F431439

General Info

Members Datasets Scaffolds Average Seq Length
389 207 385 169

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10202662|Ga0224712_102026622
Length 171
Sequence MRLILAGTFASMLLATGVAMAQGSKPTDPQIAHIAYTAGAIDIKNAEQALKKSQNKDVLAFANEMLKDHKAVNDKALALVKKLNVTPEDNATSQALTKQADEKRVSLEKMSGPDKAYADNEVAFHKTVNGALQQTLIPSANNAELKSLLQTGLKIFEGHQQHAEHVAASLK

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
4 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 2.83
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0.51
Rhizoplane 2.31
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10036645 3300002067 Bacteria 1439
2 JGI25162J39368_1005538 3300002737 Bacteria 2432
3 JGI25157J39369_1002287 3300002741 Bacteria 5055
4 JGI25164J39214_1002836 3300002772 Bacteria 2428
5 JGI25165J46597_1001813 3300003214 Bacteria 8988
6 rootL2_10140922 3300003322 Unclassified 3397
7 Ga0058862_12566575 3300004803 Bacteria 912
8 Ga0070658_10045139 3300005327 Bacteria 3562
9 Ga0070658_10442870 3300005327 Bacteria 1119
10 Ga0070683_100029813 3300005329 Bacteria 4944
11 Ga0070680_100098394 3300005336 Bacteria 2426
12 Ga0070680_100344015 3300005336 Bacteria 1268
13 Ga0070680_100610250 3300005336 Bacteria 937
14 Ga0070682_100094560 3300005337 Bacteria 1961
15 Ga0070660_100366069 3300005339 Bacteria 1189
16 Ga0070691_10003062 3300005341 Bacteria 7487
17 Ga0070691_10022553 3300005341 Bacteria 2921
18 Ga0070691_10166871 3300005341 Bacteria 1138
19 Ga0070661_100034152 3300005344 Bacteria 3688
20 Ga0070661_100397722 3300005344 Bacteria 1089
21 Ga0070668_100000306 3300005347 Bacteria 32248
22 Ga0070674_100164696 3300005356 Bacteria 1685
23 Ga0070674_100356879 3300005356 Bacteria 1182
24 Ga0070659_100031769 3300005366 Bacteria 4091
25 Ga0070659_101408006 3300005366 Bacteria 620
26 Ga0070714_100012214 3300005435 Bacteria 6849
27 Ga0070714_100622778 3300005435 Bacteria 1037
28 Ga0070713_100882608 3300005436 Bacteria 860
29 Ga0070663_100007814 3300005455 Bacteria 6537
30 Ga0070663_100073794 3300005455 Bacteria 2489
31 Ga0070663_101285325 3300005455 Bacteria 645
32 Ga0070662_100063945 3300005457 Bacteria 2693
33 Ga0070662_101397842 3300005457 Bacteria 603
34 Ga0070681_10205308 3300005458 Bacteria 1888
35 Ga0070681_10909404 3300005458 Bacteria 798
36 Ga0068867_100701819 3300005459 Bacteria 893
37 Ga0070679_100033166 3300005530 Bacteria 5113
38 Ga0070679_100141680 3300005530 Bacteria 2383
39 Ga0070679_100183733 3300005530 Bacteria 2062
40 Ga0070679_101001674 3300005530 Unclassified 780
41 Ga0070684_100001830 3300005535 Bacteria 15561
42 Ga0068853_100004017 3300005539 Bacteria 11320
43 Ga0068853_100553902 3300005539 Bacteria 1089
44 Ga0068853_100565353 3300005539 Unclassified 1078
45 Ga0070695_100781240 3300005545 Bacteria 764
46 Ga0070696_100404817 3300005546 Bacteria 1068
47 Ga0070693_100161255 3300005547 Bacteria 1428
48 Ga0068855_100020775 3300005563 Bacteria 7874
49 Ga0068855_100065217 3300005563 Bacteria 4246
50 Ga0068855_100180150 3300005563 Bacteria 2389
51 Ga0070664_100003170 3300005564 Bacteria 13292
52 Ga0068857_100022379 3300005577 Bacteria 5561
53 Ga0068857_100132383 3300005577 Bacteria 2249
54 Ga0068854_100001146 3300005578 Bacteria 15933
55 Ga0068854_100978176 3300005578 Bacteria 748
56 Ga0068854_101020649 3300005578 Unclassified 733
57 Ga0068856_100185796 3300005614 Bacteria 2092
58 Ga0068856_100481780 3300005614 Bacteria 1262
59 Ga0068852_100036896 3300005616 Bacteria 4095
60 Ga0068852_100282885 3300005616 Bacteria 1600
61 Ga0068864_100535729 3300005618 Bacteria 1130
62 Ga0068861_101123357 3300005719 Unclassified 756
63 Ga0068851_10066505 3300005834 Bacteria 1857
64 Ga0068863_100708068 3300005841 Bacteria 1001
65 Ga0068862_100000858 3300005844 Bacteria 29795
66 Ga0070712_100082658 3300006175 Unclassified 2330
67 Ga0070712_100478651 3300006175 Bacteria 1041
68 Ga0105240_10006152 3300009093 Bacteria 17700
69 Ga0105245_11001220 3300009098 Bacteria 880
70 Ga0105243_10310101 3300009148 Bacteria 1434
71 Ga0105241_10031812 3300009174 Bacteria 3951
72 Ga0105241_11849595 3300009174 Bacteria 590
73 Ga0105242_10867885 3300009176 Unclassified 899
74 Ga0105248_10011263 3300009177 Bacteria 9864
75 Ga0105237_10022017 3300009545 Bacteria 6541
76 Ga0105237_10053885 3300009545 Bacteria 4032
77 Ga0105238_10004239 3300009551 Bacteria 14247
78 Ga0105238_10018641 3300009551 Bacteria 7067
79 Ga0105249_11521909 3300009553 Unclassified 741
80 Ga0105239_10054106 3300010375 Bacteria 4402
81 Ga0105239_10784695 3300010375 Bacteria 1091
82 Ga0105246_10278564 3300011119 Bacteria 1340
83 Ga0157373_10010908 3300013100 Bacteria 6690
84 Ga0157373_10370513 3300013100 Unclassified 1023
85 Ga0157371_10292607 3300013102 Unclassified 1178
86 Ga0157371_10613312 3300013102 Bacteria 810
87 Ga0157370_10009252 3300013104 Bacteria 10558
88 Ga0157370_10019896 3300013104 Bacteria 6715
89 Ga0157370_11271871 3300013104 Bacteria 663
90 Ga0157369_10114879 3300013105 Bacteria 2859
91 Ga0157369_11039067 3300013105 Bacteria 838
92 Ga0157378_10347810 3300013297 Bacteria 1447
93 Ga0163162_10710636 3300013306 Bacteria 1126
94 Ga0157372_10026860 3300013307 Bacteria 6267
95 Ga0157372_10659261 3300013307 Bacteria 1218
96 Ga0157372_11238278 3300013307 Bacteria 862
97 Ga0182008_10063572 3300014497 Bacteria 1818
98 Ga0157379_11347671 3300014968 Bacteria 690
99 Ga0157376_11585669 3300014969 Bacteria 689
100 Ga0182007_10007258 3300015262 Bacteria 4663
101 Ga0182007_10029875 3300015262 Bacteria 1865
102 Ga0197907_11220975 3300020069 Bacteria 573
103 Ga0206356_10071297 3300020070 Bacteria 602
104 Ga0206350_10535322 3300020080 Bacteria 587
105 Ga0206354_11686731 3300020081 Bacteria 1610
106 Ga0224712_10087850 3300022467 Bacteria 1296
107 Ga0224712_10119128 3300022467 Bacteria 1141
108 Ga0224712_10202662 3300022467 Bacteria 902
109 Ga0224712_10310861 3300022467 Bacteria 739
110 Ga0209674_101350 3300025226 Bacteria 6689
111 Ga0207427_100322 3300025231 Bacteria 32298
112 Ga0209437_100118 3300025233 Bacteria 207534
113 Ga0209258_111740 3300025242 Bacteria 1095
114 Ga0209026_1000010 3300025250 Bacteria 511986
115 Ga0209759_1011133 3300025256 Bacteria 2580
116 Ga0209233_1000046 3300025261 Bacteria 470971
117 Ga0207656_10007269 3300025321 Bacteria 4024
118 Ga0207642_10209710 3300025899 Bacteria 1082
119 Ga0207647_10002290 3300025904 Bacteria 14586
120 Ga0207705_10003398 3300025909 Bacteria 12103
121 Ga0207705_10025993 3300025909 Bacteria 4178
122 Ga0207654_10110228 3300025911 Bacteria 1711
123 Ga0207707_10212129 3300025912 Bacteria 1686
124 Ga0207695_10014439 3300025913 Bacteria 9356
125 Ga0207695_10694553 3300025913 Unclassified 898
126 Ga0207671_10042657 3300025914 Bacteria 3357
127 Ga0207671_10460833 3300025914 Bacteria 1013
128 Ga0207660_10068517 3300025917 Bacteria 2574
129 Ga0207660_10323915 3300025917 Bacteria 1231
130 Ga0207657_10007729 3300025919 Bacteria 10978
131 Ga0207657_10245497 3300025919 Bacteria 1428
132 Ga0207649_10003373 3300025920 Bacteria 8740
133 Ga0207652_10250779 3300025921 Bacteria 1596
134 Ga0207652_10271393 3300025921 Unclassified 1530
135 Ga0207652_11255084 3300025921 Bacteria 643
136 Ga0207694_10036468 3300025924 Bacteria 3774
137 Ga0207694_10073033 3300025924 Bacteria 2683
138 Ga0207700_10449068 3300025928 Bacteria 1136
139 Ga0207664_10027244 3300025929 Bacteria 4330
140 Ga0207690_10002554 3300025932 Bacteria 11002
141 Ga0207690_10318236 3300025932 Unclassified 1222
142 Ga0207709_10682670 3300025935 Bacteria 820
143 Ga0207669_10314920 3300025937 Bacteria 1195
144 Ga0207711_10076378 3300025941 Bacteria 2917
145 Ga0207661_10002656 3300025944 Bacteria 12300
146 Ga0207679_10004108 3300025945 Bacteria 9035
147 Ga0207667_10107753 3300025949 Plasmid 2875
148 Ga0207667_10114757 3300025949 Bacteria 2776
149 Ga0207668_10011298 3300025972 Bacteria 5420
150 Ga0207640_10018863 3300025981 Bacteria 4062
151 Ga0207640_10753343 3300025981 Unclassified 840
152 Ga0207703_11061623 3300026035 Bacteria 778
153 Ga0207639_10014469 3300026041 Bacteria 5550
154 Ga0207639_10404564 3300026041 Bacteria 1230
155 Ga0207639_10490442 3300026041 Unclassified 1121
156 Ga0207639_10617377 3300026041 Bacteria 1001
157 Ga0207678_10019294 3300026067 Bacteria 5989
158 Ga0207678_10028356 3300026067 Bacteria 4887
159 Ga0207678_11504055 3300026067 Bacteria 594
160 Ga0207702_10004728 3300026078 Bacteria 12029
161 Ga0207648_10846639 3300026089 Bacteria 853
162 Ga0207674_10002263 3300026116 Bacteria 24396
163 Ga0207674_10029247 3300026116 Bacteria 5803
164 Ga0207675_101192209 3300026118 Unclassified 782
165 Ga0207698_10002762 3300026142 Bacteria 10472
166 Ga0209998_10048625 3300027717 Bacteria 977
167 Ga0268265_10000744 3300028380 Bacteria 31783
168 Ga0265339_10205236 3300031249 Bacteria 970
169 Ga0265313_10010775 3300031595 Bacteria 5746
170 Ga0265314_10224854 3300031711 Bacteria 1093
171 Ga0265342_10001944 3300031712 Bacteria 18500
172 Ga0307410_10667804 3300031852 Bacteria 873
173 Ga0307407_10768487 3300031903 Bacteria 731
174 Ga0307416_100429655 3300032002 Bacteria 1368
175 Ga0373949_0040273 3300035090 Unclassified 1146
176 Ga0373932_0376655 3300035112 Bacteria 545
177 Ga0373945_0006277 3300035116 Bacteria 3829
178 Ga0373960_0030176 3300035121 Unclassified 1509
179 Ga0373960_0400068 3300035121 Unclassified 530
180 Ga0373943_0002649 3300035170 Bacteria 8144
181 Ga0373946_0004189 3300035171 Bacteria 5142
182 Ga0373942_0059202 3300035207 Bacteria 1094
183 Ga0373935_0003338 3300035692 Bacteria 9298
184 Ga0373927_0003944 3300035695 Bacteria 10513
185 Ga0373947_0000256 3300035725 Bacteria 29989
186 Ga0373925_0001634 3300037068 Bacteria 18906
187 Ga0373925_0681926 3300037068 Bacteria 847
188 Ga0395899_0024696 3300037312 Bacteria 4542
189 Ga0395899_0026185 3300037312 Bacteria 4401
190 Ga0395899_0424800 3300037312 Bacteria 875
191 Ga0395900_0002554 3300037418 Bacteria 19956
192 Ga0395900_0541902 3300037418 Bacteria 1109
193 Ga0395900_0615618 3300037418 Bacteria 1025
194 Ga0395900_1161187 3300037418 Bacteria 688
195 Ga0395898_0166002 3300037466 Bacteria 2111
196 Ga0395898_0393884 3300037466 Bacteria 1320
197 Ga0395905_0020946 3300037471 Bacteria 6191
198 Ga0395905_0036681 3300037471 Bacteria 4605
199 Ga0395901_0000203 3300038443 Bacteria 74605
200 Ga0395901_0062038 3300038443 Bacteria 3890
201 Ga0395901_0149437 3300038443 Bacteria 2455
202 Ga0395901_0221680 3300038443 Bacteria 1976
203 Ga0395901_0299731 3300038443 Bacteria 1667
204 Ga0395901_1093706 3300038443 Bacteria 768
205 Ga0450901_010394 3300042533 Bacteria 964
206 Ga0453683_1078853 3300044673 Bacteria 535
207 Ga0466966_0148142 3300044684 Bacteria 1432
208 Ga0466963_0024793 3300044694 Unclassified 3820
209 Ga0466963_0124080 3300044694 Bacteria 1779
210 Ga0466963_0397939 3300044694 Bacteria 971
211 Ga0466957_0021609 3300044842 Bacteria 3793
212 Ga0451576_0024877 3300045051 Bacteria 6460
213 Ga0466958_0009376 3300045836 Bacteria 5455
214 Ga0466967_0552085 3300045976 Bacteria 1134
215 Ga0466967_1662432 3300045976 Bacteria 636
216 Ga0495580_0044495 3300046472 Bacteria 3157
217 Ga0495639_0040736 3300046475 Bacteria 2091
218 Ga0495618_0112762 3300046514 Bacteria 1741
219 Ga0495628_0402900 3300046516 Bacteria 999
220 Ga0495630_0016346 3300046517 Bacteria 5421
221 Ga0495666_0069515 3300046526 Bacteria 1675
222 Ga0495665_0008730 3300046531 Bacteria 5503
223 Ga0495634_0045370 3300046642 Bacteria 2972
224 Ga0495635_0462151 3300046663 Bacteria 838
225 Ga0495613_0107215 3300046689 Bacteria 2015
226 Ga0495624_0035690 3300046690 Bacteria 3209
227 Ga0495674_0293404 3300047319 Bacteria 1329
228 Ga0495676_0026619 3300047321 Bacteria 4976
229 Ga0495684_0002492 3300047471 Bacteria 14674
230 Ga0495593_0013012 3300047673 Bacteria 4752
231 Ga0496100_0018511 3300048903 Bacteria 4133
232 Ga0496101_0037389 3300048904 Bacteria 3444
233 Ga0496102_0091319 3300048905 Bacteria 2819
234 Ga0496102_0100241 3300048905 Bacteria 2690
235 Ga0496106_0022006 3300048909 Bacteria 4737
236 Ga0496106_0390204 3300048909 Bacteria 1119
237 Ga0496112_0073833 3300048915 Bacteria 3371
238 Ga0496113_0005356 3300048916 Bacteria 7996
239 Ga0496114_0185558 3300048917 Bacteria 1817
240 Ga0501031_0001336 3300049568 Bacteria 15190
241 Ga0501031_0008194 3300049568 Bacteria 6801
242 Ga0501031_0082464 3300049568 Bacteria 2096
243 Ga0501031_0183757 3300049568 Bacteria 1365
244 Ga0501032_0004015 3300049569 Bacteria 11156
245 Ga0501032_0020202 3300049569 Bacteria 4643
246 Ga0501032_0218460 3300049569 Bacteria 1241
247 Ga0501032_0236688 3300049569 Bacteria 1186
248 Ga0501032_0392693 3300049569 Bacteria 891
249 Ga0501033_0000866 3300049570 Bacteria 27653
250 Ga0501033_0018318 3300049570 Bacteria 5290
251 Ga0501033_0064915 3300049570 Bacteria 2685
252 Ga0501033_0284271 3300049570 Bacteria 1167
253 Ga0501034_0005588 3300049571 Bacteria 13695
254 Ga0501034_0046005 3300049571 Bacteria 4409
255 Ga0501034_0247761 3300049571 Bacteria 1726
256 Ga0501034_0278744 3300049571 Bacteria 1611
257 Ga0501036_0000276 3300049572 Bacteria 35283
258 Ga0501036_0047767 3300049572 Bacteria 3624
259 Ga0501036_0059594 3300049572 Bacteria 3234
260 Ga0501036_0143846 3300049572 Bacteria 2011
261 Ga0501036_0233491 3300049572 Bacteria 1543
262 Ga0501036_0334170 3300049572 Bacteria 1265
263 Ga0501036_1176056 3300049572 Bacteria 625
264 Ga0501037_0000958 3300049573 Bacteria 21450
265 Ga0501037_0024396 3300049573 Bacteria 4473
266 Ga0501037_0118942 3300049573 Bacteria 1900
267 Ga0501038_0005966 3300049574 Bacteria 11266
268 Ga0501038_0051121 3300049574 Bacteria 3568
269 Ga0501038_0121563 3300049574 Bacteria 2152
270 Ga0501038_0157412 3300049574 Bacteria 1849
271 Ga0501039_0003423 3300049575 Bacteria 11840
272 Ga0501039_0005815 3300049575 Bacteria 9337
273 Ga0501039_0179014 3300049575 Bacteria 1667
274 Ga0501040_0082324 3300049576 Bacteria 2231
275 Ga0501040_0118656 3300049576 Bacteria 1855
276 Ga0501040_0137307 3300049576 Bacteria 1721
277 Ga0501040_0156329 3300049576 Bacteria 1610
278 Ga0501041_0095285 3300049577 Bacteria 1839
279 Ga0501042_0006948 3300049578 Bacteria 7387
280 Ga0501042_0020819 3300049578 Bacteria 4566
281 Ga0501042_0168925 3300049578 Bacteria 1578
282 Ga0501042_0173132 3300049578 Bacteria 1557
283 Ga0501043_0008033 3300049579 Bacteria 8331
284 Ga0501043_0029042 3300049579 Bacteria 4342
285 Ga0501043_0107633 3300049579 Bacteria 2189
286 Ga0501046_0000594 3300049580 Bacteria 35581
287 Ga0501046_0091519 3300049580 Bacteria 2339
288 Ga0501046_0165282 3300049580 Bacteria 1663
289 Ga0501046_0214245 3300049580 Bacteria 1428
290 Ga0501047_0011224 3300049581 Bacteria 8478
291 Ga0501047_0055676 3300049581 Bacteria 3824
292 Ga0501047_0080112 3300049581 Bacteria 3139
293 Ga0501047_0169653 3300049581 Bacteria 2051
294 Ga0501047_0224956 3300049581 Bacteria 1732
295 Ga0501047_0238990 3300049581 Bacteria 1667
296 Ga0501047_0379297 3300049581 Bacteria 1248
297 Ga0501047_0488288 3300049581 Bacteria 1059
298 Ga0501047_0533656 3300049581 Bacteria 999
299 Ga0501048_0005654 3300049582 Bacteria 9510
300 Ga0501048_0075385 3300049582 Bacteria 2379
301 Ga0501048_0531575 3300049582 Bacteria 843
302 Ga0501048_0741926 3300049582 Bacteria 705
303 Ga0501067_0010940 3300049583 Bacteria 5023
304 Ga0501067_0015087 3300049583 Bacteria 4275
305 Ga0501067_0137442 3300049583 Bacteria 1360
306 Ga0501067_0301224 3300049583 Bacteria 892
307 Ga0501068_0009725 3300049584 Bacteria 5384
308 Ga0501068_0088800 3300049584 Bacteria 1904
309 Ga0501068_0107951 3300049584 Bacteria 1729
310 Ga0501068_0118527 3300049584 Bacteria 1649
311 Ga0501068_0183573 3300049584 Bacteria 1323
312 Ga0501068_0242306 3300049584 Bacteria 1148
313 Ga0501068_0666312 3300049584 Bacteria 680
314 Ga0501069_0020664 3300049585 Bacteria 3568
315 Ga0501069_0112769 3300049585 Bacteria 1549
316 Ga0501069_0276538 3300049585 Bacteria 982
317 Ga0501069_0477271 3300049585 Bacteria 743
318 Ga0501070_0009058 3300049586 Bacteria 8419
319 Ga0501070_0114633 3300049586 Bacteria 2226
320 Ga0501070_0315313 3300049586 Bacteria 1272
321 Ga0501070_0700289 3300049586 Bacteria 801
322 Ga0501071_0147719 3300049587 Bacteria 1752
323 Ga0501072_0100219 3300049588 Bacteria 2302
324 Ga0501072_0156271 3300049588 Bacteria 1818
325 Ga0501073_0019754 3300049589 Bacteria 4862
326 Ga0501073_0089596 3300049589 Bacteria 2138
327 Ga0501073_0116030 3300049589 Bacteria 1856
328 Ga0501073_0136976 3300049589 Bacteria 1697
329 Ga0501073_0336774 3300049589 Bacteria 1041
330 Ga0501074_0003617 3300049590 Bacteria 10974
331 Ga0501074_0067146 3300049590 Bacteria 2579
332 Ga0501074_0117282 3300049590 Bacteria 1904
333 Ga0501076_0202664 3300049592 Bacteria 1620
334 Ga0501076_0331716 3300049592 Bacteria 1248
335 Ga0501076_0386978 3300049592 Bacteria 1149
336 Ga0501077_0190906 3300049593 Bacteria 1301
337 Ga0501079_0160439 3300049741 Bacteria 1753
338 Ga0501079_0257644 3300049741 Bacteria 1363
339 Ga0501079_0469734 3300049741 Bacteria 988
340 Ga0501080_0028666 3300049742 Bacteria 5182
341 Ga0501080_0065291 3300049742 Bacteria 3385
342 Ga0501080_0084131 3300049742 Bacteria 2956
343 Ga0501080_0119917 3300049742 Bacteria 2438
344 Ga0501080_0144857 3300049742 Unclassified 2196
345 Ga0501080_0371697 3300049742 Bacteria 1289
346 Ga0501080_0784411 3300049742 Bacteria 836
347 Ga0501081_0013788 3300049743 Bacteria 5318
348 Ga0501081_0478351 3300049743 Bacteria 927
349 Ga0501081_0654613 3300049743 Bacteria 787
350 Ga0501083_0166045 3300049744 Bacteria 1443
351 Ga0501083_0258729 3300049744 Bacteria 1132
352 Ga0501083_0295108 3300049744 Bacteria 1054
353 Ga0501083_0889235 3300049744 Bacteria 580
354 Ga0501035_0003778 3300049822 Bacteria 14432
355 Ga0501035_0039274 3300049822 Bacteria 4283
356 Ga0501035_0219204 3300049822 Bacteria 1625
357 Ga0501035_0296668 3300049822 Bacteria 1363
358 Ga0501035_0437050 3300049822 Bacteria 1084
359 Ga0501035_0628657 3300049822 Bacteria 872
360 Ga0501044_0006712 3300049823 Bacteria 12684
361 Ga0501044_0053440 3300049823 Bacteria 4156
362 Ga0501044_0140930 3300049823 Bacteria 2399
363 Ga0501044_0211718 3300049823 Bacteria 1892
364 Ga0501044_0229484 3300049823 Bacteria 1804
365 Ga0501044_0421448 3300049823 Bacteria 1245
366 Ga0501045_0134196 3300049824 Bacteria 1840
367 Ga0501045_0229743 3300049824 Bacteria 1381
368 nmdc:mga0n895_209571_c1 3300050512 Bacteria 1979
369 Ga0495619_0034895 3300053085 Bacteria 3270
370 Ga0495619_0228542 3300053085 Bacteria 1289
371 Ga0500614_063693 3300053123 Bacteria 997
372 Ga0500637_0124109 3300053178 Bacteria 1498
373 Ga0501084_0008770 3300054114 Bacteria 8362
374 Ga0501084_0032214 3300054114 Bacteria 4384
375 Ga0501084_0043353 3300054114 Bacteria 3764
376 Ga0501084_0314990 3300054114 Bacteria 1321
377 Ga0587066_135805 3300059490 Unclassified 596
378 Ga0587098_030909 3300059604 Bacteria 736
379 Ga0501082_0005751 3300060353 Bacteria 10758
380 Ga0501082_0194442 3300060353 Bacteria 1764
381 Ga0501082_0435211 3300060353 Bacteria 1145
382 Ga0501082_0839164 3300060353 Bacteria 804
383 Ga0530510_0129976 3300061734 Bacteria 1852
384 Ga0530510_0150539 3300061734 Bacteria 1718
385 Ga0530510_0994401 3300061734 Bacteria 642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0006277 Ga0373945_0006277_3186_3662 147
2 3300035170 Ga0373943_0002649 Ga0373943_0002649_464_940 147
3 3300035171 Ga0373946_0004189 Ga0373946_0004189_1551_2027 147
4 3300035692 Ga0373935_0003338 Ga0373935_0003338_6912_7388 147
5 3300035695 Ga0373927_0003944 Ga0373927_0003944_1950_2426 147
6 3300035725 Ga0373947_0000256 Ga0373947_0000256_6980_7456 147
7 3300037068 Ga0373925_0001634 Ga0373925_0001634_3376_3852 147
8 3300046472 Ga0495580_0044495 Ga0495580_0044495_699_1175 147
9 3300046475 Ga0495639_0040736 Ga0495639_0040736_1209_1685 147
10 3300046514 Ga0495618_0112762 Ga0495618_0112762_363_839 147
11 3300046517 Ga0495630_0016346 Ga0495630_0016346_3495_3971 147
12 3300046526 Ga0495666_0069515 Ga0495666_0069515_351_827 147
13 3300046531 Ga0495665_0008730 Ga0495665_0008730_4103_4579 147
14 3300046642 Ga0495634_0045370 Ga0495634_0045370_1932_2408 147
15 3300046663 Ga0495635_0462151 Ga0495635_0462151_39_515 147
16 3300046689 Ga0495613_0107215 Ga0495613_0107215_470_946 147
17 3300046690 Ga0495624_0035690 Ga0495624_0035690_855_1331 147
18 3300047319 Ga0495674_0293404 Ga0495674_0293404_308_784 147
19 3300047321 Ga0495676_0026619 Ga0495676_0026619_3258_3734 147
20 3300047471 Ga0495684_0002492 Ga0495684_0002492_7213_7689 147
21 3300047673 Ga0495593_0013012 Ga0495593_0013012_2883_3359 147
22 3300053085 Ga0495619_0034895 Ga0495619_0034895_2322_2798 147
23 3300035112 Ga0373932_0376655 Ga0373932_0376655_20_502 151
24 3300037418 Ga0395900_1161187 Ga0395900_1161187_187_657 151
25 3300044673 Ga0453683_1078853 Ga0453683_1078853_38_517 151
26 3300035090 Ga0373949_0040273 Ga0373949_0040273_614_1117 152
27 3300035121 Ga0373960_0400068 Ga0373960_0400068_16_516 152
28 3300009148 Ga0105243_10310101 Ga0105243_103101012 153
29 3300014969 Ga0157376_11585669 Ga0157376_115856691 153
30 3300005327 Ga0070658_10442870 Ga0070658_104428701 154
31 3300044694 Ga0466963_0024793 Ga0466963_0024793_1397_1918 154
32 3300005435 Ga0070714_100012214 Ga0070714_1000122146 155
33 3300013104 Ga0157370_10019896 Ga0157370_100198964 155
34 3300013297 Ga0157378_10347810 Ga0157378_103478102 155
35 3300015262 Ga0182007_10029875 Ga0182007_100298753 155
36 3300002741 JGI25157J39369_1002287 JGI25157J39369_10022874 156
37 3300005435 Ga0070714_100622778 Ga0070714_1006227781 156
38 3300009098 Ga0105245_11001220 Ga0105245_110012201 156
39 3300025226 Ga0209674_101350 Ga0209674_1013507 156
40 3300025242 Ga0209258_111740 Ga0209258_1117401 156
41 3300025250 Ga0209026_1000010 Ga0209026_100001046 156
42 3300025256 Ga0209759_1011133 Ga0209759_10111333 156
43 3300027717 Ga0209998_10048625 Ga0209998_100486252 156
44 3300050512 nmdc:mga0n895_209571_c1 nmdc:mga0n895_209571_c1_652_1179 156
45 3300005436 Ga0070713_100882608 Ga0070713_1008826081 157
46 3300015262 Ga0182007_10007258 Ga0182007_100072583 157
47 3300025928 Ga0207700_10449068 Ga0207700_104490682 157
48 3300037312 Ga0395899_0024696 Ga0395899_0024696_688_1206 157
49 3300037466 Ga0395898_0393884 Ga0395898_0393884_526_1044 157
50 3300037471 Ga0395905_0020946 Ga0395905_0020946_2904_3422 157
51 3300038443 Ga0395901_0221680 Ga0395901_0221680_191_709 157
52 3300003322 rootL2_10140922 rootL2_101409223 158
53 3300038443 Ga0395901_1093706 Ga0395901_1093706_265_741 158
54 3300054114 Ga0501084_0043353 Ga0501084_0043353_2727_3257 158
55 3300037418 Ga0395900_0541902 Ga0395900_0541902_18_497 159
56 3300044694 Ga0466963_0397939 Ga0466963_0397939_268_792 159
57 3300049572 Ga0501036_0233491 Ga0501036_0233491_318_848 159
58 3300049574 Ga0501038_0157412 Ga0501038_0157412_1071_1601 159
59 3300049576 Ga0501040_0156329 Ga0501040_0156329_841_1371 159
60 3300049580 Ga0501046_0165282 Ga0501046_0165282_1093_1623 159
61 3300049582 Ga0501048_0741926 Ga0501048_0741926_55_585 159
62 3300049584 Ga0501068_0242306 Ga0501068_0242306_73_591 159
63 3300049584 Ga0501068_0666312 Ga0501068_0666312_124_654 159
64 3300049587 Ga0501071_0147719 Ga0501071_0147719_992_1522 159
65 3300049589 Ga0501073_0136976 Ga0501073_0136976_209_739 159
66 3300049592 Ga0501076_0202664 Ga0501076_0202664_217_747 159
67 3300049741 Ga0501079_0257644 Ga0501079_0257644_253_783 159
68 3300049742 Ga0501080_0144857 Ga0501080_0144857_1578_2096 159
69 3300049742 Ga0501080_0371697 Ga0501080_0371697_542_1072 159
70 3300049743 Ga0501081_0013788 Ga0501081_0013788_4562_5092 159
71 3300049743 Ga0501081_0478351 Ga0501081_0478351_19_540 159
72 3300049744 Ga0501083_0295108 Ga0501083_0295108_226_756 159
73 3300049744 Ga0501083_0889235 Ga0501083_0889235_37_555 159
74 3300049822 Ga0501035_0296668 Ga0501035_0296668_233_763 159
75 3300049824 Ga0501045_0229743 Ga0501045_0229743_681_1211 159
76 3300060353 Ga0501082_0435211 Ga0501082_0435211_160_690 159
77 3300061734 Ga0530510_0150539 Ga0530510_0150539_52_582 159
78 3300014497 Ga0182008_10063572 Ga0182008_100635723 160
79 3300048915 Ga0496112_0073833 Ga0496112_0073833_744_1262 160
80 3300048916 Ga0496113_0005356 Ga0496113_0005356_7286_7804 160
81 3300049585 Ga0501069_0477271 Ga0501069_0477271_105_623 160
82 iso_pu_bacteria 2802428860 2802729202 160
83 iso_pu_bacteria 2937084907 2937088020 160
84 3300005530 Ga0070679_100183733 Ga0070679_1001837334 161
85 3300009545 Ga0105237_10022017 Ga0105237_100220179 161
86 3300026067 Ga0207678_11504055 Ga0207678_115040551 161
87 iso_pu_bacteria 2537561836 2538835250 161
88 iso_pu_bacteria 2643221562 2643828634 161
89 3300005336 Ga0070680_100610250 Ga0070680_1006102501 162
90 3300005341 Ga0070691_10022553 Ga0070691_100225532 162
91 3300005356 Ga0070674_100164696 Ga0070674_1001646962 162
92 3300005458 Ga0070681_10205308 Ga0070681_102053083 162
93 3300005459 Ga0068867_100701819 Ga0068867_1007018191 162
94 3300005530 Ga0070679_100033166 Ga0070679_1000331663 162
95 3300005530 Ga0070679_101001674 Ga0070679_1010016741 162
96 3300005539 Ga0068853_100565353 Ga0068853_1005653531 162
97 3300005563 Ga0068855_100020775 Ga0068855_1000207753 162
98 3300005577 Ga0068857_100132383 Ga0068857_1001323833 162
99 3300005578 Ga0068854_101020649 Ga0068854_1010206491 162
100 3300005614 Ga0068856_100481780 Ga0068856_1004817802 162
101 3300009174 Ga0105241_10031812 Ga0105241_100318125 162
102 3300009545 Ga0105237_10053885 Ga0105237_100538852 162
103 3300009551 Ga0105238_10018641 Ga0105238_100186416 162
104 3300022467 Ga0224712_10202662 Ga0224712_102026622 162
105 3300025913 Ga0207695_10694553 Ga0207695_106945531 162
106 3300025914 Ga0207671_10042657 Ga0207671_100426572 162
107 3300025919 Ga0207657_10245497 Ga0207657_102454972 162
108 3300025921 Ga0207652_10250779 Ga0207652_102507792 162
109 3300025921 Ga0207652_10271393 Ga0207652_102713933 162
110 3300025924 Ga0207694_10036468 Ga0207694_100364684 162
111 3300025932 Ga0207690_10318236 Ga0207690_103182361 162
112 3300025949 Ga0207667_10107753 Ga0207667_101077532 162
113 3300025981 Ga0207640_10753343 Ga0207640_107533432 162
114 3300026041 Ga0207639_10490442 Ga0207639_104904421 162
115 3300026041 Ga0207639_10617377 Ga0207639_106173772 162
116 3300026089 Ga0207648_10846639 Ga0207648_108466391 162
117 3300026116 Ga0207674_10029247 Ga0207674_100292476 162
118 3300049568 Ga0501031_0001336 Ga0501031_0001336_923_1438 162
119 3300049569 Ga0501032_0020202 Ga0501032_0020202_3582_4097 162
120 3300049570 Ga0501033_0018318 Ga0501033_0018318_2226_2741 162
121 3300049571 Ga0501034_0005588 Ga0501034_0005588_7100_7615 162
122 3300049572 Ga0501036_0000276 Ga0501036_0000276_3732_4247 162
123 3300049573 Ga0501037_0024396 Ga0501037_0024396_1622_2137 162
124 3300049574 Ga0501038_0005966 Ga0501038_0005966_2267_2782 162
125 3300049575 Ga0501039_0003423 Ga0501039_0003423_5204_5719 162
126 3300049576 Ga0501040_0118656 Ga0501040_0118656_649_1164 162
127 3300049578 Ga0501042_0006948 Ga0501042_0006948_523_1038 162
128 3300049580 Ga0501046_0000594 Ga0501046_0000594_21040_21555 162
129 3300049581 Ga0501047_0011224 Ga0501047_0011224_6342_6857 162
130 3300049582 Ga0501048_0005654 Ga0501048_0005654_1445_1960 162
131 3300049583 Ga0501067_0015087 Ga0501067_0015087_826_1341 162
132 3300049584 Ga0501068_0009725 Ga0501068_0009725_2869_3384 162
133 3300049585 Ga0501069_0020664 Ga0501069_0020664_1463_1978 162
134 3300049586 Ga0501070_0009058 Ga0501070_0009058_3676_4191 162
135 3300049589 Ga0501073_0019754 Ga0501073_0019754_2209_2724 162
136 3300049590 Ga0501074_0003617 Ga0501074_0003617_6272_6787 162
137 3300049742 Ga0501080_0028666 Ga0501080_0028666_3046_3561 162
138 3300049822 Ga0501035_0039274 Ga0501035_0039274_723_1238 162
139 3300049823 Ga0501044_0140930 Ga0501044_0140930_723_1238 162
140 3300054114 Ga0501084_0008770 Ga0501084_0008770_5887_6402 162
141 3300060353 Ga0501082_0005751 Ga0501082_0005751_1664_2179 162
142 3300005539 Ga0068853_100553902 Ga0068853_1005539021 163
143 3300022467 Ga0224712_10087850 Ga0224712_100878501 163
144 3300031249 Ga0265339_10205236 Ga0265339_102052361 163
145 3300037312 Ga0395899_0424800 Ga0395899_0424800_98_619 163
146 3300037418 Ga0395900_0615618 Ga0395900_0615618_208_729 163
147 3300038443 Ga0395901_0062038 Ga0395901_0062038_1112_1633 163
148 3300038443 Ga0395901_0299731 Ga0395901_0299731_1109_1633 163
149 3300049581 Ga0501047_0379297 Ga0501047_0379297_16_540 163
150 3300049583 Ga0501067_0301224 Ga0501067_0301224_322_846 163
151 3300049589 Ga0501073_0116030 Ga0501073_0116030_1113_1637 163
152 3300060353 Ga0501082_0839164 Ga0501082_0839164_110_634 163
153 3300005336 Ga0070680_100344015 Ga0070680_1003440153 164
154 3300005339 Ga0070660_100366069 Ga0070660_1003660692 164
155 3300005341 Ga0070691_10166871 Ga0070691_101668712 164
156 3300005344 Ga0070661_100397722 Ga0070661_1003977221 164
157 3300005347 Ga0070668_100000306 Ga0070668_10000030637 164
158 3300005455 Ga0070663_101285325 Ga0070663_1012853251 164
159 3300005458 Ga0070681_10909404 Ga0070681_109094041 164
160 3300005545 Ga0070695_100781240 Ga0070695_1007812401 164
161 3300005563 Ga0068855_100065217 Ga0068855_1000652174 164
162 3300005578 Ga0068854_100978176 Ga0068854_1009781761 164
163 3300005616 Ga0068852_100282885 Ga0068852_1002828851 164
164 3300005618 Ga0068864_100535729 Ga0068864_1005357292 164
165 3300005719 Ga0068861_101123357 Ga0068861_1011233572 164
166 3300005841 Ga0068863_100708068 Ga0068863_1007080682 164
167 3300005844 Ga0068862_100000858 Ga0068862_10000085829 164
168 3300006175 Ga0070712_100082658 Ga0070712_1000826584 164
169 3300009177 Ga0105248_10011263 Ga0105248_100112634 164
170 3300010375 Ga0105239_10054106 Ga0105239_100541066 164
171 3300013104 Ga0157370_11271871 Ga0157370_112718711 164
172 3300013105 Ga0157369_11039067 Ga0157369_110390671 164
173 3300013306 Ga0163162_10710636 Ga0163162_107106361 164
174 3300014968 Ga0157379_11347671 Ga0157379_113476711 164
175 3300020070 Ga0206356_10071297 Ga0206356_100712971 164
176 3300022467 Ga0224712_10310861 Ga0224712_103108611 164
177 3300025899 Ga0207642_10209710 Ga0207642_102097102 164
178 3300025909 Ga0207705_10025993 Ga0207705_100259932 164
179 3300025912 Ga0207707_10212129 Ga0207707_102121291 164
180 3300025917 Ga0207660_10323915 Ga0207660_103239151 164
181 3300025921 Ga0207652_11255084 Ga0207652_112550841 164
182 3300025941 Ga0207711_10076378 Ga0207711_100763783 164
183 3300025972 Ga0207668_10011298 Ga0207668_100112987 164
184 3300026118 Ga0207675_101192209 Ga0207675_1011922091 164
185 3300028380 Ga0268265_10000744 Ga0268265_1000074413 164
186 3300031595 Ga0265313_10010775 Ga0265313_100107758 164
187 3300031711 Ga0265314_10224854 Ga0265314_102248541 164
188 3300031712 Ga0265342_10001944 Ga0265342_1000194415 164
189 3300031852 Ga0307410_10667804 Ga0307410_106678042 164
190 3300031903 Ga0307407_10768487 Ga0307407_107684871 164
191 3300032002 Ga0307416_100429655 Ga0307416_1004296552 164
192 3300037068 Ga0373925_0681926 Ga0373925_0681926_14_535 164
193 3300044684 Ga0466966_0148142 Ga0466966_0148142_35_556 164
194 3300044694 Ga0466963_0124080 Ga0466963_0124080_202_723 164
195 3300044842 Ga0466957_0021609 Ga0466957_0021609_1066_1587 164
196 3300045051 Ga0451576_0024877 Ga0451576_0024877_5699_6220 164
197 3300045836 Ga0466958_0009376 Ga0466958_0009376_1093_1614 164
198 3300045976 Ga0466967_1662432 Ga0466967_1662432_48_596 164
199 3300046516 Ga0495628_0402900 Ga0495628_0402900_153_674 164
200 3300048905 Ga0496102_0091319 Ga0496102_0091319_1782_2321 164
201 3300048909 Ga0496106_0390204 Ga0496106_0390204_499_1038 164
202 3300048917 Ga0496114_0185558 Ga0496114_0185558_857_1378 164
203 3300049568 Ga0501031_0008194 Ga0501031_0008194_4727_5248 164
204 3300049568 Ga0501031_0183757 Ga0501031_0183757_808_1329 164
205 3300049569 Ga0501032_0004015 Ga0501032_0004015_6475_6996 164
206 3300049569 Ga0501032_0236688 Ga0501032_0236688_629_1150 164
207 3300049569 Ga0501032_0392693 Ga0501032_0392693_43_564 164
208 3300049570 Ga0501033_0000866 Ga0501033_0000866_6202_6723 164
209 3300049570 Ga0501033_0064915 Ga0501033_0064915_16_537 164
210 3300049571 Ga0501034_0046005 Ga0501034_0046005_1097_1618 164
211 3300049571 Ga0501034_0247761 Ga0501034_0247761_551_1111 164
212 3300049571 Ga0501034_0278744 Ga0501034_0278744_483_1004 164
213 3300049572 Ga0501036_0059594 Ga0501036_0059594_2429_2950 164
214 3300049572 Ga0501036_0143846 Ga0501036_0143846_855_1376 164
215 3300049572 Ga0501036_0334170 Ga0501036_0334170_580_1101 164
216 3300049572 Ga0501036_1176056 Ga0501036_1176056_73_594 164
217 3300049573 Ga0501037_0000958 Ga0501037_0000958_12044_12565 164
218 3300049573 Ga0501037_0118942 Ga0501037_0118942_572_1093 164
219 3300049574 Ga0501038_0051121 Ga0501038_0051121_548_1069 164
220 3300049574 Ga0501038_0121563 Ga0501038_0121563_373_894 164
221 3300049575 Ga0501039_0005815 Ga0501039_0005815_4650_5171 164
222 3300049575 Ga0501039_0179014 Ga0501039_0179014_572_1093 164
223 3300049576 Ga0501040_0137307 Ga0501040_0137307_625_1146 164
224 3300049577 Ga0501041_0095285 Ga0501041_0095285_899_1420 164
225 3300049578 Ga0501042_0020819 Ga0501042_0020819_1189_1710 164
226 3300049578 Ga0501042_0173132 Ga0501042_0173132_946_1467 164
227 3300049579 Ga0501043_0008033 Ga0501043_0008033_6851_7372 164
228 3300049579 Ga0501043_0029042 Ga0501043_0029042_678_1199 164
229 3300049579 Ga0501043_0107633 Ga0501043_0107633_572_1093 164
230 3300049580 Ga0501046_0091519 Ga0501046_0091519_843_1364 164
231 3300049580 Ga0501046_0214245 Ga0501046_0214245_700_1221 164
232 3300049581 Ga0501047_0055676 Ga0501047_0055676_346_864 164
233 3300049581 Ga0501047_0080112 Ga0501047_0080112_2346_2867 164
234 3300049581 Ga0501047_0169653 Ga0501047_0169653_959_1480 164
235 3300049581 Ga0501047_0224956 Ga0501047_0224956_321_842 164
236 3300049581 Ga0501047_0238990 Ga0501047_0238990_575_1096 164
237 3300049581 Ga0501047_0488288 Ga0501047_0488288_268_792 164
238 3300049581 Ga0501047_0533656 Ga0501047_0533656_393_914 164
239 3300049582 Ga0501048_0075385 Ga0501048_0075385_1024_1545 164
240 3300049583 Ga0501067_0010940 Ga0501067_0010940_1124_1645 164
241 3300049583 Ga0501067_0137442 Ga0501067_0137442_654_1175 164
242 3300049584 Ga0501068_0088800 Ga0501068_0088800_345_866 164
243 3300049584 Ga0501068_0118527 Ga0501068_0118527_1114_1635 164
244 3300049584 Ga0501068_0183573 Ga0501068_0183573_18_539 164
245 3300049585 Ga0501069_0112769 Ga0501069_0112769_418_939 164
246 3300049586 Ga0501070_0114633 Ga0501070_0114633_1360_1881 164
247 3300049586 Ga0501070_0315313 Ga0501070_0315313_616_1137 164
248 3300049588 Ga0501072_0100219 Ga0501072_0100219_35_556 164
249 3300049589 Ga0501073_0089596 Ga0501073_0089596_907_1428 164
250 3300049589 Ga0501073_0336774 Ga0501073_0336774_484_1005 164
251 3300049590 Ga0501074_0067146 Ga0501074_0067146_395_916 164
252 3300049590 Ga0501074_0117282 Ga0501074_0117282_575_1096 164
253 3300049592 Ga0501076_0331716 Ga0501076_0331716_714_1235 164
254 3300049741 Ga0501079_0160439 Ga0501079_0160439_14_535 164
255 3300049741 Ga0501079_0469734 Ga0501079_0469734_258_779 164
256 3300049742 Ga0501080_0065291 Ga0501080_0065291_245_766 164
257 3300049742 Ga0501080_0784411 Ga0501080_0784411_144_665 164
258 3300049744 Ga0501083_0166045 Ga0501083_0166045_88_609 164
259 3300049744 Ga0501083_0258729 Ga0501083_0258729_575_1096 164
260 3300049822 Ga0501035_0003778 Ga0501035_0003778_7178_7699 164
261 3300049822 Ga0501035_0437050 Ga0501035_0437050_474_995 164
262 3300049822 Ga0501035_0628657 Ga0501035_0628657_339_860 164
263 3300049823 Ga0501044_0006712 Ga0501044_0006712_815_1336 164
264 3300049823 Ga0501044_0053440 Ga0501044_0053440_807_1328 164
265 3300049823 Ga0501044_0211718 Ga0501044_0211718_392_913 164
266 3300049823 Ga0501044_0229484 Ga0501044_0229484_346_867 164
267 3300049824 Ga0501045_0134196 Ga0501045_0134196_1283_1804 164
268 3300053085 Ga0495619_0228542 Ga0495619_0228542_624_1145 164
269 3300053123 Ga0500614_063693 Ga0500614_063693_417_941 164
270 3300053178 Ga0500637_0124109 Ga0500637_0124109_621_1145 164
271 3300054114 Ga0501084_0032214 Ga0501084_0032214_357_878 164
272 3300059490 Ga0587066_135805 Ga0587066_135805_33_569 164
273 3300059604 Ga0587098_030909 Ga0587098_030909_75_599 164
274 3300060353 Ga0501082_0194442 Ga0501082_0194442_1037_1558 164
275 3300061734 Ga0530510_0994401 Ga0530510_0994401_25_546 164
276 3300002067 JGI24735J21928_10036645 JGI24735J21928_100366453 165
277 3300002737 JGI25162J39368_1005538 JGI25162J39368_10055383 165
278 3300002772 JGI25164J39214_1002836 JGI25164J39214_10028361 165
279 3300003214 JGI25165J46597_1001813 JGI25165J46597_10018133 165
280 3300004803 Ga0058862_12566575 Ga0058862_125665751 165
281 3300005327 Ga0070658_10045139 Ga0070658_100451393 165
282 3300005329 Ga0070683_100029813 Ga0070683_1000298132 165
283 3300005336 Ga0070680_100098394 Ga0070680_1000983943 165
284 3300005337 Ga0070682_100094560 Ga0070682_1000945602 165
285 3300005341 Ga0070691_10003062 Ga0070691_1000306210 165
286 3300005344 Ga0070661_100034152 Ga0070661_1000341523 165
287 3300005356 Ga0070674_100356879 Ga0070674_1003568791 165
288 3300005366 Ga0070659_100031769 Ga0070659_1000317693 165
289 3300005366 Ga0070659_101408006 Ga0070659_1014080061 165
290 3300005455 Ga0070663_100007814 Ga0070663_1000078145 165
291 3300005455 Ga0070663_100073794 Ga0070663_1000737945 165
292 3300005457 Ga0070662_100063945 Ga0070662_1000639453 165
293 3300005457 Ga0070662_101397842 Ga0070662_1013978421 165
294 3300005530 Ga0070679_100141680 Ga0070679_1001416802 165
295 3300005535 Ga0070684_100001830 Ga0070684_1000018307 165
296 3300005539 Ga0068853_100004017 Ga0068853_10000401713 165
297 3300005546 Ga0070696_100404817 Ga0070696_1004048173 165
298 3300005547 Ga0070693_100161255 Ga0070693_1001612552 165
299 3300005563 Ga0068855_100180150 Ga0068855_1001801503 165
300 3300005564 Ga0070664_100003170 Ga0070664_10000317010 165
301 3300005577 Ga0068857_100022379 Ga0068857_1000223795 165
302 3300005578 Ga0068854_100001146 Ga0068854_10000114612 165
303 3300005614 Ga0068856_100185796 Ga0068856_1001857963 165
304 3300005616 Ga0068852_100036896 Ga0068852_1000368963 165
305 3300005834 Ga0068851_10066505 Ga0068851_100665053 165
306 3300006175 Ga0070712_100478651 Ga0070712_1004786512 165
307 3300009093 Ga0105240_10006152 Ga0105240_1000615213 165
308 3300009174 Ga0105241_11849595 Ga0105241_118495951 165
309 3300009176 Ga0105242_10867885 Ga0105242_108678852 165
310 3300009551 Ga0105238_10004239 Ga0105238_1000423914 165
311 3300009553 Ga0105249_11521909 Ga0105249_115219091 165
312 3300010375 Ga0105239_10784695 Ga0105239_107846952 165
313 3300011119 Ga0105246_10278564 Ga0105246_102785642 165
314 3300013100 Ga0157373_10010908 Ga0157373_100109082 165
315 3300013100 Ga0157373_10370513 Ga0157373_103705131 165
316 3300013102 Ga0157371_10292607 Ga0157371_102926072 165
317 3300013102 Ga0157371_10613312 Ga0157371_106133122 165
318 3300013104 Ga0157370_10009252 Ga0157370_100092529 165
319 3300013105 Ga0157369_10114879 Ga0157369_101148793 165
320 3300013307 Ga0157372_10026860 Ga0157372_100268603 165
321 3300013307 Ga0157372_10659261 Ga0157372_106592613 165
322 3300013307 Ga0157372_11238278 Ga0157372_112382781 165
323 3300020069 Ga0197907_11220975 Ga0197907_112209751 165
324 3300020080 Ga0206350_10535322 Ga0206350_105353221 165
325 3300020081 Ga0206354_11686731 Ga0206354_116867312 165
326 3300022467 Ga0224712_10119128 Ga0224712_101191283 165
327 3300025231 Ga0207427_100322 Ga0207427_10032225 165
328 3300025233 Ga0209437_100118 Ga0209437_10011878 165
329 3300025261 Ga0209233_1000046 Ga0209233_1000046216 165
330 3300025321 Ga0207656_10007269 Ga0207656_100072693 165
331 3300025904 Ga0207647_10002290 Ga0207647_100022905 165
332 3300025909 Ga0207705_10003398 Ga0207705_100033984 165
333 3300025911 Ga0207654_10110228 Ga0207654_101102284 165
334 3300025913 Ga0207695_10014439 Ga0207695_100144394 165
335 3300025914 Ga0207671_10460833 Ga0207671_104608332 165
336 3300025917 Ga0207660_10068517 Ga0207660_100685173 165
337 3300025919 Ga0207657_10007729 Ga0207657_100077294 165
338 3300025920 Ga0207649_10003373 Ga0207649_100033733 165
339 3300025924 Ga0207694_10073033 Ga0207694_100730333 165
340 3300025929 Ga0207664_10027244 Ga0207664_100272445 165
341 3300025932 Ga0207690_10002554 Ga0207690_100025545 165
342 3300025935 Ga0207709_10682670 Ga0207709_106826702 165
343 3300025937 Ga0207669_10314920 Ga0207669_103149203 165
344 3300025944 Ga0207661_10002656 Ga0207661_100026566 165
345 3300025945 Ga0207679_10004108 Ga0207679_1000410810 165
346 3300025949 Ga0207667_10114757 Ga0207667_101147572 165
347 3300025981 Ga0207640_10018863 Ga0207640_100188633 165
348 3300026035 Ga0207703_11061623 Ga0207703_110616231 165
349 3300026041 Ga0207639_10014469 Ga0207639_100144693 165
350 3300026041 Ga0207639_10404564 Ga0207639_104045643 165
351 3300026067 Ga0207678_10019294 Ga0207678_100192946 165
352 3300026067 Ga0207678_10028356 Ga0207678_100283568 165
353 3300026078 Ga0207702_10004728 Ga0207702_100047285 165
354 3300026116 Ga0207674_10002263 Ga0207674_1000226336 165
355 3300026142 Ga0207698_10002762 Ga0207698_1000276210 165
356 3300035121 Ga0373960_0030176 Ga0373960_0030176_486_1013 165
357 3300035207 Ga0373942_0059202 Ga0373942_0059202_209_736 165
358 3300037312 Ga0395899_0026185 Ga0395899_0026185_913_1434 165
359 3300037418 Ga0395900_0002554 Ga0395900_0002554_16503_17021 165
360 3300037466 Ga0395898_0166002 Ga0395898_0166002_1084_1605 165
361 3300037471 Ga0395905_0036681 Ga0395905_0036681_2778_3299 165
362 3300038443 Ga0395901_0000203 Ga0395901_0000203_24889_25407 165
363 3300038443 Ga0395901_0149437 Ga0395901_0149437_976_1539 165
364 3300042533 Ga0450901_010394 Ga0450901_010394_327_872 165
365 3300045976 Ga0466967_0552085 Ga0466967_0552085_59_577 165
366 3300048903 Ga0496100_0018511 Ga0496100_0018511_2940_3467 165
367 3300048904 Ga0496101_0037389 Ga0496101_0037389_1446_1973 165
368 3300048905 Ga0496102_0100241 Ga0496102_0100241_1146_1673 165
369 3300048909 Ga0496106_0022006 Ga0496106_0022006_2590_3117 165
370 3300049568 Ga0501031_0082464 Ga0501031_0082464_1229_1753 165
371 3300049569 Ga0501032_0218460 Ga0501032_0218460_531_1055 165
372 3300049570 Ga0501033_0284271 Ga0501033_0284271_524_1048 165
373 3300049572 Ga0501036_0047767 Ga0501036_0047767_761_1285 165
374 3300049576 Ga0501040_0082324 Ga0501040_0082324_860_1384 165
375 3300049578 Ga0501042_0168925 Ga0501042_0168925_380_904 165
376 3300049582 Ga0501048_0531575 Ga0501048_0531575_42_566 165
377 3300049584 Ga0501068_0107951 Ga0501068_0107951_1061_1585 165
378 3300049585 Ga0501069_0276538 Ga0501069_0276538_44_568 165
379 3300049586 Ga0501070_0700289 Ga0501070_0700289_201_725 165
380 3300049588 Ga0501072_0156271 Ga0501072_0156271_753_1277 165
381 3300049592 Ga0501076_0386978 Ga0501076_0386978_519_1043 165
382 3300049593 Ga0501077_0190906 Ga0501077_0190906_173_697 165
383 3300049742 Ga0501080_0084131 Ga0501080_0084131_586_1110 165
384 3300049742 Ga0501080_0119917 Ga0501080_0119917_744_1271 165
385 3300049743 Ga0501081_0654613 Ga0501081_0654613_137_661 165
386 3300049822 Ga0501035_0219204 Ga0501035_0219204_727_1251 165
387 3300049823 Ga0501044_0421448 Ga0501044_0421448_173_697 165
388 3300054114 Ga0501084_0314990 Ga0501084_0314990_782_1306 165
389 3300061734 Ga0530510_0129976 Ga0530510_0129976_1103_1627 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13628

DUF4142

Domain of unknown function (DUF4142)

26

166

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6c-assembly1.cif.gz_A crystal structure of protein ne0167 from nitrosomonas europaea 0.8913 100 163
7vzg-assembly1.cif.gz_D structure of the acidobacteria homodimeric reaction center bound with cytochrome c (the larger form) 0.8782 109 165
5ffe-assembly1.cif.gz_A copm in the ag-bound form (by soaking) 0.8304 18 163
3bt5-assembly1.cif.gz_A crystal structure of duf305 fragment from deinococcus radiodurans 0.8282 17 163
3hiu-assembly1.cif.gz_A the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8236 21 164
ID Description Score Start End Superfamily
af_Q9CA10_47_189_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9342 102 164 1.20.140.40
3fseA02 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8756 21 163 1.20.1260.10
5da5I00 Special;Helix non-globular;Helix Hairpins; 0.8694 99 165 6.10.140.1960
af_Q54XF9_6_149_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8179 23 162 1.20.1260.10
3bt5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8157 18 163 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A529MCR8-F1-model_v4 DUF4142 domain-containing protein 1 27 165
AF-A0A2N8MDQ7-F1-model_v4 DUF4142 domain-containing protein 0.9957 17 165
AF-A0A7X7PH18-F1-model_v4 DUF4142 domain-containing protein 0.995 41 164
AF-A0A1E5A0R0-F1-model_v4 DUF4142 domain-containing protein 0.9941 18 164
AF-A0A5N1IS72-F1-model_v4 DUF4142 domain-containing protein 0.9936 16 164

Feature Viewer

pLDDT pTM Quality
91.29 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map