unclassified | 1980 |
| 39 | Ga0068856_100594684 | 3300005614 | Bacteria | 1127 |
| 40 | Ga0068852_100641536 | 3300005616 | Bacteria | 1069 |
| 41 | Ga0068852_101963177 | 3300005616 | Bacteria | 607 |
| 42 | Ga0070717_10073944 | 3300006028 | Bacteria | 2849 |
| 43 | Ga0070717_10239436 | 3300006028 | Bacteria | 1600 |
| 44 | Ga0070717_11327806 | 3300006028 | Bacteria | 653 |
| 45 | Ga0070716_100146344 | 3300006173 | Unclassified | 1514 |
| 46 | Ga0070712_100361068 | 3300006175 | Unclassified | 1191 |
| 47 | Ga0070712_100443462 | 3300006175 | Bacteria | 1080 |
| 48 | Ga0070712_100597985 | 3300006175 | Unclassified | 933 |
| 49 | Ga0070712_101047412 | 3300006175 | Unclassified | 707 |
| 50 | Ga0075436_100063878 | 3300006914 | Bacteria | 2544 |
| 51 | Ga0075436_101372332 | 3300006914 | Bacteria | 535 |
| 52 | Ga0105240_10138467 | 3300009093 | Bacteria | 2912 |
| 53 | Ga0105240_11469887 | 3300009093 | Unclassified | 715 |
| 54 | Ga0105237_10046315 | 3300009545 | Bacteria | 4374 |
| 55 | Ga0105237_10676242 | 3300009545 | Bacteria | 1039 |
| 56 | Ga0105239_10278837 | 3300010375 | Bacteria | 1881 |
| 57 | Ga0157370_10274579 | 3300013104 | Bacteria | 1557 |
| 58 | Ga0157369_10092484 | 3300013105 | Bacteria | 3228 |
| 59 | Ga0157369_10211491 | 3300013105 | Bacteria | 2032 |
| 60 | Ga0157369_10307292 | 3300013105 | Bacteria | 1649 |
| 61 | Ga0157372_10213150 | 3300013307 | Bacteria | 2238 |
| 62 | Ga0157372_10371536 | 3300013307 | Bacteria | 1666 |
| 63 | Ga0157372_10494849 | 3300013307 | Bacteria | 1426 |
| 64 | Ga0157376_11510857 | 3300014969 | Unclassified | 705 |
| 65 | Ga0182007_10214621 | 3300015262 | Unclassified | 678 |
| 66 | Ga0197907_10686202 | 3300020069 | Bacteria | 1722 |
| 67 | Ga0197907_11148690 | 3300020069 | Bacteria | 2448 |
| 68 | Ga0206350_10129454 | 3300020080 | Unclassified | 573 |
| 69 | Ga0224712_10029463 | 3300022467 | Bacteria | 1972 |
| 70 | Ga0224712_10087238 | 3300022467 | Bacteria | 1300 |
| 71 | Ga0207692_10406385 | 3300025898 | Bacteria | 850 |
| 72 | Ga0207699_10011500 | 3300025906 | Bacteria | 4473 |
| 73 | Ga0207699_10527857 | 3300025906 | Unclassified | 854 |
| 74 | Ga0207699_10542666 | 3300025906 | Bacteria | 843 |
| 75 | Ga0207705_11081132 | 3300025909 | Unclassified | 618 |
| 76 | Ga0207707_10016264 | 3300025912 | Bacteria | 6490 |
| 77 | Ga0207707_10960660 | 3300025912 | Unclassified | 703 |
| 78 | Ga0207695_10185541 | 3300025913 | Bacteria | 1999 |
| 79 | Ga0207695_10251981 | 3300025913 | Bacteria | 1665 |
| 80 | Ga0207695_10868457 | 3300025913 | Unclassified | 782 |
| 81 | Ga0207671_10042538 | 3300025914 | Bacteria | 3362 |
| 82 | Ga0207693_10003507 | 3300025915 | Bacteria | 13396 |
| 83 | Ga0207693_10054464 | 3300025915 | Bacteria | 3137 |
| 84 | Ga0207693_10577919 | 3300025915 | Unclassified | 875 |
| 85 | Ga0207663_10019019 | 3300025916 | Bacteria | 3861 |
| 86 | Ga0207660_10023653 | 3300025917 | Bacteria | 4152 |
| 87 | Ga0207660_10126759 | 3300025917 | Bacteria | 1939 |
| 88 | Ga0207660_10546575 | 3300025917 | Bacteria | 942 |
| 89 | Ga0207657_10010685 | 3300025919 | Bacteria | 9143 |
| 90 | Ga0207649_10059224 | 3300025920 | Bacteria | 2402 |
| 91 | Ga0207652_10054182 | 3300025921 | Bacteria | 3447 |
| 92 | Ga0207694_10778276 | 3300025924 | Bacteria | 808 |
| 93 | Ga0207687_10810356 | 3300025927 | Bacteria | 799 |
| 94 | Ga0207700_10403800 | 3300025928 | Unclassified | 1198 |
| 95 | Ga0207664_10015331 | 3300025929 | Bacteria | 5557 |
| 96 | Ga0207664_10053726 | 3300025929 | Bacteria | 3190 |
| 97 | Ga0207664_10072024 | 3300025929 | Bacteria | 2785 |
| 98 | Ga0207664_10238097 | 3300025929 | Unclassified | 1584 |
| 99 | Ga0207664_10298490 | 3300025929 | Bacteria | 1417 |
| 100 | Ga0207664_10469869 | 3300025929 | Bacteria | 1124 |
| 101 | Ga0207664_10794707 | 3300025929 | Bacteria | 851 |
| 102 | Ga0207644_10526940 | 3300025931 | Bacteria | 976 |
| 103 | Ga0207690_10582245 | 3300025932 | Bacteria | 912 |
| 104 | Ga0207665_10212420 | 3300025939 | Unclassified | 1414 |
| 105 | Ga0207665_11258082 | 3300025939 | Bacteria | 590 |
| 106 | Ga0207667_10113886 | 3300025949 | Bacteria | 2788 |
| 107 | Ga0207639_11510328 | 3300026041 | Unclassified | 630 |
| 108 | Ga0207702_10407979 | 3300026078 | Unclassified | 1311 |
| 109 | Ga0207702_10737234 | 3300026078 | Bacteria | 972 |
| 110 | Ga0207674_10430911 | 3300026116 | Bacteria | 1274 |
| 111 | Ga0207698_10739871 | 3300026142 | Bacteria | 981 |
| 112 | Ga0207698_10776646 | 3300026142 | Unclassified | 959 |
| 113 | Ga0265337_1024314 | 3300028556 | Bacteria | 1855 |
| 114 | Ga0265338_10085501 | 3300028800 | Bacteria | 2628 |
| 115 | Ga0265332_10150541 | 3300031238 | Bacteria | 973 |
| 116 | Ga0265339_10051908 | 3300031249 | Bacteria | 2235 |
| 117 | Ga0265339_10312956 | 3300031249 | Bacteria | 746 |
| 118 | Ga0265331_10058255 | 3300031250 | Bacteria | 1829 |
| 119 | Ga0265331_10298381 | 3300031250 | Bacteria | 722 |
| 120 | Ga0265327_10271801 | 3300031251 | Bacteria | 751 |
| 121 | Ga0265316_10094227 | 3300031344 | Bacteria | 2281 |
| 122 | Ga0265314_10095821 | 3300031711 | Bacteria | 1920 |
| 123 | Ga0265342_10060651 | 3300031712 | Bacteria | 2230 |
| 124 | Ga0373926_0355440 | 3300035083 | Unclassified | 575 |
| 125 | Ga0373934_0134367 | 3300035086 | Bacteria | 1010 |
| 126 | Ga0373944_0011609 | 3300035089 | Bacteria | 2416 |
| 127 | Ga0373936_0145918 | 3300035113 | Bacteria | 1024 |
| 128 | Ga0373953_0448990 | 3300035117 | Unclassified | 570 |
| 129 | Ga0373954_0272827 | 3300035118 | Bacteria | 834 |
| 130 | Ga0373954_0371709 | 3300035118 | Bacteria | 706 |
| 131 | Ga0373956_0188573 | 3300035119 | Bacteria | 976 |
| 132 | Ga0373943_0002185 | 3300035170 | Bacteria | 8897 |
| 133 | Ga0373946_0092059 | 3300035171 | Bacteria | 1345 |
| 134 | Ga0373955_0054513 | 3300035172 | Bacteria | 2187 |
| 135 | Ga0373955_0248013 | 3300035172 | Bacteria | 1067 |
| 136 | Ga0373924_0051334 | 3300035410 | Bacteria | 1710 |
| 137 | Ga0373924_0168280 | 3300035410 | Bacteria | 963 |
| 138 | Ga0373931_0144835 | 3300035691 | Bacteria | 1380 |
| 139 | Ga0373927_0040229 | 3300035695 | Bacteria | 3034 |
| 140 | Ga0373933_0113495 | 3300035724 | Bacteria | 1692 |
| 141 | Ga0373933_0245670 | 3300035724 | Bacteria | 1152 |
| 142 | Ga0373933_0295065 | 3300035724 | Bacteria | 1049 |
| 143 | Ga0373947_0001831 | 3300035725 | Bacteria | 13012 |
| 144 | Ga0373937_0000308 | 3300036401 | Bacteria | 46115 |
| 145 | Ga0373937_0844960 | 3300036401 | Unclassified | 864 |
| 146 | Ga0373925_0001399 | 3300037068 | Bacteria | 20978 |
| 147 | Ga0395900_0207206 | 3300037418 | Bacteria | 1981 |
| 148 | Ga0395898_0070355 | 3300037466 | Bacteria | 3383 |
| 149 | Ga0395898_1681625 | 3300037466 | Unclassified | 558 |
| 150 | Ga0395901_0032177 | 3300038443 | Bacteria | 5413 |
| 151 | Ga0466969_0001118 | 3300044656 | Bacteria | 14481 |
| 152 | Ga0466969_0008428 | 3300044656 | Bacteria | 5467 |
| 153 | Ga0466969_0044143 | 3300044656 | Bacteria | 2219 |
| 154 | Ga0466969_0059439 | 3300044656 | Bacteria | 1859 |
| 155 | Ga0466969_0129344 | 3300044656 | Bacteria | 1171 |
| 156 | Ga0466969_0180909 | 3300044656 | Bacteria | 965 |
| 157 | Ga0466965_0057132 | 3300044683 | Bacteria | 1944 |
| 158 | Ga0466965_0109076 | 3300044683 | Bacteria | 1421 |
| 159 | Ga0466965_0296783 | 3300044683 | Bacteria | 876 |
| 160 | Ga0466966_0061836 | 3300044684 | Bacteria | 2361 |
| 161 | Ga0466966_0088643 | 3300044684 | Bacteria | 1922 |
| 162 | Ga0466966_0103550 | 3300044684 | Bacteria | 1759 |
| 163 | Ga0466966_0217497 | 3300044684 | Bacteria | 1154 |
| 164 | Ga0466966_0400975 | 3300044684 | Bacteria | 824 |
| 165 | Ga0466961_0001935 | 3300044693 | Bacteria | 12908 |
| 166 | Ga0466961_0005003 | 3300044693 | Bacteria | 8335 |
| 167 | Ga0466961_0015993 | 3300044693 | Bacteria | 4816 |
| 168 | Ga0466961_0029040 | 3300044693 | Bacteria | 3556 |
| 169 | Ga0466961_0035369 | 3300044693 | Bacteria | 3208 |
| 170 | Ga0466961_0114877 | 3300044693 | Bacteria | 1692 |
| 171 | Ga0466961_0156745 | 3300044693 | Bacteria | 1420 |
| 172 | Ga0466963_0000063 | 3300044694 | Bacteria | 36209 |
| 173 | Ga0466963_0001173 | 3300044694 | Bacteria | 13751 |
| 174 | Ga0466963_0004689 | 3300044694 | Bacteria | 7979 |
| 175 | Ga0466963_0006929 | 3300044694 | Bacteria | 6743 |
| 176 | Ga0466963_0010349 | 3300044694 | Bacteria | 5646 |
| 177 | Ga0466963_0011197 | 3300044694 | Bacteria | 5459 |
| 178 | Ga0466963_0013481 | 3300044694 | Bacteria | 5019 |
| 179 | Ga0466963_0016086 | 3300044694 | Bacteria | 4646 |
| 180 | Ga0466963_0057183 | 3300044694 | Bacteria | 2597 |
| 181 | Ga0466963_0100063 | 3300044694 | Bacteria | 1983 |
| 182 | Ga0466963_0285282 | 3300044694 | Bacteria | 1160 |
| 183 | Ga0466963_0379060 | 3300044694 | Unclassified | 997 |
| 184 | Ga0466963_0388638 | 3300044694 | Bacteria | 984 |
| 185 | Ga0466963_0412436 | 3300044694 | Bacteria | 952 |
| 186 | Ga0466963_0741810 | 3300044694 | Unclassified | 693 |
| 187 | Ga0466964_0010377 | 3300044706 | Bacteria | 3514 |
| 188 | Ga0466964_0022167 | 3300044706 | Bacteria | 2461 |
| 189 | Ga0466964_0025843 | 3300044706 | Bacteria | 2295 |
| 190 | Ga0466964_0152064 | 3300044706 | Bacteria | 1074 |
| 191 | Ga0466964_0177540 | 3300044706 | Bacteria | 1007 |
| 192 | Ga0466964_0439859 | 3300044706 | Unclassified | 689 |
| 193 | Ga0466971_0008678 | 3300044719 | Bacteria | 4434 |
| 194 | Ga0466971_0012914 | 3300044719 | Bacteria | 3663 |
| 195 | Ga0466971_0097736 | 3300044719 | Bacteria | 1347 |
| 196 | Ga0466971_0298409 | 3300044719 | Bacteria | 773 |
| 197 | Ga0466968_0004165 | 3300044735 | Bacteria | 5388 |
| 198 | Ga0466968_0008070 | 3300044735 | Bacteria | 4025 |
| 199 | Ga0466968_0033012 | 3300044735 | Bacteria | 2156 |
| 200 | Ga0466968_0059025 | 3300044735 | Bacteria | 1652 |
| 201 | Ga0466968_0133195 | 3300044735 | Bacteria | 1132 |
| 202 | Ga0466968_0144415 | 3300044735 | Bacteria | 1090 |
| 203 | Ga0466968_0185585 | 3300044735 | Bacteria | 969 |
| 204 | Ga0466968_0229363 | 3300044735 | Bacteria | 877 |
| 205 | Ga0466968_0340370 | 3300044735 | Archaea | 727 |
| 206 | Ga0466970_0028193 | 3300044765 | Bacteria | 2949 |
| 207 | Ga0466970_0375002 | 3300044765 | Bacteria | 809 |
| 208 | Ga0466957_0005605 | 3300044842 | Bacteria | 7055 |
| 209 | Ga0466957_0017834 | 3300044842 | Bacteria | 4164 |
| 210 | Ga0466957_0027287 | 3300044842 | Bacteria | 3393 |
| 211 | Ga0466957_0033886 | 3300044842 | Bacteria | 3064 |
| 212 | Ga0466957_0040495 | 3300044842 | Bacteria | 2814 |
| 213 | Ga0466957_0048335 | 3300044842 | Bacteria | 2586 |
| 214 | Ga0466957_0132014 | 3300044842 | Bacteria | 1601 |
| 215 | Ga0466957_0368887 | 3300044842 | Bacteria | 977 |
| 216 | Ga0466957_0544311 | 3300044842 | Bacteria | 808 |
| 217 | Ga0466960_0049246 | 3300044901 | Bacteria | 2028 |
| 218 | Ga0466960_0219164 | 3300044901 | Unclassified | 1046 |
| 219 | Ga0466960_0267688 | 3300044901 | Bacteria | 954 |
| 220 | Ga0466959_0002510 | 3300045049 | Bacteria | 11759 |
| 221 | Ga0466959_0007364 | 3300045049 | Bacteria | 7717 |
| 222 | Ga0466959_0027876 | 3300045049 | Bacteria | 4189 |
| 223 | Ga0466959_0046851 | 3300045049 | Bacteria | 3181 |
| 224 | Ga0466959_0050460 | 3300045049 | Bacteria | 3054 |
| 225 | Ga0466958_0002452 | 3300045836 | Bacteria | 9314 |
| 226 | Ga0466958_0003539 | 3300045836 | Bacteria | 8123 |
| 227 | Ga0466958_0006209 | 3300045836 | Bacteria | 6485 |
| 228 | Ga0466958_0008111 | 3300045836 | Bacteria | 5811 |
| 229 | Ga0466958_0010125 | 3300045836 | Bacteria | 5271 |
| 230 | Ga0466958_0011741 | 3300045836 | Bacteria | 4944 |
| 231 | Ga0466958_0025985 | 3300045836 | Bacteria | 3457 |
| 232 | Ga0466958_0070526 | 3300045836 | Bacteria | 2138 |
| 233 | Ga0466958_0112053 | 3300045836 | Bacteria | 1703 |
| 234 | Ga0466958_0418375 | 3300045836 | Unclassified | 866 |
| 235 | Ga0466958_0882643 | 3300045836 | Unclassified | 583 |
| 236 | Ga0466967_0010076 | 3300045976 | Bacteria | 7064 |
| 237 | Ga0466967_0011084 | 3300045976 | Bacteria | 6807 |
| 238 | Ga0466967_0018865 | 3300045976 | Bacteria | 5530 |
| 239 | Ga0466967_0022589 | 3300045976 | Bacteria | 5136 |
| 240 | Ga0466967_0028091 | 3300045976 | Bacteria | 4691 |
| 241 | Ga0466967_0042535 | 3300045976 | Bacteria | 3927 |
| 242 | Ga0466967_0058028 | 3300045976 | Bacteria | 3419 |
| 243 | Ga0466967_0069471 | 3300045976 | Bacteria | 3148 |
| 244 | Ga0466967_0102470 | 3300045976 | Bacteria | 2618 |
| 245 | Ga0466967_0129682 | 3300045976 | Bacteria | 2339 |
| 246 | Ga0466967_0177243 | 3300045976 | Bacteria | 2008 |
| 247 | Ga0466967_0223687 | 3300045976 | Bacteria | 1789 |
| 248 | Ga0466967_0348468 | 3300045976 | Bacteria | 1433 |
| 249 | Ga0466967_0353136 | 3300045976 | Bacteria | 1423 |
| 250 | Ga0466967_0368663 | 3300045976 | Bacteria | 1392 |
| 251 | Ga0466967_0546115 | 3300045976 | Bacteria | 1140 |
| 252 | Ga0466967_0645955 | 3300045976 | Bacteria | 1046 |
| 253 | Ga0466967_0829696 | 3300045976 | Bacteria | 918 |
| 254 | Ga0466967_1044171 | 3300045976 | Unclassified | 814 |
| 255 | Ga0466967_1594461 | 3300045976 | Unclassified | 650 |
| 256 | Ga0495592_0000410 | 3300046454 | Bacteria | 32753 |
| 257 | Ga0495592_0122926 | 3300046454 | Bacteria | 1824 |
| 258 | Ga0495592_0429525 | 3300046454 | Bacteria | 831 |
| 259 | Ga0495629_0023903 | 3300046459 | Bacteria | 4352 |
| 260 | Ga0495629_0026042 | 3300046459 | Bacteria | 4156 |
| 261 | Ga0495641_0005629 | 3300046461 | Bacteria | 8372 |
| 262 | Ga0495641_0043617 | 3300046461 | Bacteria | 2074 |
| 263 | Ga0495641_0049424 | 3300046461 | Bacteria | 1925 |
| 264 | Ga0495641_0059508 | 3300046461 | Unclassified | 1727 |
| 265 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 266 | Ga0495653_0001634 | 3300046463 | Bacteria | 17597 |
| 267 | Ga0495653_0007842 | 3300046463 | Bacteria | 8742 |
| 268 | Ga0495653_0043772 | 3300046463 | Unclassified | 3478 |
| 269 | Ga0495580_0060479 | 3300046472 | Bacteria | 2661 |
| 270 | Ga0495582_0013890 | 3300046473 | Bacteria | 4435 |
| 271 | Ga0495582_0268866 | 3300046473 | Bacteria | 978 |
| 272 | Ga0495582_0384003 | 3300046473 | Bacteria | 809 |
| 273 | Ga0495639_0004963 | 3300046475 | Bacteria | 5706 |
| 274 | Ga0495662_0005815 | 3300046476 | Bacteria | 6172 |
| 275 | Ga0495662_0300659 | 3300046476 | Bacteria | 789 |
| 276 | Ga0495664_0003716 | 3300046477 | Bacteria | 8323 |
| 277 | Ga0495664_0216257 | 3300046477 | Bacteria | 1160 |
| 278 | Ga0495664_0281734 | 3300046477 | Bacteria | 1004 |
| 279 | Ga0495664_0485460 | 3300046477 | Unclassified | 738 |
| 280 | Ga0495594_0837661 | 3300046499 | Bacteria | 518 |
| 281 | Ga0495608_0001004 | 3300046511 | Bacteria | 19861 |
| 282 | Ga0495608_0009477 | 3300046511 | Bacteria | 6803 |
| 283 | Ga0495608_0177246 | 3300046511 | Unclassified | 1350 |
| 284 | Ga0495618_0008709 | 3300046514 | Bacteria | 6132 |
| 285 | Ga0495618_0010292 | 3300046514 | Bacteria | 5658 |
| 286 | Ga0495618_0261595 | 3300046514 | Bacteria | 1083 |
| 287 | Ga0495628_0004501 | 3300046516 | Bacteria | 12347 |
| 288 | Ga0495628_0465520 | 3300046516 | Bacteria | 916 |
| 289 | Ga0495630_0051981 | 3300046517 | Bacteria | 3067 |
| 290 | Ga0495630_0117703 | 3300046517 | Bacteria | 2014 |
| 291 | Ga0495630_0185143 | 3300046517 | Bacteria | 1588 |
| 292 | Ga0495666_0001186 | 3300046526 | Bacteria | 12548 |
| 293 | Ga0495666_0461620 | 3300046526 | Bacteria | 569 |
| 294 | Ga0495652_0000319 | 3300046529 | Bacteria | 56845 |
| 295 | Ga0495652_0116557 | 3300046529 | Bacteria | 2138 |
| 296 | Ga0495652_0303955 | 3300046529 | Bacteria | 1158 |
| 297 | Ga0495665_0003752 | 3300046531 | Bacteria | 8219 |
| 298 | Ga0495640_0010802 | 3300046533 | Bacteria | 7043 |
| 299 | Ga0495640_0038013 | 3300046533 | Unclassified | 3389 |
| 300 | Ga0495640_0055087 | 3300046533 | Bacteria | 2721 |
| 301 | Ga0495586_0028377 | 3300046535 | Bacteria | 2994 |
| 302 | Ga0495586_0228676 | 3300046535 | Unclassified | 1058 |
| 303 | Ga0495587_0000055 | 3300046536 | Bacteria | 97024 |
| 304 | Ga0495587_0195806 | 3300046536 | Bacteria | 1143 |
| 305 | Ga0495645_0000170 | 3300046543 | Bacteria | 45455 |
| 306 | Ga0495645_0128889 | 3300046543 | Bacteria | 1775 |
| 307 | Ga0495645_0225655 | 3300046543 | Bacteria | 1257 |
| 308 | Ga0495667_0026892 | 3300046559 | Bacteria | 3877 |
| 309 | Ga0495667_1022708 | 3300046559 | Unclassified | 503 |
| 310 | Ga0495634_0045509 | 3300046642 | Bacteria | 2965 |
| 311 | Ga0495634_0360663 | 3300046642 | Unclassified | 869 |
| 312 | Ga0495635_0011475 | 3300046663 | Bacteria | 6212 |
| 313 | Ga0495635_0011569 | 3300046663 | Bacteria | 6186 |
| 314 | Ga0495635_0051587 | 3300046663 | Unclassified | 2833 |
| 315 | Ga0495657_0014781 | 3300046675 | Bacteria | 5728 |
| 316 | Ga0495599_0001220 | 3300046678 | Bacteria | 14572 |
| 317 | Ga0495599_0145157 | 3300046678 | Bacteria | 1471 |
| 318 | Ga0495623_0000149 | 3300046679 | Bacteria | 42958 |
| 319 | Ga0495646_0036349 | 3300046680 | Bacteria | 3051 |
| 320 | Ga0495647_0002686 | 3300046681 | Bacteria | 5650 |
| 321 | Ga0495647_0206589 | 3300046681 | Bacteria | 863 |
| 322 | Ga0495658_0004111 | 3300046683 | Bacteria | 7167 |
| 323 | Ga0495658_0043605 | 3300046683 | Bacteria | 2510 |
| 324 | Ga0495613_0091926 | 3300046689 | Bacteria | 2197 |
| 325 | Ga0495613_0157864 | 3300046689 | Bacteria | 1615 |
| 326 | Ga0495624_0011996 | 3300046690 | Bacteria | 5938 |
| 327 | Ga0495600_0031617 | 3300046809 | Bacteria | 3430 |
| 328 | Ga0495600_0747800 | 3300046809 | Unclassified | 585 |
| 329 | Ga0495581_0005286 | 3300047315 | Bacteria | 7468 |
| 330 | Ga0495581_0330090 | 3300047315 | Bacteria | 891 |
| 331 | Ga0495604_0001048 | 3300047317 | Bacteria | 22980 |
| 332 | Ga0495604_0637691 | 3300047317 | Unclassified | 680 |
| 333 | Ga0495674_0009278 | 3300047319 | Bacteria | 9349 |
| 334 | Ga0495674_0023647 | 3300047319 | Bacteria | 5658 |
| 335 | Ga0495674_0348571 | 3300047319 | Bacteria | 1202 |
| 336 | Ga0495674_1057583 | 3300047319 | Unclassified | 619 |
| 337 | Ga0495676_0034894 | 3300047321 | Bacteria | 4214 |
| 338 | Ga0495676_0478396 | 3300047321 | Bacteria | 819 |
| 339 | Ga0495680_0126315 | 3300047322 | Bacteria | 1883 |
| 340 | Ga0495680_0210678 | 3300047322 | Bacteria | 1391 |
| 341 | Ga0495675_0000029 | 3300047444 | Bacteria | 105305 |
| 342 | Ga0495675_0081328 | 3300047444 | Bacteria | 2040 |
| 343 | Ga0495684_0008421 | 3300047471 | Bacteria | 7990 |
| 344 | Ga0495684_0011049 | 3300047471 | Bacteria | 6982 |
| 345 | Ga0495684_0063160 | 3300047471 | Bacteria | 2815 |
| 346 | Ga0495684_0509036 | 3300047471 | Unclassified | 826 |
| 347 | Ga0495593_0000750 | 3300047673 | Bacteria | 18855 |
| 348 | Ga0495593_0203942 | 3300047673 | Unclassified | 994 |
| 349 | Ga0495602_0000741 | 3300048088 | Bacteria | 30911 |
| 350 | Ga0495602_0237775 | 3300048088 | Bacteria | 1364 |
| 351 | Ga0495614_0000802 | 3300048089 | Bacteria | 13308 |
| 352 | Ga0496101_0288760 | 3300048904 | Unclassified | 1283 |
| 353 | Ga0496101_0506515 | 3300048904 | Unclassified | 954 |
| 354 | Ga0496102_0035214 | 3300048905 | Bacteria | 4505 |
| 355 | Ga0496103_0087820 | 3300048906 | Bacteria | 1960 |
| 356 | Ga0496105_0104055 | 3300048908 | Bacteria | 2344 |
| 357 | Ga0496107_0172702 | 3300048910 | Bacteria | 1604 |
| 358 | Ga0496108_0048445 | 3300048911 | Bacteria | 3553 |
| 359 | Ga0496108_1393794 | 3300048911 | Unclassified | 587 |
| 360 | Ga0496109_0028648 | 3300048912 | Bacteria | 4983 |
| 361 | Ga0496109_0101269 | 3300048912 | Bacteria | 2673 |
| 362 | Ga0496111_0028079 | 3300048914 | Bacteria | 3986 |
| 363 | Ga0496112_0684982 | 3300048915 | Bacteria | 953 |
| 364 | Ga0496114_0023553 | 3300048917 | Bacteria | 5025 |
| 365 | Ga0496115_0053205 | 3300048918 | Bacteria | 3248 |
| 366 | Ga0496115_0211611 | 3300048918 | Unclassified | 1601 |
| 367 | Ga0496115_0531505 | 3300048918 | Bacteria | 942 |
| 368 | Ga0496115_0717056 | 3300048918 | Bacteria | 785 |
| 369 | Ga0496115_0723109 | 3300048918 | Unclassified | 781 |
| 370 | Ga0501067_0310941 | 3300049583 | Bacteria | 878 |
| 371 | nmdc:mga08x19_1211761_c1 | 3300050514 | Bacteria | 535 |
| 372 | nmdc:mga08x19_320156_c1 | 3300050514 | Bacteria | 1079 |
| 373 | Ga0495601_0000082 | 3300053077 | Bacteria | 51242 |
| 374 | Ga0495601_0026834 | 3300053077 | Bacteria | 3558 |
| 375 | Ga0495601_0237359 | 3300053077 | Unclassified | 1190 |
| 376 | Ga0495601_0411895 | 3300053077 | Unclassified | 876 |
| 377 | Ga0495612_0001482 | 3300053078 | Bacteria | 9660 |
| 378 | Ga0495612_0160459 | 3300053078 | Bacteria | 981 |
| 379 | Ga0495595_0034057 | 3300053084 | Bacteria | 2302 |
| 380 | Ga0495595_0125814 | 3300053084 | Unclassified | 1250 |
| 381 | Ga0495619_0004080 | 3300053085 | Bacteria | 9348 |
| 382 | Ga0495619_0006116 | 3300053085 | Bacteria | 7624 |
| 383 | Ga0495619_0029797 | 3300053085 | Bacteria | 3528 |
| 384 | Ga0495619_0869388 | 3300053085 | Unclassified | 607 |
| 385 | Ga0500566_0489808 | 3300053094 | Unclassified | 531 |
| 386 | Ga0466962_0001705 | 3300061719 | Bacteria | 10322 |
| 387 | Ga0466962_0003049 | 3300061719 | Bacteria | 7986 |
| 388 | Ga0466962_0016734 | 3300061719 | Bacteria | 3534 |
| 389 | Ga0466962_0159010 | 3300061719 | Bacteria | 1098 |
| 390 | Ga0466962_0209954 | 3300061719 | Bacteria | 952 |
| 391 | Ga0070680_100042661 | |||
| 392 | Ga0070658_10030830 | |||
| 393 | Ga0070658_10373116 | |||
| 394 | Ga0070683_100039898 | |||
| 395 | Ga0070680_100112160 | |||
| 396 | Ga0070680_100640012 | |||
| 397 | Ga0070691_10024463 | |||
| 398 | Ga0070661_100542360 | |||
| 399 | Ga0070661_100635236 | |||
| 400 | Ga0070659_100061611 | |||
| 401 | Ga0070709_10023377 | |||
| 402 | Ga0070709_10036729 | |||
| 403 | Ga0070714_100008975 | |||
| 404 | Ga0070714_100016982 | |||
| 405 | Ga0070714_100022212 | |||
| 406 | Ga0070714_100025488 | |||
| 407 | Ga0070714_100290894 | |||
| 408 | Ga0070714_100857056 | |||
| 409 | Ga0070713_100025595 | |||
| 410 | Ga0070713_100151066 | |||
| 411 | Ga0070713_100877808 | |||
| 412 | Ga0070710_10100246 | |||
| 413 | Ga0070710_10614397 | |||
| 414 | Ga0070711_100016338 | |||
| 415 | Ga0070711_100600313 | |||
| 416 | Ga0070694_100339956 | |||
| 417 | Ga0070681_10108549 | |||
| 418 | Ga0070681_10158397 | |||
| 419 | Ga0070698_100193039 | |||
| 420 | Ga0070698_100483713 | |||
| 421 | Ga0070679_100060222 | |||
| 422 | Ga0070679_100575522 | |||
| 423 | Ga0070684_100004597 | |||
| 424 | Ga0070684_100271721 | |||
| 425 | Ga0070695_100001141 | |||
| 426 | Ga0070693_100773588 | |||
| 427 | Ga0068855_100117518 | |||
| 428 | Ga0068856_100206339 | |||
| 429 | Ga0068856_100594684 | |||
| 430 | Ga0068852_100641536 | |||
| 431 | Ga0068852_101963177 | |||
| 432 | Ga0070717_10073944 | |||
| 433 | Ga0070717_10239436 | |||
| 434 | Ga0070717_11327806 | |||
| 435 | Ga0070716_100146344 | |||
| 436 | Ga0070712_100361068 | |||
| 437 | Ga0070712_100443462 | |||
| 438 | Ga0070712_100597985 | |||
| 439 | Ga0070712_101047412 | |||
| 440 | Ga0075436_100063878 | |||
| 441 | Ga0075436_101372332 | |||
| 442 | Ga0105240_10138467 | |||
| 443 | Ga0105240_11469887 | |||
| 444 | Ga0105237_10046315 | |||
| 445 | Ga0105237_10676242 | |||
| 446 | Ga0105239_10278837 | |||
| 447 | Ga0157370_10274579 | |||
| 448 | Ga0157369_10092484 | |||
| 449 | Ga0157369_10211491 | |||
| 450 | Ga0157369_10307292 | |||
| 451 | Ga0157372_10213150 | |||
| 452 | Ga0157372_10371536 | |||
| 453 | Ga0157372_10494849 | |||
| 454 | Ga0157376_11510857 | |||
| 455 | Ga0182007_10214621 | |||
| 456 | Ga0197907_10686202 | |||
| 457 | Ga0197907_11148690 | |||
| 458 | Ga0206350_10129454 | |||
| 459 | Ga0224712_10029463 | |||
| 460 | Ga0224712_10087238 | |||
| 461 | Ga0207692_10406385 | |||
| 462 | Ga0207699_10011500 | |||
| 463 | Ga0207699_10527857 | |||
| 464 | Ga0207699_10542666 | |||
| 465 | Ga0207705_11081132 | |||
| 466 | Ga0207707_10016264 | |||
| 467 | Ga0207707_10960660 | |||
| 468 | Ga0207695_10185541 | |||
| 469 | Ga0207695_10251981 | |||
| 470 | Ga0207695_10868457 | |||
| 471 | Ga0207671_10042538 | |||
| 472 | Ga0207693_10003507 | |||
| 473 | Ga0207693_10054464 | |||
| 474 | Ga0207693_10577919 | |||
| 475 | Ga0207663_10019019 | |||
| 476 | Ga0207660_10023653 | |||
| 477 | Ga0207660_10126759 | |||
| 478 | Ga0207660_10546575 | |||
| 479 | Ga0207657_10010685 | |||
| 480 | Ga0207649_10059224 | |||
| 481 | Ga0207652_10054182 | |||
| 482 | Ga0207694_10778276 | |||
| 483 | Ga0207687_10810356 | |||
| 484 | Ga0207700_10403800 | |||
| 485 | Ga0207664_10015331 | |||
| 486 | Ga0207664_10053726 | |||
| 487 | Ga0207664_10072024 | |||
| 488 | Ga0207664_10238097 | |||
| 489 | Ga0207664_10298490 | |||
| 490 | Ga0207664_10469869 | |||
| 491 | Ga0207664_10794707 | |||
| 492 | Ga0207644_10526940 | |||
| 493 | Ga0207690_10582245 | |||
| 494 | Ga0207665_10212420 | |||
| 495 | Ga0207665_11258082 | |||
| 496 | Ga0207667_10113886 | |||
| 497 | Ga0207639_11510328 | |||
| 498 | Ga0207702_10407979 | |||
| 499 | Ga0207702_10737234 | |||
| 500 | Ga0207674_10430911 | |||
| 501 | Ga0207698_10739871 | |||
| 502 | Ga0207698_10776646 | |||
| 503 | Ga0265337_1024314 | |||
| 504 | Ga0265338_10085501 | |||
| 505 | Ga0265332_10150541 | |||
| 506 | Ga0265339_10051908 | |||
| 507 | Ga0265339_10312956 | |||
| 508 | Ga0265331_10058255 | |||
| 509 | Ga0265331_10298381 | |||
| 510 | Ga0265327_10271801 | |||
| 511 | Ga0265316_10094227 | |||
| 512 | Ga0265314_10095821 | |||
| 513 | Ga0265342_10060651 | |||
| 514 | Ga0373926_0355440 | |||
| 515 | Ga0373934_0134367 | |||
| 516 | Ga0373944_0011609 | |||
| 517 | Ga0373936_0145918 | |||
| 518 | Ga0373953_0448990 | |||
| 519 | Ga0373954_0272827 | |||
| 520 | Ga0373954_0371709 | |||
| 521 | Ga0373956_0188573 | |||
| 522 | Ga0373943_0002185 | |||
| 523 | Ga0373946_0092059 | |||
| 524 | Ga0373955_0054513 | |||
| 525 | Ga0373955_0248013 | |||
| 526 | Ga0373924_0051334 | |||
| 527 | Ga0373924_0168280 | |||
| 528 | Ga0373931_0144835 | |||
| 529 | Ga0373927_0040229 | |||
| 530 | Ga0373933_0113495 | |||
| 531 | Ga0373933_0245670 | |||
| 532 | Ga0373933_0295065 | |||
| 533 | Ga0373947_0001831 | |||
| 534 | Ga0373937_0000308 | |||
| 535 | Ga0373937_0844960 | |||
| 536 | Ga0373925_0001399 | |||
| 537 | Ga0395900_0207206 | |||
| 538 | Ga0395898_0070355 | |||
| 539 | Ga0395898_1681625 | |||
| 540 | Ga0395901_0032177 | |||
| 541 | Ga0466969_0001118 | |||
| 542 | Ga0466969_0008428 | |||
| 543 | Ga0466969_0044143 | |||
| 544 | Ga0466969_0059439 | |||
| 545 | Ga0466969_0129344 | |||
| 546 | Ga0466969_0180909 | |||
| 547 | Ga0466965_0057132 | |||
| 548 | Ga0466965_0109076 | |||
| 549 | Ga0466965_0296783 | |||
| 550 | Ga0466966_0061836 | |||
| 551 | Ga0466966_0088643 | |||
| 552 | Ga0466966_0103550 | |||
| 553 | Ga0466966_0217497 | |||
| 554 | Ga0466966_0400975 | |||
| 555 | Ga0466961_0001935 | |||
| 556 | Ga0466961_0005003 | |||
| 557 | Ga0466961_0015993 | |||
| 558 | Ga0466961_0029040 | |||
| 559 | Ga0466961_0035369 | |||
| 560 | Ga0466961_0114877 | |||
| 561 | Ga0466961_0156745 | |||
| 562 | Ga0466963_0000063 | |||
| 563 | Ga0466963_0001173 | |||
| 564 | Ga0466963_0004689 | |||
| 565 | Ga0466963_0006929 | |||
| 566 | Ga0466963_0010349 | |||
| 567 | Ga0466963_0011197 | |||
| 568 | Ga0466963_0013481 | |||
| 569 | Ga0466963_0016086 | |||
| 570 | Ga0466963_0057183 | |||
| 571 | Ga0466963_0100063 | |||
| 572 | Ga0466963_0285282 | |||
| 573 | Ga0466963_0379060 | |||
| 574 | Ga0466963_0388638 | |||
| 575 | Ga0466963_0412436 | |||
| 576 | Ga0466963_0741810 | |||
| 577 | Ga0466964_0010377 | |||
| 578 | Ga0466964_0022167 | |||
| 579 | Ga0466964_0025843 | |||
| 580 | Ga0466964_0152064 | |||
| 581 | Ga0466964_0177540 | |||
| 582 | Ga0466964_0439859 | |||
| 583 | Ga0466971_0008678 | |||
| 584 | Ga0466971_0012914 | |||
| 585 | Ga0466971_0097736 | |||
| 586 | Ga0466971_0298409 | |||
| 587 | Ga0466968_0004165 | |||
| 588 | Ga0466968_0008070 | |||
| 589 | Ga0466968_0033012 | |||
| 590 | Ga0466968_0059025 | |||
| 591 | Ga0466968_0133195 | |||
| 592 | Ga0466968_0144415 | |||
| 593 | Ga0466968_0185585 | |||
| 594 | Ga0466968_0229363 | |||
| 595 | Ga0466968_0340370 | |||
| 596 | Ga0466970_0028193 | |||
| 597 | Ga0466970_0375002 | |||
| 598 | Ga0466957_0005605 | |||
| 599 | Ga0466957_0017834 | |||
| 600 | Ga0466957_0027287 | |||
| 601 | Ga0466957_0033886 | |||
| 602 | Ga0466957_0040495 | |||
| 603 | Ga0466957_0048335 | |||
| 604 | Ga0466957_0132014 | |||
| 605 | Ga0466957_0368887 | |||
| 606 | Ga0466957_0544311 | |||
| 607 | Ga0466960_0049246 | |||
| 608 | Ga0466960_0219164 | |||
| 609 | Ga0466960_0267688 | |||
| 610 | Ga0466959_0002510 | |||
| 611 | Ga0466959_0007364 | |||
| 612 | Ga0466959_0027876 | |||
| 613 | Ga0466959_0046851 | |||
| 614 | Ga0466959_0050460 | |||
| 615 | Ga0466958_0002452 | |||
| 616 | Ga0466958_0003539 | |||
| 617 | Ga0466958_0006209 | |||
| 618 | Ga0466958_0008111 | |||
| 619 | Ga0466958_0010125 | |||
| 620 | Ga0466958_0011741 | |||
| 621 | Ga0466958_0025985 | |||
| 622 | Ga0466958_0070526 | |||
| 623 | Ga0466958_0112053 | |||
| 624 | Ga0466958_0418375 | |||
| 625 | Ga0466958_0882643 | |||
| 626 | Ga0466967_0010076 | |||
| 627 | Ga0466967_0011084 | |||
| 628 | Ga0466967_0018865 | |||
| 629 | Ga0466967_0022589 | |||
| 630 | Ga0466967_0028091 | |||
| 631 | Ga0466967_0042535 | |||
| 632 | Ga0466967_0058028 | |||
| 633 | Ga0466967_0069471 | |||
| 634 | Ga0466967_0102470 | |||
| 635 | Ga0466967_0129682 | |||
| 636 | Ga0466967_0177243 | |||
| 637 | Ga0466967_0223687 | |||
| 638 | Ga0466967_0348468 | |||
| 639 | Ga0466967_0353136 | |||
| 640 | Ga0466967_0368663 | |||
| 641 | Ga0466967_0546115 | |||
| 642 | Ga0466967_0645955 | |||
| 643 | Ga0466967_0829696 | |||
| 644 | Ga0466967_1044171 | |||
| 645 | Ga0466967_1594461 | |||
| 646 | Ga0495592_0000410 | |||
| 647 | Ga0495592_0122926 | |||
| 648 | Ga0495592_0429525 | |||
| 649 | Ga0495629_0023903 | |||
| 650 | Ga0495629_0026042 | |||
| 651 | Ga0495641_0005629 | |||
| 652 | Ga0495641_0043617 | |||
| 653 | Ga0495641_0049424 | |||
| 654 | Ga0495641_0059508 | |||
| 655 | Ga0495651_0000034 | |||
| 656 | Ga0495653_0001634 | |||
| 657 | Ga0495653_0007842 | |||
| 658 | Ga0495653_0043772 | |||
| 659 | Ga0495580_0060479 | |||
| 660 | Ga0495582_0013890 | |||
| 661 | Ga0495582_0268866 | |||
| 662 | Ga0495582_0384003 | |||
| 663 | Ga0495639_0004963 | |||
| 664 | Ga0495662_0005815 | |||
| 665 | Ga0495662_0300659 | |||
| 666 | Ga0495664_0003716 | |||
| 667 | Ga0495664_0216257 | |||
| 668 | Ga0495664_0281734 | |||
| 669 | Ga0495664_0485460 | |||
| 670 | Ga0495594_0837661 | |||
| 671 | Ga0495608_0001004 | |||
| 672 | Ga0495608_0009477 | |||
| 673 | Ga0495608_0177246 | |||
| 674 | Ga0495618_0008709 | |||
| 675 | Ga0495618_0010292 | |||
| 676 | Ga0495618_0261595 | |||
| 677 | Ga0495628_0004501 | |||
| 678 | Ga0495628_0465520 | |||
| 679 | Ga0495630_0051981 | |||
| 680 | Ga0495630_0117703 | |||
| 681 | Ga0495630_0185143 | |||
| 682 | Ga0495666_0001186 | |||
| 683 | Ga0495666_0461620 | |||
| 684 | Ga0495652_0000319 | |||
| 685 | Ga0495652_0116557 | |||
| 686 | Ga0495652_0303955 | |||
| 687 | Ga0495665_0003752 | |||
| 688 | Ga0495640_0010802 | |||
| 689 | Ga0495640_0038013 | |||
| 690 | Ga0495640_0055087 | |||
| 691 | Ga0495586_0028377 | |||
| 692 | Ga0495586_0228676 | |||
| 693 | Ga0495587_0000055 | |||
| 694 | Ga0495587_0195806 | |||
| 695 | Ga0495645_0000170 | |||
| 696 | Ga0495645_0128889 | |||
| 697 | Ga0495645_0225655 | |||
| 698 | Ga0495667_0026892 | |||
| 699 | Ga0495667_1022708 | |||
| 700 | Ga0495634_0045509 | |||
| 701 | Ga0495634_0360663 | |||
| 702 | Ga0495635_0011475 | |||
| 703 | Ga0495635_0011569 | |||
| 704 | Ga0495635_0051587 | |||
| 705 | Ga0495657_0014781 | |||
| 706 | Ga0495599_0001220 | |||
| 707 | Ga0495599_0145157 | |||
| 708 | Ga0495623_0000149 | |||
| 709 | Ga0495646_0036349 | |||
| 710 | Ga0495647_0002686 | |||
| 711 | Ga0495647_0206589 | |||
| 712 | Ga0495658_0004111 | |||
| 713 | Ga0495658_0043605 | |||
| 714 | Ga0495613_0091926 | |||
| 715 | Ga0495613_0157864 | |||
| 716 | Ga0495624_0011996 | |||
| 717 | Ga0495600_0031617 | |||
| 718 | Ga0495600_0747800 | |||
| 719 | Ga0495581_0005286 | |||
| 720 | Ga0495581_0330090 | |||
| 721 | Ga0495604_0001048 | |||
| 722 | Ga0495604_0637691 | |||
| 723 | Ga0495674_0009278 | |||
| 724 | Ga0495674_0023647 | |||
| 725 | Ga0495674_0348571 | |||
| 726 | Ga0495674_1057583 | |||
| 727 | Ga0495676_0034894 | |||
| 728 | Ga0495676_0478396 | |||
| 729 | Ga0495680_0126315 | |||
| 730 | Ga0495680_0210678 | |||
| 731 | Ga0495675_0000029 | |||
| 732 | Ga0495675_0081328 | |||
| 733 | Ga0495684_0008421 | |||
| 734 | Ga0495684_0011049 | |||
| 735 | Ga0495684_0063160 | |||
| 736 | Ga0495684_0509036 | |||
| 737 | Ga0495593_0000750 | |||
| 738 | Ga0495593_0203942 | |||
| 739 | Ga0495602_0000741 | |||
| 740 | Ga0495602_0237775 | |||
| 741 | Ga0495614_0000802 | |||
| 742 | Ga0496101_0288760 | |||
| 743 | Ga0496101_0506515 | |||
| 744 | Ga0496102_0035214 | |||
| 745 | Ga0496103_0087820 | |||
| 746 | Ga0496105_0104055 | |||
| 747 | Ga0496107_0172702 | |||
| 748 | Ga0496108_0048445 | |||
| 749 | Ga0496108_1393794 | |||
| 750 | Ga0496109_0028648 | |||
| 751 | Ga0496109_0101269 | |||
| 752 | Ga0496111_0028079 | |||
| 753 | Ga0496112_0684982 | |||
| 754 | Ga0496114_0023553 | |||
| 755 | Ga0496115_0053205 | |||
| 756 | Ga0496115_0211611 | |||
| 757 | Ga0496115_0531505 | |||
| 758 | Ga0496115_0717056 | |||
| 759 | Ga0496115_0723109 | |||
| 760 | Ga0501067_0310941 | |||
| 761 | nmdc:mga08x19_1211761_c1 | |||
| 762 | nmdc:mga08x19_320156_c1 | |||
| 763 | Ga0495601_0000082 | |||
| 764 | Ga0495601_0026834 | |||
| 765 | Ga0495601_0237359 | |||
| 766 | Ga0495601_0411895 | |||
| 767 | Ga0495612_0001482 | |||
| 768 | Ga0495612_0160459 | |||
| 769 | Ga0495595_0034057 | |||
| 770 | Ga0495595_0125814 | |||
| 771 | Ga0495619_0004080 | |||
| 772 | Ga0495619_0006116 | |||
| 773 | Ga0495619_0029797 | |||
| 774 | Ga0495619_0869388 | |||
| 775 | Ga0500566_0489808 | |||
| 776 | Ga0466962_0001705 | |||
| 777 | Ga0466962_0003049 | |||
| 778 | Ga0466962_0016734 | |||
| 779 | Ga0466962_0159010 | |||
| 780 | Ga0466962_0209954 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xao-assembly1.cif.gz_B | crystal structure of thioredoxin 1 | 0.9199 | 17 | 102 |
| 7c3f-assembly4.cif.gz_L | crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex | 0.917 | 17 | 104 |
| 3hz4-assembly1.cif.gz_B | crystal structure of thioredoxin from methanosarcina mazei | 0.9166 | 16 | 102 |
| 5j7d-assembly7.cif.gz_G | computationally designed thioredoxin df106 | 0.9141 | 15 | 88 |
| 4pob-assembly1.cif.gz_B | crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus | 0.914 | 15 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v98B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9117 | 17 | 103 | 3.40.30.10 |
| af_P47938_1_107_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9077 | 14 | 88 | 3.40.30.10 |
| 3hz4B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9074 | 16 | 103 | 3.40.30.10 |
| af_Q9SKB6_214_310_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9062 | 16 | 87 | 3.40.30.10 |
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8979 | 16 | 104 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538D1N8-F1-model_v4 | Thioredoxin family protein | 0.9844 | 18 | 105 |
|
| AF-A0A538G5E9-F1-model_v4 | Thioredoxin family protein | 0.9641 | 8 | 105 |
|
| AF-A0A538D1N8-F1-model_v4 | Thioredoxin family protein | 0.9628 | 18 | 105 |
|
| AF-A0A4Y3QL65-F1-model_v4 | Thioredoxin | 0.9419 | 17 | 105 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A0G4I2U0-F1-model_v4 | Thioredoxin domain-containing protein | 0.939 | 17 | 101 |
GO:0005737
GO:0015035 |