F431571

General Info

Members Datasets Scaffolds Average Seq Length
389 201 778 138

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0157927|Ga0501042_0157927_505_969
Length 154
Sequence MMALPSHIDLQIVTPDRLILHEQVDEVQIPGAQGYFGVLPGHTPFLATLAVGELWYRKGQEKFYVAIAFGFAEVLPDRVTILARVGERAEDIDIDRAEAARKRAEDRLEQPKPEVDFERARLALTKSLARLQVASRTPLGSRVGALRRLHDARG

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.66
Nodule 0
Rhizoplane 3.34
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0157927 3300049578 Bacteria 1636
2 Ga0065712_10007252 3300005290 Bacteria 4558
3 Ga0065712_10216000 3300005290 Bacteria 1056
4 Ga0065715_10130806 3300005293 Bacteria 2019
5 Ga0065715_10192965 3300005293 Bacteria 1404
6 Ga0065707_10084692 3300005295 Bacteria 6880
7 Ga0065707_10332437 3300005295 Bacteria 947
8 Ga0070676_10603651 3300005328 Bacteria 792
9 Ga0070676_10625328 3300005328 Bacteria 779
10 Ga0070676_11498186 3300005328 Unclassified 519
11 Ga0070683_101111613 3300005329 Unclassified 759
12 Ga0070690_100317000 3300005330 Unclassified 1122
13 Ga0070670_100933441 3300005331 Bacteria 788
14 Ga0070677_10353610 3300005333 Bacteria 762
15 Ga0070666_10509338 3300005335 Bacteria 873
16 Ga0070680_101970105 3300005336 Bacteria 506
17 Ga0068868_100534735 3300005338 Bacteria 1031
18 Ga0070689_100851216 3300005340 Bacteria 804
19 Ga0070687_100259610 3300005343 Unclassified 1083
20 Ga0070687_100372797 3300005343 Bacteria 928
21 Ga0070687_101106455 3300005343 Bacteria 580
22 Ga0070661_100870627 3300005344 Bacteria 742
23 Ga0070669_100037108 3300005353 Bacteria 3535
24 Ga0070669_100079718 3300005353 Bacteria 2436
25 Ga0070675_100623131 3300005354 Bacteria 979
26 Ga0070675_101690728 3300005354 Bacteria 584
27 Ga0070674_100816275 3300005356 Bacteria 806
28 Ga0070674_100983241 3300005356 Bacteria 740
29 Ga0070673_100005359 3300005364 Bacteria 8195
30 Ga0070673_100051140 3300005364 Bacteria 3234
31 Ga0070673_100215398 3300005364 Bacteria 1660
32 Ga0070673_100245025 3300005364 Bacteria 1560
33 Ga0070688_100028461 3300005365 Bacteria 3336
34 Ga0070688_100111753 3300005365 Bacteria 1818
35 Ga0070667_100897166 3300005367 Bacteria 825
36 Ga0070709_10159037 3300005434 Bacteria 1569
37 Ga0070713_100036514 3300005436 Bacteria 3966
38 Ga0070701_10423761 3300005438 Unclassified 848
39 Ga0070700_100964215 3300005441 Bacteria 699
40 Ga0070700_101268305 3300005441 Bacteria 618
41 Ga0070694_100888374 3300005444 Bacteria 735
42 Ga0070708_100257981 3300005445 Bacteria 1638
43 Ga0070708_100489845 3300005445 Bacteria 1160
44 Ga0070708_101334992 3300005445 Bacteria 670
45 Ga0070678_100893329 3300005456 Bacteria 812
46 Ga0070662_100455189 3300005457 Bacteria 1063
47 Ga0070662_100553231 3300005457 Bacteria 964
48 Ga0070662_100714427 3300005457 Bacteria 848
49 Ga0068867_100181825 3300005459 Bacteria 1672
50 Ga0068867_100538799 3300005459 Bacteria 1009
51 Ga0070706_100005309 3300005467 Bacteria 12282
52 Ga0070707_100002280 3300005468 Bacteria 18332
53 Ga0070707_100615318 3300005468 Bacteria 1049
54 Ga0070698_100021237 3300005471 Bacteria 6802
55 Ga0070698_101244463 3300005471 Bacteria 694
56 Ga0070699_100001510 3300005518 Bacteria 21276
57 Ga0070699_100391810 3300005518 Bacteria 1255
58 Ga0070699_100802190 3300005518 Bacteria 862
59 Ga0070699_101689123 3300005518 Bacteria 580
60 Ga0070697_100003704 3300005536 Bacteria 11743
61 Ga0070672_100226330 3300005543 Bacteria 1570
62 Ga0070672_100236673 3300005543 Bacteria 1535
63 Ga0070672_100506741 3300005543 Bacteria 1044
64 Ga0070686_100097487 3300005544 Bacteria 1979
65 Ga0070686_100505734 3300005544 Bacteria 938
66 Ga0070696_100453165 3300005546 Bacteria 1013
67 Ga0070696_100573825 3300005546 Bacteria 907
68 Ga0070704_100170523 3300005549 Unclassified 1730
69 Ga0070704_100317168 3300005549 Bacteria 1305
70 Ga0070704_100813173 3300005549 Bacteria 836
71 Ga0070704_100964593 3300005549 Bacteria 770
72 Ga0070664_100272045 3300005564 Bacteria 1526
73 Ga0070702_101393251 3300005615 Bacteria 573
74 Ga0068852_100097161 3300005616 Bacteria 2649
75 Ga0068859_100001580 3300005617 Bacteria 23222
76 Ga0068859_100005074 3300005617 Bacteria 13372
77 Ga0068859_100005255 3300005617 Bacteria 13157
78 Ga0068859_100249684 3300005617 Bacteria 1865
79 Ga0068859_100493212 3300005617 Bacteria 1320
80 Ga0068859_100525993 3300005617 Bacteria 1277
81 Ga0068864_100303304 3300005618 Bacteria 1496
82 Ga0068866_10310636 3300005718 Bacteria 988
83 Ga0068861_100037801 3300005719 Bacteria 3589
84 Ga0068861_100131743 3300005719 Bacteria 2030
85 Ga0068870_10125855 3300005840 Bacteria 1482
86 Ga0068870_10133156 3300005840 Bacteria 1446
87 Ga0068860_100175328 3300005843 Bacteria 2072
88 Ga0068860_100964868 3300005843 Bacteria 870
89 Ga0068862_100194378 3300005844 Bacteria 1827
90 Ga0070717_10074134 3300006028 Bacteria 2845
91 Ga0075365_10019563 3300006038 Bacteria 4182
92 Ga0075365_10203564 3300006038 Bacteria 1387
93 Ga0075365_10534899 3300006038 Bacteria 829
94 Ga0075368_10014820 3300006042 Bacteria 2884
95 Ga0075363_100036659 3300006048 Bacteria 2573
96 Ga0075363_100842762 3300006048 Unclassified 559
97 Ga0075367_10004737 3300006178 Bacteria 6692
98 Ga0075369_10084760 3300006186 Bacteria 1409
99 Ga0075366_10059813 3300006195 Bacteria 2263
100 Ga0075366_10224639 3300006195 Bacteria 1144
101 Ga0075366_10822603 3300006195 Bacteria 578
102 Ga0075428_100217307 3300006844 Bacteria 2064
103 Ga0075428_101087206 3300006844 Bacteria 845
104 Ga0075430_100146321 3300006846 Bacteria 1968
105 Ga0075430_100207503 3300006846 Bacteria 1626
106 Ga0075431_100405486 3300006847 Unclassified 1364
107 Ga0075431_100519009 3300006847 Bacteria 1181
108 Ga0075433_10009466 3300006852 Bacteria 7787
109 Ga0075433_10184207 3300006852 Bacteria 1858
110 Ga0075433_10926196 3300006852 Bacteria 760
111 Ga0075433_10995273 3300006852 Bacteria 730
112 Ga0075433_11068831 3300006852 Bacteria 702
113 Ga0075433_11340452 3300006852 Bacteria 620
114 Ga0075434_100007256 3300006871 Bacteria 10253
115 Ga0075434_100070773 3300006871 Bacteria 3479
116 Ga0075434_100253564 3300006871 Bacteria 1778
117 Ga0075434_100483139 3300006871 Bacteria 1260
118 Ga0075429_101403555 3300006880 Unclassified 608
119 Ga0097620_100001580 3300006931 Bacteria 23222
120 Ga0097620_100005074 3300006931 Bacteria 13372
121 Ga0097620_100005255 3300006931 Bacteria 13157
122 Ga0097620_100249692 3300006931 Bacteria 1865
123 Ga0097620_100493219 3300006931 Bacteria 1320
124 Ga0097620_100525980 3300006931 Bacteria 1277
125 Ga0075435_100017729 3300007076 Bacteria 5396
126 Ga0099794_10241194 3300007265 Bacteria 931
127 Ga0111539_10592533 3300009094 Bacteria 1291
128 Ga0111539_11526441 3300009094 Bacteria 775
129 Ga0105247_11217192 3300009101 Bacteria 600
130 Ga0114129_10160311 3300009147 Bacteria 3073
131 Ga0114129_10355487 3300009147 Bacteria 1940
132 Ga0114129_10535828 3300009147 Bacteria 1525
133 Ga0105243_12886281 3300009148 Bacteria 521
134 Ga0105242_10304482 3300009176 Bacteria 1456
135 Ga0105248_10513831 3300009177 Bacteria 1351
136 Ga0105248_11198238 3300009177 Bacteria 859
137 Ga0105238_10530138 3300009551 Bacteria 1181
138 Ga0105249_10280534 3300009553 Bacteria 1664
139 Ga0105249_10328627 3300009553 Bacteria 1542
140 Ga0105249_11673509 3300009553 Bacteria 709
141 Ga0105249_12170942 3300009553 Bacteria 628
142 Ga0157378_10924788 3300013297 Bacteria 904
143 Ga0163162_11289543 3300013306 Bacteria 830
144 Ga0157375_11023342 3300013308 Bacteria 965
145 Ga0163163_11846392 3300014325 Bacteria 664
146 Ga0157380_10123942 3300014326 Bacteria 2193
147 Ga0157380_10574405 3300014326 Bacteria 1110
148 Ga0157380_10778535 3300014326 Bacteria 971
149 Ga0157380_11403851 3300014326 Bacteria 749
150 Ga0157380_12448209 3300014326 Bacteria 587
151 Ga0157377_10174585 3300014745 Bacteria 1346
152 Ga0207682_10183790 3300025893 Bacteria 956
153 Ga0207699_10110474 3300025906 Bacteria 1761
154 Ga0207643_10148880 3300025908 Bacteria 1402
155 Ga0207684_10001191 3300025910 Bacteria 29072
156 Ga0207684_10408233 3300025910 Bacteria 1167
157 Ga0207693_11040631 3300025915 Bacteria 624
158 Ga0207657_10960115 3300025919 Unclassified 657
159 Ga0207646_10006888 3300025922 Bacteria 11672
160 Ga0207646_10597725 3300025922 Bacteria 991
161 Ga0207646_11808499 3300025922 Bacteria 522
162 Ga0207681_10050036 3300025923 Bacteria 2827
163 Ga0207681_10334878 3300025923 Bacteria 1207
164 Ga0207659_10497135 3300025926 Bacteria 1032
165 Ga0207659_10738766 3300025926 Bacteria 844
166 Ga0207700_10139277 3300025928 Bacteria 1992
167 Ga0207706_10386664 3300025933 Bacteria 1214
168 Ga0207706_10527264 3300025933 Bacteria 1018
169 Ga0207670_10132601 3300025936 Bacteria 1827
170 Ga0207669_10013371 3300025937 Bacteria 4073
171 Ga0207669_10802154 3300025937 Bacteria 781
172 Ga0207669_11209743 3300025937 Bacteria 640
173 Ga0207704_10279813 3300025938 Bacteria 1268
174 Ga0207704_11378327 3300025938 Bacteria 604
175 Ga0207691_10254028 3300025940 Bacteria 1517
176 Ga0207691_10556288 3300025940 Bacteria 972
177 Ga0207661_10169089 3300025944 Bacteria 1902
178 Ga0207679_10144034 3300025945 Bacteria 1930
179 Ga0207679_10405599 3300025945 Bacteria 1200
180 Ga0207651_10051234 3300025960 Bacteria 2807
181 Ga0207651_10153396 3300025960 Bacteria 1796
182 Ga0207651_10175354 3300025960 Bacteria 1695
183 Ga0207651_10258505 3300025960 Bacteria 1428
184 Ga0207712_10451635 3300025961 Bacteria 1090
185 Ga0207712_11479847 3300025961 Unclassified 608
186 Ga0207668_11569024 3300025972 Bacteria 594
187 Ga0207658_10198343 3300025986 Bacteria 1674
188 Ga0207677_10099821 3300026023 Bacteria 2133
189 Ga0207639_10089660 3300026041 Bacteria 2458
190 Ga0207708_10224206 3300026075 Bacteria 1507
191 Ga0207708_10241295 3300026075 Bacteria 1454
192 Ga0207708_10470436 3300026075 Bacteria 1049
193 Ga0207708_10692891 3300026075 Bacteria 870
194 Ga0207648_10226754 3300026089 Bacteria 1661
195 Ga0207676_10233301 3300026095 Bacteria 1646
196 Ga0207674_10163214 3300026116 Bacteria 2182
197 Ga0207674_10697634 3300026116 Bacteria 980
198 Ga0207675_100026664 3300026118 Bacteria 5379
199 Ga0207675_100355203 3300026118 Bacteria 1437
200 Ga0207683_10195258 3300026121 Bacteria 1839
201 Ga0209971_1005060 3300027682 Bacteria 3131
202 Ga0209966_1063940 3300027695 Bacteria 798
203 Ga0209813_10016200 3300027866 Bacteria 2032
204 Ga0207428_10411389 3300027907 Bacteria 989
205 Ga0268265_10545895 3300028380 Bacteria 1099
206 Ga0268265_11177034 3300028380 Bacteria 763
207 Ga0268264_10252199 3300028381 Bacteria 1640
208 Ga0268264_11250401 3300028381 Bacteria 752
209 Ga0316578_10146422 3300031728 Bacteria 1423
210 Ga0307412_11153721 3300031911 Unclassified 692
211 Ga0307409_100320141 3300031995 Bacteria 1451
212 Ga0307416_100454812 3300032002 Bacteria 1334
213 Ga0307411_10544813 3300032005 Bacteria 989
214 Ga0307415_100735945 3300032126 Bacteria 894
215 Ga0373926_0065512 3300035083 Bacteria 1329
216 Ga0373953_0210341 3300035117 Bacteria 842
217 Ga0373954_0336056 3300035118 Bacteria 746
218 Ga0373957_0032456 3300035120 Bacteria 1923
219 Ga0373957_0136258 3300035120 Bacteria 1002
220 Ga0373943_0184858 3300035170 Bacteria 1147
221 Ga0373933_0032456 3300035724 Bacteria 3035
222 Ga0373937_0007516 3300036401 Bacteria 9433
223 Ga0373937_0085117 3300036401 Bacteria 2926
224 Ga0373925_0003153 3300037068 Bacteria 12918
225 Ga0451807_2731722 3300041486 Bacteria 566
226 Ga0451576_0052140 3300045051 Bacteria 4287
227 Ga0451576_0338082 3300045051 Bacteria 1576
228 Ga0451576_1931332 3300045051 Unclassified 609
229 Ga0495603_0234100 3300046455 Bacteria 1059
230 Ga0495638_0007942 3300046460 Bacteria 7567
231 Ga0495639_0214233 3300046475 Bacteria 945
232 Ga0495594_0300833 3300046499 Bacteria 914
233 Ga0495628_0190120 3300046516 Bacteria 1550
234 Ga0495659_0103751 3300046664 Bacteria 1104
235 Ga0495599_0109216 3300046678 Bacteria 1723
236 Ga0495646_0438116 3300046680 Bacteria 676
237 Ga0495636_0073575 3300047318 Bacteria 1462
238 Ga0495674_0110410 3300047319 Bacteria 2332
239 Ga0495674_0958211 3300047319 Bacteria 658
240 Ga0495680_0138904 3300047322 Bacteria 1779
241 Ga0495614_0118071 3300048089 Bacteria 1168
242 Ga0496101_0156245 3300048904 Bacteria 1747
243 Ga0496102_0010247 3300048905 Bacteria 8059
244 Ga0496103_0133500 3300048906 Bacteria 1586
245 Ga0496104_0614169 3300048907 Bacteria 997
246 Ga0496104_1028064 3300048907 Bacteria 728
247 Ga0496106_0264179 3300048909 Bacteria 1377
248 Ga0496106_0440912 3300048909 Bacteria 1046
249 Ga0496107_0318395 3300048910 Bacteria 1158
250 Ga0496110_0058075 3300048913 Bacteria 3407
251 Ga0496112_0028083 3300048915 Bacteria 5428
252 Ga0496113_0154557 3300048916 Bacteria 1811
253 Ga0496114_0294303 3300048917 Bacteria 1433
254 Ga0501031_0002965 3300049568 Bacteria 10861
255 Ga0501032_0011090 3300049569 Bacteria 6475
256 Ga0501032_0036543 3300049569 Bacteria 3352
257 Ga0501033_0003798 3300049570 Bacteria 12286
258 Ga0501033_0010678 3300049570 Bacteria 7037
259 Ga0501033_0019069 3300049570 Bacteria 5186
260 Ga0501034_0012278 3300049571 Bacteria 8852
261 Ga0501034_0170513 3300049571 Bacteria 2143
262 Ga0501036_0001288 3300049572 Bacteria 19206
263 Ga0501036_0064757 3300049572 Bacteria 3093
264 Ga0501036_0087355 3300049572 Bacteria 2635
265 Ga0501036_0123239 3300049572 Bacteria 2189
266 Ga0501037_0005114 3300049573 Bacteria 9538
267 Ga0501037_0092720 3300049573 Bacteria 2185
268 Ga0501037_0145911 3300049573 Bacteria 1692
269 Ga0501038_0013284 3300049574 Bacteria 7509
270 Ga0501038_0029763 3300049574 Bacteria 4836
271 Ga0501038_0096996 3300049574 Bacteria 2460
272 Ga0501038_0437278 3300049574 Bacteria 1008
273 Ga0501039_0044494 3300049575 Bacteria 3429
274 Ga0501039_0137081 3300049575 Bacteria 1922
275 Ga0501039_0625334 3300049575 Bacteria 843
276 Ga0501039_0875874 3300049575 Bacteria 699
277 Ga0501039_0886368 3300049575 Bacteria 695
278 Ga0501040_0115186 3300049576 Bacteria 1882
279 Ga0501040_0307515 3300049576 Bacteria 1133
280 Ga0501040_0528547 3300049576 Bacteria 851
281 Ga0501041_0250149 3300049577 Bacteria 1114
282 Ga0501042_0011496 3300049578 Bacteria 5976
283 Ga0501042_0046566 3300049578 Bacteria 3092
284 Ga0501043_0019720 3300049579 Bacteria 5295
285 Ga0501043_0041713 3300049579 Bacteria 3605
286 Ga0501043_0084324 3300049579 Bacteria 2497
287 Ga0501043_0560293 3300049579 Bacteria 848
288 Ga0501046_0010413 3300049580 Bacteria 7988
289 Ga0501046_0084346 3300049580 Bacteria 2450
290 Ga0501046_0099567 3300049580 Bacteria 2231
291 Ga0501046_0513361 3300049580 Bacteria 857
292 Ga0501047_0025544 3300049581 Bacteria 5678
293 Ga0501047_0076783 3300049581 Bacteria 3214
294 Ga0501047_0825258 3300049581 Bacteria 741
295 Ga0501048_0012101 3300049582 Bacteria 6431
296 Ga0501048_0018801 3300049582 Bacteria 5079
297 Ga0501048_0108321 3300049582 Bacteria 1961
298 Ga0501048_0147183 3300049582 Bacteria 1666
299 Ga0501048_0683129 3300049582 Bacteria 737
300 Ga0501067_0001597 3300049583 Bacteria 12418
301 Ga0501067_0009296 3300049583 Bacteria 5445
302 Ga0501067_0146727 3300049583 Bacteria 1314
303 Ga0501068_0028858 3300049584 Bacteria 3283
304 Ga0501068_0032675 3300049584 Bacteria 3094
305 Ga0501068_0212224 3300049584 Bacteria 1229
306 Ga0501068_1012456 3300049584 Bacteria 548
307 Ga0501069_0000277 3300049585 Bacteria 23273
308 Ga0501070_0004794 3300049586 Bacteria 11569
309 Ga0501070_0018320 3300049586 Bacteria 5873
310 Ga0501070_0282308 3300049586 Bacteria 1354
311 Ga0501071_0000369 3300049587 Bacteria 22026
312 Ga0501071_0124630 3300049587 Bacteria 1911
313 Ga0501072_0096581 3300049588 Bacteria 2348
314 Ga0501072_0344088 3300049588 Bacteria 1184
315 Ga0501072_0794862 3300049588 Bacteria 741
316 Ga0501073_0003611 3300049589 Bacteria 11631
317 Ga0501073_0007039 3300049589 Bacteria 8379
318 Ga0501073_0183430 3300049589 Bacteria 1448
319 Ga0501074_0000449 3300049590 Bacteria 24661
320 Ga0501074_0110537 3300049590 Bacteria 1966
321 Ga0501074_0187100 3300049590 Bacteria 1476
322 Ga0501074_0281147 3300049590 Bacteria 1183
323 Ga0501074_0289435 3300049590 Bacteria 1164
324 Ga0501075_0040336 3300049591 Bacteria 3496
325 Ga0501075_0137540 3300049591 Bacteria 1861
326 Ga0501075_0453622 3300049591 Bacteria 978
327 Ga0501076_0046119 3300049592 Bacteria 3443
328 Ga0501076_1196275 3300049592 Bacteria 625
329 Ga0501076_1287840 3300049592 Unclassified 601
330 Ga0501077_0386515 3300049593 Bacteria 894
331 Ga0501079_0005948 3300049741 Bacteria 9128
332 Ga0501079_0035925 3300049741 Bacteria 3815
333 Ga0501079_0046723 3300049741 Bacteria 3340
334 Ga0501079_0426404 3300049741 Bacteria 1041
335 Ga0501079_0597182 3300049741 Bacteria 869
336 Ga0501080_0005720 3300049742 Bacteria 11120
337 Ga0501080_0050301 3300049742 Bacteria 3879
338 Ga0501081_0471794 3300049743 Bacteria 933
339 Ga0501083_0023709 3300049744 Bacteria 4255
340 Ga0501083_0043376 3300049744 Bacteria 3047
341 Ga0501035_0007716 3300049822 Bacteria 10049
342 Ga0501035_0008187 3300049822 Bacteria 9743
343 Ga0501035_0084806 3300049822 Bacteria 2793
344 Ga0501035_0399469 3300049822 Bacteria 1144
345 Ga0501044_0010848 3300049823 Bacteria 9884
346 Ga0501044_0013275 3300049823 Bacteria 8917
347 Ga0501044_0298786 3300049823 Bacteria 1539
348 Ga0501045_0021517 3300049824 Bacteria 4614
349 Ga0501045_0029810 3300049824 Bacteria 3945
350 Ga0501045_0063767 3300049824 Bacteria 2704
351 Ga0501045_0151415 3300049824 Bacteria 1726
352 Ga0501045_0328618 3300049824 Bacteria 1138
353 nmdc:mga00v17_501308_c1 3300050491 Bacteria 787
354 nmdc:mga0yw44_15647_c1 3300050492 Bacteria 4071
355 nmdc:mga0yw44_164355_c1 3300050492 Bacteria 1454
356 nmdc:mga0yw44_798796_c1 3300050492 Bacteria 641
357 nmdc:mga0k408_238378_c1 3300050493 Bacteria 1086
358 nmdc:mga0k408_642372_c1 3300050493 Bacteria 624
359 nmdc:mga06z11_24748_c1 3300050494 Bacteria 2837
360 nmdc:mga06z11_67165_c1 3300050494 Bacteria 1887
361 nmdc:mga04h51_16648_c1 3300050495 Bacteria 2137
362 nmdc:mga05p37_354285_c1 3300050507 Bacteria 1727
363 nmdc:mga05p37_862585_c1 3300050507 Bacteria 982
364 nmdc:mga05p37_985709_c1 3300050507 Bacteria 897
365 nmdc:mga0qj67_21246_c1 3300050509 Bacteria 4979
366 nmdc:mga08y16_380747_c1 3300050511 Bacteria 1446
367 nmdc:mga0n895_182504_c1 3300050512 Bacteria 2130
368 nmdc:mga0n895_233598_c1 3300050512 Bacteria 1866
369 nmdc:mga0n895_285681_c1 3300050512 Bacteria 1673
370 nmdc:mga0n895_435716_c1 3300050512 Bacteria 1324
371 nmdc:mga0n895_55687_c1 3300050512 Bacteria 3892
372 nmdc:mga0n895_577675_c1 3300050512 Bacteria 1128
373 nmdc:mga0rr50_12958_c1 3300050513 Bacteria 5408
374 nmdc:mga08x19_84466_c1 3300050514 Bacteria 2088
375 nmdc:mga0a205_23429_c1 3300050515 Bacteria 5857
376 nmdc:mga0a205_980469_c1 3300050515 Bacteria 692
377 nmdc:mga0sz30_102735_c1 3300050516 Bacteria 1249
378 Ga0495619_0167029 3300053085 Bacteria 1521
379 Ga0501084_0020395 3300054114 Bacteria 5527
380 Ga0501084_0133437 3300054114 Bacteria 2090
381 Ga0501084_0335018 3300054114 Bacteria 1278
382 Ga0501084_0440199 3300054114 Bacteria 1102
383 Ga0590077_098964 3300059426 Bacteria 681
384 Ga0501082_0002846 3300060353 Bacteria 15076
385 Ga0501082_0007501 3300060353 Bacteria 9412
386 Ga0501082_0248682 3300060353 Bacteria 1547
387 Ga0501082_0599776 3300060353 Bacteria 964
388 Ga0501082_0812124 3300060353 Bacteria 818
389 Ga0501082_1424283 3300060353 Bacteria 605
390 Ga0501042_0157927
391 Ga0065712_10007252
392 Ga0065712_10216000
393 Ga0065715_10130806
394 Ga0065715_10192965
395 Ga0065707_10084692
396 Ga0065707_10332437
397 Ga0070676_10603651
398 Ga0070676_10625328
399 Ga0070676_11498186
400 Ga0070683_101111613
401 Ga0070690_100317000
402 Ga0070670_100933441
403 Ga0070677_10353610
404 Ga0070666_10509338
405 Ga0070680_101970105
406 Ga0068868_100534735
407 Ga0070689_100851216
408 Ga0070687_100259610
409 Ga0070687_100372797
410 Ga0070687_101106455
411 Ga0070661_100870627
412 Ga0070669_100037108
413 Ga0070669_100079718
414 Ga0070675_100623131
415 Ga0070675_101690728
416 Ga0070674_100816275
417 Ga0070674_100983241
418 Ga0070673_100005359
419 Ga0070673_100051140
420 Ga0070673_100215398
421 Ga0070673_100245025
422 Ga0070688_100028461
423 Ga0070688_100111753
424 Ga0070667_100897166
425 Ga0070709_10159037
426 Ga0070713_100036514
427 Ga0070701_10423761
428 Ga0070700_100964215
429 Ga0070700_101268305
430 Ga0070694_100888374
431 Ga0070708_100257981
432 Ga0070708_100489845
433 Ga0070708_101334992
434 Ga0070678_100893329
435 Ga0070662_100455189
436 Ga0070662_100553231
437 Ga0070662_100714427
438 Ga0068867_100181825
439 Ga0068867_100538799
440 Ga0070706_100005309
441 Ga0070707_100002280
442 Ga0070707_100615318
443 Ga0070698_100021237
444 Ga0070698_101244463
445 Ga0070699_100001510
446 Ga0070699_100391810
447 Ga0070699_100802190
448 Ga0070699_101689123
449 Ga0070697_100003704
450 Ga0070672_100226330
451 Ga0070672_100236673
452 Ga0070672_100506741
453 Ga0070686_100097487
454 Ga0070686_100505734
455 Ga0070696_100453165
456 Ga0070696_100573825
457 Ga0070704_100170523
458 Ga0070704_100317168
459 Ga0070704_100813173
460 Ga0070704_100964593
461 Ga0070664_100272045
462 Ga0070702_101393251
463 Ga0068852_100097161
464 Ga0068859_100001580
465 Ga0068859_100005074
466 Ga0068859_100005255
467 Ga0068859_100249684
468 Ga0068859_100493212
469 Ga0068859_100525993
470 Ga0068864_100303304
471 Ga0068866_10310636
472 Ga0068861_100037801
473 Ga0068861_100131743
474 Ga0068870_10125855
475 Ga0068870_10133156
476 Ga0068860_100175328
477 Ga0068860_100964868
478 Ga0068862_100194378
479 Ga0070717_10074134
480 Ga0075365_10019563
481 Ga0075365_10203564
482 Ga0075365_10534899
483 Ga0075368_10014820
484 Ga0075363_100036659
485 Ga0075363_100842762
486 Ga0075367_10004737
487 Ga0075369_10084760
488 Ga0075366_10059813
489 Ga0075366_10224639
490 Ga0075366_10822603
491 Ga0075428_100217307
492 Ga0075428_101087206
493 Ga0075430_100146321
494 Ga0075430_100207503
495 Ga0075431_100405486
496 Ga0075431_100519009
497 Ga0075433_10009466
498 Ga0075433_10184207
499 Ga0075433_10926196
500 Ga0075433_10995273
501 Ga0075433_11068831
502 Ga0075433_11340452
503 Ga0075434_100007256
504 Ga0075434_100070773
505 Ga0075434_100253564
506 Ga0075434_100483139
507 Ga0075429_101403555
508 Ga0097620_100001580
509 Ga0097620_100005074
510 Ga0097620_100005255
511 Ga0097620_100249692
512 Ga0097620_100493219
513 Ga0097620_100525980
514 Ga0075435_100017729
515 Ga0099794_10241194
516 Ga0111539_10592533
517 Ga0111539_11526441
518 Ga0105247_11217192
519 Ga0114129_10160311
520 Ga0114129_10355487
521 Ga0114129_10535828
522 Ga0105243_12886281
523 Ga0105242_10304482
524 Ga0105248_10513831
525 Ga0105248_11198238
526 Ga0105238_10530138
527 Ga0105249_10280534
528 Ga0105249_10328627
529 Ga0105249_11673509
530 Ga0105249_12170942
531 Ga0157378_10924788
532 Ga0163162_11289543
533 Ga0157375_11023342
534 Ga0163163_11846392
535 Ga0157380_10123942
536 Ga0157380_10574405
537 Ga0157380_10778535
538 Ga0157380_11403851
539 Ga0157380_12448209
540 Ga0157377_10174585
541 Ga0207682_10183790
542 Ga0207699_10110474
543 Ga0207643_10148880
544 Ga0207684_10001191
545 Ga0207684_10408233
546 Ga0207693_11040631
547 Ga0207657_10960115
548 Ga0207646_10006888
549 Ga0207646_10597725
550 Ga0207646_11808499
551 Ga0207681_10050036
552 Ga0207681_10334878
553 Ga0207659_10497135
554 Ga0207659_10738766
555 Ga0207700_10139277
556 Ga0207706_10386664
557 Ga0207706_10527264
558 Ga0207670_10132601
559 Ga0207669_10013371
560 Ga0207669_10802154
561 Ga0207669_11209743
562 Ga0207704_10279813
563 Ga0207704_11378327
564 Ga0207691_10254028
565 Ga0207691_10556288
566 Ga0207661_10169089
567 Ga0207679_10144034
568 Ga0207679_10405599
569 Ga0207651_10051234
570 Ga0207651_10153396
571 Ga0207651_10175354
572 Ga0207651_10258505
573 Ga0207712_10451635
574 Ga0207712_11479847
575 Ga0207668_11569024
576 Ga0207658_10198343
577 Ga0207677_10099821
578 Ga0207639_10089660
579 Ga0207708_10224206
580 Ga0207708_10241295
581 Ga0207708_10470436
582 Ga0207708_10692891
583 Ga0207648_10226754
584 Ga0207676_10233301
585 Ga0207674_10163214
586 Ga0207674_10697634
587 Ga0207675_100026664
588 Ga0207675_100355203
589 Ga0207683_10195258
590 Ga0209971_1005060
591 Ga0209966_1063940
592 Ga0209813_10016200
593 Ga0207428_10411389
594 Ga0268265_10545895
595 Ga0268265_11177034
596 Ga0268264_10252199
597 Ga0268264_11250401
598 Ga0316578_10146422
599 Ga0307412_11153721
600 Ga0307409_100320141
601 Ga0307416_100454812
602 Ga0307411_10544813
603 Ga0307415_100735945
604 Ga0373926_0065512
605 Ga0373953_0210341
606 Ga0373954_0336056
607 Ga0373957_0032456
608 Ga0373957_0136258
609 Ga0373943_0184858
610 Ga0373933_0032456
611 Ga0373937_0007516
612 Ga0373937_0085117
613 Ga0373925_0003153
614 Ga0451807_2731722
615 Ga0451576_0052140
616 Ga0451576_0338082
617 Ga0451576_1931332
618 Ga0495603_0234100
619 Ga0495638_0007942
620 Ga0495639_0214233
621 Ga0495594_0300833
622 Ga0495628_0190120
623 Ga0495659_0103751
624 Ga0495599_0109216
625 Ga0495646_0438116
626 Ga0495636_0073575
627 Ga0495674_0110410
628 Ga0495674_0958211
629 Ga0495680_0138904
630 Ga0495614_0118071
631 Ga0496101_0156245
632 Ga0496102_0010247
633 Ga0496103_0133500
634 Ga0496104_0614169
635 Ga0496104_1028064
636 Ga0496106_0264179
637 Ga0496106_0440912
638 Ga0496107_0318395
639 Ga0496110_0058075
640 Ga0496112_0028083
641 Ga0496113_0154557
642 Ga0496114_0294303
643 Ga0501031_0002965
644 Ga0501032_0011090
645 Ga0501032_0036543
646 Ga0501033_0003798
647 Ga0501033_0010678
648 Ga0501033_0019069
649 Ga0501034_0012278
650 Ga0501034_0170513
651 Ga0501036_0001288
652 Ga0501036_0064757
653 Ga0501036_0087355
654 Ga0501036_0123239
655 Ga0501037_0005114
656 Ga0501037_0092720
657 Ga0501037_0145911
658 Ga0501038_0013284
659 Ga0501038_0029763
660 Ga0501038_0096996
661 Ga0501038_0437278
662 Ga0501039_0044494
663 Ga0501039_0137081
664 Ga0501039_0625334
665 Ga0501039_0875874
666 Ga0501039_0886368
667 Ga0501040_0115186
668 Ga0501040_0307515
669 Ga0501040_0528547
670 Ga0501041_0250149
671 Ga0501042_0011496
672 Ga0501042_0046566
673 Ga0501043_0019720
674 Ga0501043_0041713
675 Ga0501043_0084324
676 Ga0501043_0560293
677 Ga0501046_0010413
678 Ga0501046_0084346
679 Ga0501046_0099567
680 Ga0501046_0513361
681 Ga0501047_0025544
682 Ga0501047_0076783
683 Ga0501047_0825258
684 Ga0501048_0012101
685 Ga0501048_0018801
686 Ga0501048_0108321
687 Ga0501048_0147183
688 Ga0501048_0683129
689 Ga0501067_0001597
690 Ga0501067_0009296
691 Ga0501067_0146727
692 Ga0501068_0028858
693 Ga0501068_0032675
694 Ga0501068_0212224
695 Ga0501068_1012456
696 Ga0501069_0000277
697 Ga0501070_0004794
698 Ga0501070_0018320
699 Ga0501070_0282308
700 Ga0501071_0000369
701 Ga0501071_0124630
702 Ga0501072_0096581
703 Ga0501072_0344088
704 Ga0501072_0794862
705 Ga0501073_0003611
706 Ga0501073_0007039
707 Ga0501073_0183430
708 Ga0501074_0000449
709 Ga0501074_0110537
710 Ga0501074_0187100
711 Ga0501074_0281147
712 Ga0501074_0289435
713 Ga0501075_0040336
714 Ga0501075_0137540
715 Ga0501075_0453622
716 Ga0501076_0046119
717 Ga0501076_1196275
718 Ga0501076_1287840
719 Ga0501077_0386515
720 Ga0501079_0005948
721 Ga0501079_0035925
722 Ga0501079_0046723
723 Ga0501079_0426404
724 Ga0501079_0597182
725 Ga0501080_0005720
726 Ga0501080_0050301
727 Ga0501081_0471794
728 Ga0501083_0023709
729 Ga0501083_0043376
730 Ga0501035_0007716
731 Ga0501035_0008187
732 Ga0501035_0084806
733 Ga0501035_0399469
734 Ga0501044_0010848
735 Ga0501044_0013275
736 Ga0501044_0298786
737 Ga0501045_0021517
738 Ga0501045_0029810
739 Ga0501045_0063767
740 Ga0501045_0151415
741 Ga0501045_0328618
742 nmdc:mga00v17_501308_c1
743 nmdc:mga0yw44_15647_c1
744 nmdc:mga0yw44_164355_c1
745 nmdc:mga0yw44_798796_c1
746 nmdc:mga0k408_238378_c1
747 nmdc:mga0k408_642372_c1
748 nmdc:mga06z11_24748_c1
749 nmdc:mga06z11_67165_c1
750 nmdc:mga04h51_16648_c1
751 nmdc:mga05p37_354285_c1
752 nmdc:mga05p37_862585_c1
753 nmdc:mga05p37_985709_c1
754 nmdc:mga0qj67_21246_c1
755 nmdc:mga08y16_380747_c1
756 nmdc:mga0n895_182504_c1
757 nmdc:mga0n895_233598_c1
758 nmdc:mga0n895_285681_c1
759 nmdc:mga0n895_435716_c1
760 nmdc:mga0n895_55687_c1
761 nmdc:mga0n895_577675_c1
762 nmdc:mga0rr50_12958_c1
763 nmdc:mga08x19_84466_c1
764 nmdc:mga0a205_23429_c1
765 nmdc:mga0a205_980469_c1
766 nmdc:mga0sz30_102735_c1
767 Ga0495619_0167029
768 Ga0501084_0020395
769 Ga0501084_0133437
770 Ga0501084_0335018
771 Ga0501084_0440199
772 Ga0590077_098964
773 Ga0501082_0002846
774 Ga0501082_0007501
775 Ga0501082_0248682
776 Ga0501082_0599776
777 Ga0501082_0812124
778 Ga0501082_1424283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

90

135

0.97

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

8

85

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9599 7 102
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9576 7 102
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9405 12 82
6fkh-assembly1.cif.gz_e chloroplast f1fo conformation 2 0.9266 7 97
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9129 7 91
ID Description Score Start End Superfamily
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9648 7 91 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9643 5 91 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9596 6 91 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9497 6 91 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9495 28 91 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A832DIA0-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9967 6 92 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A1F9HME4-F1-model_v4 ATP synthase F1 subunit epsilon 0.9914 6 86 GO:0012505
GO:0045261
GO:0046933
AF-A0A7C7L6X6-F1-model_v4 ATP synthase F1 complex delta/epsilon subunit N-terminal domain-containing protein 0.9881 6 87 GO:0012505
GO:0045261
GO:0046933
AF-A0A523ID07-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9854 5 88 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A1G2P9M1-F1-model_v4 ATP synthase F1 complex delta/epsilon subunit N-terminal domain-containing protein 0.9835 6 82 GO:0012505
GO:0045261
GO:0046933

Map