F431250

General Info

Members Datasets Scaffolds Average Seq Length
388 220 776 112

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0613113|Ga0501038_0613113_302_688
Length 128
Sequence VSAEGGALPASGRVARLAAIGLLAGLFSALFGVGGGIIMVPLLIWLLGYDAKVATATSLAAIIFTATFGTATHGALGNVDWTTALLIGIPAMVGVNIGLAVKARISSRALTYAFAVLLVAVAIRLAVG

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.18
Rhizosphere 85.31
Stem 0
Stem Tuber 0
Unclassified 12.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0613113 3300049574 Bacteria 822
2 Ga0070683_100001446 3300005329 Bacteria 18256
3 Ga0070683_101324753 3300005329 Unclassified 692
4 Ga0070690_100404604 3300005330 Bacteria 1003
5 Ga0070682_100015452 3300005337 Bacteria 4424
6 Ga0070682_101585369 3300005337 Bacteria 565
7 Ga0070682_101724153 3300005337 Unclassified 545
8 Ga0068868_100117992 3300005338 Bacteria 2162
9 Ga0070660_101702126 3300005339 Bacteria 537
10 Ga0070691_10309803 3300005341 Bacteria 865
11 Ga0070675_100080871 3300005354 Bacteria 2709
12 Ga0070671_100324662 3300005355 Bacteria 1312
13 Ga0070671_101004810 3300005355 Bacteria 731
14 Ga0070674_100641043 3300005356 Bacteria 902
15 Ga0070674_100702076 3300005356 Bacteria 865
16 Ga0070659_100508296 3300005366 Bacteria 1028
17 Ga0070659_101951326 3300005366 Unclassified 527
18 Ga0070667_101505087 3300005367 Bacteria 632
19 Ga0070714_100024674 3300005435 Bacteria 4955
20 Ga0070713_100405450 3300005436 Bacteria 1274
21 Ga0070701_10878785 3300005438 Bacteria 617
22 Ga0070711_100277283 3300005439 Bacteria 1325
23 Ga0070663_100257864 3300005455 Bacteria 1382
24 Ga0070663_100278935 3300005455 Bacteria 1331
25 Ga0070678_100058015 3300005456 Bacteria 2839
26 Ga0070662_100049154 3300005457 Bacteria 3041
27 Ga0070681_10008442 3300005458 Bacteria 10083
28 Ga0068867_100565358 3300005459 Bacteria 987
29 Ga0068867_100571357 3300005459 Bacteria 982
30 Ga0070706_100157724 3300005467 Bacteria 2118
31 Ga0070706_100175388 3300005467 Bacteria 2002
32 Ga0070707_100365438 3300005468 Bacteria 1402
33 Ga0070698_100037141 3300005471 Bacteria 5024
34 Ga0070698_100164515 3300005471 Bacteria 2161
35 Ga0070698_100318600 3300005471 Bacteria 1485
36 Ga0070698_100341617 3300005471 Bacteria 1428
37 Ga0070699_100026291 3300005518 Bacteria 5020
38 Ga0070699_100037161 3300005518 Bacteria 4214
39 Ga0070699_100872216 3300005518 Bacteria 824
40 Ga0070679_100041753 3300005530 Bacteria 4565
41 Ga0070684_100012357 3300005535 Bacteria 6840
42 Ga0070684_101179432 3300005535 Bacteria 720
43 Ga0070684_101622599 3300005535 Bacteria 610
44 Ga0068853_101971951 3300005539 Bacteria 566
45 Ga0070672_100795332 3300005543 Bacteria 832
46 Ga0070686_101034596 3300005544 Bacteria 675
47 Ga0070695_101896329 3300005545 Bacteria 501
48 Ga0070696_100090565 3300005546 Bacteria 2177
49 Ga0070696_100500021 3300005546 Unclassified 967
50 Ga0070693_100032063 3300005547 Bacteria 2886
51 Ga0070693_100526665 3300005547 Archaea 842
52 Ga0070693_101675101 3300005547 Unclassified 501
53 Ga0070665_100187390 3300005548 Bacteria 2070
54 Ga0070665_100688920 3300005548 Bacteria 1035
55 Ga0070704_100244240 3300005549 Bacteria 1471
56 Ga0068855_101562810 3300005563 Bacteria 676
57 Ga0068855_101623724 3300005563 Bacteria 661
58 Ga0070664_100660876 3300005564 Bacteria 972
59 Ga0070664_101491352 3300005564 Bacteria 640
60 Ga0070664_101886167 3300005564 Bacteria 567
61 Ga0068857_100471083 3300005577 Bacteria 1176
62 Ga0068854_100309396 3300005578 Unclassified 1281
63 Ga0068854_100414979 3300005578 Bacteria 1117
64 Ga0068856_100500934 3300005614 Bacteria 1235
65 Ga0068856_100724215 3300005614 Bacteria 1015
66 Ga0068859_101810855 3300005617 Bacteria 674
67 Ga0068864_101474432 3300005618 Bacteria 683
68 Ga0068864_101635794 3300005618 Bacteria 648
69 Ga0068866_10196119 3300005718 Bacteria 1203
70 Ga0068866_10251872 3300005718 Bacteria 1081
71 Ga0068870_10167653 3300005840 Bacteria 1308
72 Ga0081455_10031570 3300005937 Bacteria 4790
73 Ga0081455_10046765 3300005937 Bacteria 3751
74 Ga0081455_10330417 3300005937 Bacteria 1082
75 Ga0081455_10560413 3300005937 Bacteria 753
76 Ga0081455_10585592 3300005937 Bacteria 730
77 Ga0081540_1011397 3300005983 Bacteria 5944
78 Ga0081540_1027675 3300005983 Bacteria 3205
79 Ga0070712_101861793 3300006175 Bacteria 527
80 Ga0068871_100367986 3300006358 Bacteria 1274
81 Ga0075428_102429920 3300006844 Bacteria 538
82 Ga0075431_100401485 3300006847 Bacteria 1372
83 Ga0075433_10650782 3300006852 Bacteria 924
84 Ga0075433_11478521 3300006852 Bacteria 587
85 Ga0075434_100142839 3300006871 Bacteria 2414
86 Ga0075434_100433121 3300006871 Bacteria 1336
87 Ga0075429_100113492 3300006880 Bacteria 2368
88 Ga0068865_100568981 3300006881 Unclassified 954
89 Ga0097620_101810041 3300006931 Bacteria 674
90 Ga0105240_10099400 3300009093 Unclassified 3541
91 Ga0111539_10145734 3300009094 Unclassified 2772
92 Ga0105245_10003423 3300009098 Bacteria 14211
93 Ga0105245_10109363 3300009098 Bacteria 2568
94 Ga0105245_10283137 3300009098 Bacteria 1621
95 Ga0105245_10383715 3300009098 Bacteria 1400
96 Ga0105245_10875456 3300009098 Bacteria 939
97 Ga0105245_10912827 3300009098 Bacteria 920
98 Ga0105245_10915045 3300009098 Bacteria 919
99 Ga0105245_13024790 3300009098 Bacteria 521
100 Ga0105243_10193884 3300009148 Bacteria 1777
101 Ga0105243_11789528 3300009148 Bacteria 645
102 Ga0105241_12509678 3300009174 Bacteria 516
103 Ga0105242_10050507 3300009176 Bacteria 3386
104 Ga0105239_10157729 3300010375 Bacteria 2535
105 Ga0105239_13014323 3300010375 Bacteria 549
106 Ga0105246_10116736 3300011119 Bacteria 1970
107 Ga0105246_11938146 3300011119 Archaea 567
108 Ga0105246_11969806 3300011119 Unclassified 563
109 Ga0157374_10147999 3300013296 Bacteria 2282
110 Ga0157378_10128065 3300013297 Bacteria 2347
111 Ga0163162_11210419 3300013306 Bacteria 857
112 Ga0157375_10111555 3300013308 Bacteria 2834
113 Ga0157375_10529553 3300013308 Bacteria 1341
114 Ga0157375_13043402 3300013308 Unclassified 560
115 Ga0163163_11386666 3300014325 Bacteria 765
116 Ga0157380_10208346 3300014326 Bacteria 1740
117 Ga0157379_10759688 3300014968 Unclassified 913
118 Ga0157376_10334342 3300014969 Bacteria 1444
119 Ga0157376_10367936 3300014969 Bacteria 1381
120 Ga0163161_11862317 3300017792 Bacteria 535
121 Ga0207642_10112543 3300025899 Bacteria 1389
122 Ga0207688_10265624 3300025901 Bacteria 1043
123 Ga0207699_10368858 3300025906 Bacteria 1017
124 Ga0207643_10114813 3300025908 Bacteria 1589
125 Ga0207684_10240567 3300025910 Bacteria 1561
126 Ga0207695_10120036 3300025913 Bacteria 2598
127 Ga0207693_11362759 3300025915 Bacteria 528
128 Ga0207663_10750551 3300025916 Bacteria 775
129 Ga0207660_10092057 3300025917 Bacteria 2250
130 Ga0207662_10133330 3300025918 Bacteria 1568
131 Ga0207649_10105659 3300025920 Bacteria 1872
132 Ga0207652_10060312 3300025921 Bacteria 3273
133 Ga0207652_10460154 3300025921 Unclassified 1147
134 Ga0207659_10096258 3300025926 Bacteria 2222
135 Ga0207687_10033967 3300025927 Bacteria 3462
136 Ga0207687_10036873 3300025927 Bacteria 3332
137 Ga0207687_10131704 3300025927 Bacteria 1886
138 Ga0207687_10361811 3300025927 Bacteria 1184
139 Ga0207687_11123256 3300025927 Bacteria 675
140 Ga0207687_11904056 3300025927 Bacteria 508
141 Ga0207664_10022812 3300025929 Bacteria 4681
142 Ga0207644_10229433 3300025931 Bacteria 1475
143 Ga0207644_10536402 3300025931 Bacteria 968
144 Ga0207644_10848455 3300025931 Bacteria 765
145 Ga0207706_10211393 3300025933 Unclassified 1700
146 Ga0207686_10057863 3300025934 Unclassified 2442
147 Ga0207709_10900500 3300025935 Bacteria 719
148 Ga0207709_10942463 3300025935 Bacteria 703
149 Ga0207669_10292652 3300025937 Bacteria 1234
150 Ga0207669_10567735 3300025937 Unclassified 918
151 Ga0207691_10879667 3300025940 Archaea 750
152 Ga0207661_10003413 3300025944 Bacteria 11027
153 Ga0207661_10260449 3300025944 Bacteria 1545
154 Ga0207661_10846575 3300025944 Unclassified 842
155 Ga0207679_10288766 3300025945 Bacteria 1409
156 Ga0207651_11144703 3300025960 Unclassified 698
157 Ga0207651_11860671 3300025960 Bacteria 541
158 Ga0207668_10710320 3300025972 Bacteria 884
159 Ga0207668_11527193 3300025972 Bacteria 603
160 Ga0207640_10157125 3300025981 Bacteria 1678
161 Ga0207658_10801927 3300025986 Unclassified 855
162 Ga0207677_10110677 3300026023 Bacteria 2045
163 Ga0207678_10271334 3300026067 Bacteria 1455
164 Ga0207678_10860623 3300026067 Unclassified 801
165 Ga0207708_11169264 3300026075 Bacteria 672
166 Ga0207702_10006553 3300026078 Bacteria 10017
167 Ga0207702_10593016 3300026078 Bacteria 1087
168 Ga0207648_10070398 3300026089 Bacteria 3049
169 Ga0207648_10289610 3300026089 Bacteria 1466
170 Ga0207648_11167642 3300026089 Bacteria 723
171 Ga0207648_11358356 3300026089 Unclassified 668
172 Ga0207674_10390037 3300026116 Bacteria 1346
173 Ga0207675_101036083 3300026118 Unclassified 839
174 Ga0207675_101691823 3300026118 Unclassified 653
175 Ga0207683_10015019 3300026121 Bacteria 6590
176 Ga0268266_11000674 3300028379 Bacteria 809
177 Ga0265320_10006755 3300031240 Bacteria 7199
178 Ga0307408_100360430 3300031548 Bacteria 1237
179 Ga0307408_100815828 3300031548 Bacteria 848
180 Ga0307407_11401432 3300031903 Bacteria 551
181 Ga0307412_11516085 3300031911 Bacteria 610
182 Ga0307409_100038058 3300031995 Bacteria 3554
183 Ga0307409_100596557 3300031995 Bacteria 1091
184 Ga0307411_11227503 3300032005 Bacteria 681
185 Ga0307415_100089295 3300032126 Bacteria 2226
186 Ga0373951_0174898 3300035091 Bacteria 614
187 Ga0373952_0148631 3300035092 Bacteria 656
188 Ga0373943_0034784 3300035170 Bacteria 2405
189 Ga0373935_0057293 3300035692 Bacteria 2486
190 Ga0373935_0955932 3300035692 Bacteria 636
191 Ga0373947_0029763 3300035725 Unclassified 3205
192 Ga0395899_0741864 3300037312 Unclassified 612
193 Ga0395898_0985432 3300037466 Bacteria 779
194 Ga0395898_1030396 3300037466 Unclassified 758
195 Ga0395901_0140128 3300038443 Bacteria 2542
196 Ga0395901_0164737 3300038443 Bacteria 2328
197 Ga0395901_0550864 3300038443 Unclassified 1169
198 Ga0436363_0977173 3300039450 Bacteria 538
199 Ga0439461_0133140 3300041410 Bacteria 630
200 Ga0439465_0329003 3300041413 Bacteria 575
201 Ga0451853_2226286 3300041512 Bacteria 837
202 Ga0439433_0087460 3300041999 Bacteria 763
203 Ga0439448_0037395 3300042005 Bacteria 1559
204 Ga0439455_0019229 3300042012 Bacteria 1609
205 Ga0439463_155425 3300042016 Bacteria 593
206 Ga0439446_0005415 3300042156 Bacteria 3283
207 Ga0439446_0165766 3300042156 Bacteria 733
208 Ga0439458_0029442 3300042157 Bacteria 1303
209 Ga0439434_0006817 3300042435 Bacteria 3338
210 Ga0439434_0184147 3300042435 Bacteria 700
211 Ga0439435_0252029 3300042436 Bacteria 595
212 Ga0439460_0040234 3300042461 Bacteria 1369
213 Ga0450918_009671 3300042531 Bacteria 1687
214 Ga0451576_0171276 3300045051 Bacteria 2266
215 Ga0451576_1313621 3300045051 Unclassified 754
216 Ga0466967_1114031 3300045976 Bacteria 787
217 Ga0495603_0320537 3300046455 Bacteria 890
218 Ga0495629_0075516 3300046459 Unclassified 2354
219 Ga0495641_0022803 3300046461 Unclassified 3125
220 Ga0495582_0183877 3300046473 Bacteria 1191
221 Ga0495605_0270561 3300046474 Bacteria 724
222 Ga0495584_0057441 3300046491 Bacteria 1958
223 Ga0495584_0097952 3300046491 Bacteria 1482
224 Ga0495594_0019914 3300046499 Unclassified 3570
225 Ga0495596_0033791 3300046500 Bacteria 2035
226 Ga0495596_0236025 3300046500 Bacteria 710
227 Ga0495620_0335292 3300046515 Unclassified 574
228 Ga0495630_0041085 3300046517 Bacteria 3454
229 Ga0495630_0314737 3300046517 Bacteria 1197
230 Ga0495644_0036577 3300046523 Bacteria 1852
231 Ga0495665_0422761 3300046531 Bacteria 675
232 Ga0495640_0590440 3300046533 Bacteria 671
233 Ga0495586_0029827 3300046535 Unclassified 2920
234 Ga0495598_0173306 3300046537 Bacteria 766
235 Ga0495609_0108835 3300046538 Bacteria 1197
236 Ga0495656_0255209 3300046615 Unclassified 887
237 Ga0495634_0178818 3300046642 Unclassified 1329
238 Ga0495634_0727833 3300046642 Bacteria 569
239 Ga0495647_0001825 3300046681 Bacteria 6589
240 Ga0495658_0518412 3300046683 Bacteria 763
241 Ga0495613_0413427 3300046689 Bacteria 919
242 Ga0495624_0273850 3300046690 Bacteria 1020
243 Ga0495670_0381238 3300046691 Bacteria 761
244 Ga0495674_0468106 3300047319 Bacteria 1011
245 Ga0495676_0056087 3300047321 Unclassified 3118
246 Ga0495680_0931197 3300047322 Bacteria 559
247 Ga0495615_0019854 3300048090 Bacteria 1498
248 Ga0496100_0016358 3300048903 Bacteria 4355
249 Ga0496101_0000511 3300048904 Bacteria 24342
250 Ga0496101_0119170 3300048904 Bacteria 1994
251 Ga0496101_0744859 3300048904 Bacteria 773
252 Ga0496101_1605435 3300048904 Bacteria 505
253 Ga0496102_0194247 3300048905 Bacteria 1913
254 Ga0496102_0291454 3300048905 Bacteria 1538
255 Ga0496102_1020250 3300048905 Bacteria 748
256 Ga0496103_0330593 3300048906 Bacteria 980
257 Ga0496104_0000085 3300048907 Bacteria 90352
258 Ga0496105_0002537 3300048908 Bacteria 13250
259 Ga0496105_0037651 3300048908 Bacteria 3983
260 Ga0496105_0298009 3300048908 Unclassified 1297
261 Ga0496106_0032090 3300048909 Bacteria 3915
262 Ga0496106_0119589 3300048909 Bacteria 2058
263 Ga0496106_0267337 3300048909 Unclassified 1369
264 Ga0496107_0120999 3300048910 Bacteria 1929
265 Ga0496107_0372570 3300048910 Unclassified 1062
266 Ga0496107_0428395 3300048910 Bacteria 984
267 Ga0496108_0002785 3300048911 Bacteria 14014
268 Ga0496108_0031507 3300048911 Bacteria 4400
269 Ga0496108_0079277 3300048911 Bacteria 2780
270 Ga0496108_0805512 3300048911 Bacteria 810
271 Ga0496109_0000212 3300048912 Bacteria 56945
272 Ga0496109_0007042 3300048912 Bacteria 9487
273 Ga0496109_0007980 3300048912 Bacteria 8974
274 Ga0496109_0086040 3300048912 Bacteria 2903
275 Ga0496109_0525476 3300048912 Bacteria 1117
276 Ga0496109_1845770 3300048912 Bacteria 537
277 Ga0496110_0000288 3300048913 Bacteria 32994
278 Ga0496110_0017093 3300048913 Bacteria 6064
279 Ga0496110_0033445 3300048913 Bacteria 4447
280 Ga0496110_0072436 3300048913 Unclassified 3057
281 Ga0496110_0235408 3300048913 Bacteria 1666
282 Ga0496110_0241981 3300048913 Unclassified 1642
283 Ga0496110_0622292 3300048913 Unclassified 978
284 Ga0496110_0778002 3300048913 Bacteria 861
285 Ga0496111_0000178 3300048914 Bacteria 28805
286 Ga0496111_0000284 3300048914 Bacteria 24558
287 Ga0496111_0016673 3300048914 Bacteria 5067
288 Ga0496111_0025431 3300048914 Bacteria 4177
289 Ga0496111_0120104 3300048914 Bacteria 1941
290 Ga0496112_0131776 3300048915 Bacteria 2471
291 Ga0496113_0011988 3300048916 Bacteria 5812
292 Ga0496113_0044728 3300048916 Bacteria 3282
293 Ga0496113_0092159 3300048916 Bacteria 2337
294 Ga0496113_0714752 3300048916 Unclassified 799
295 Ga0496113_1376895 3300048916 Unclassified 547
296 Ga0496114_0000943 3300048917 Bacteria 21746
297 Ga0496114_0006349 3300048917 Bacteria 9300
298 Ga0496114_0007657 3300048917 Bacteria 8540
299 Ga0496114_0121665 3300048917 Bacteria 2245
300 Ga0496114_1181708 3300048917 Bacteria 651
301 Ga0496115_0026275 3300048918 Bacteria 4543
302 Ga0496115_0709582 3300048918 Bacteria 790
303 Ga0501031_0004587 3300049568 Bacteria 8958
304 Ga0501031_0338116 3300049568 Bacteria 975
305 Ga0501032_0022982 3300049569 Bacteria 4317
306 Ga0501033_0135590 3300049570 Bacteria 1781
307 Ga0501034_0955178 3300049571 Bacteria 743
308 Ga0501036_0138388 3300049572 Bacteria 2055
309 Ga0501037_0018508 3300049573 Bacteria 5134
310 Ga0501038_0001935 3300049574 Bacteria 19107
311 Ga0501039_0000364 3300049575 Bacteria 32385
312 Ga0501040_0000524 3300049576 Bacteria 23062
313 Ga0501040_0106600 3300049576 Bacteria 1958
314 Ga0501040_0408335 3300049576 Bacteria 976
315 Ga0501040_0617584 3300049576 Unclassified 783
316 Ga0501041_0001318 3300049577 Bacteria 13657
317 Ga0501041_0441547 3300049577 Bacteria 826
318 Ga0501042_0006121 3300049578 Bacteria 7794
319 Ga0501042_0073272 3300049578 Bacteria 2450
320 Ga0501042_0088493 3300049578 Bacteria 2222
321 Ga0501043_0319630 3300049579 Bacteria 1184
322 Ga0501046_0003462 3300049580 Bacteria 14484
323 Ga0501046_0724118 3300049580 Bacteria 700
324 Ga0501047_1294091 3300049581 Unclassified 543
325 Ga0501048_0002423 3300049582 Bacteria 14233
326 Ga0501048_0022337 3300049582 Bacteria 4629
327 Ga0501048_0123135 3300049582 Bacteria 1833
328 Ga0501048_0148312 3300049582 Bacteria 1659
329 Ga0501067_0002182 3300049583 Bacteria 10797
330 Ga0501067_0168877 3300049583 Unclassified 1218
331 Ga0501068_0181017 3300049584 Bacteria 1332
332 Ga0501068_0854234 3300049584 Bacteria 598
333 Ga0501069_0001361 3300049585 Bacteria 12005
334 Ga0501069_0410654 3300049585 Unclassified 802
335 Ga0501070_0264094 3300049586 Bacteria 1407
336 Ga0501071_0000033 3300049587 Bacteria 45630
337 Ga0501071_0027551 3300049587 Bacteria 3999
338 Ga0501071_0508733 3300049587 Bacteria 924
339 Ga0501071_0624151 3300049587 Bacteria 829
340 Ga0501072_0013480 3300049588 Bacteria 6257
341 Ga0501072_0047061 3300049588 Bacteria 3396
342 Ga0501073_0113289 3300049589 Unclassified 1881
343 Ga0501074_0009071 3300049590 Bacteria 7223
344 Ga0501075_0000893 3300049591 Bacteria 18824
345 Ga0501075_0050478 3300049591 Bacteria 3127
346 Ga0501075_0257822 3300049591 Bacteria 1329
347 Ga0501075_0451472 3300049591 Bacteria 980
348 Ga0501075_0490731 3300049591 Bacteria 937
349 Ga0501075_1357359 3300049591 Bacteria 538
350 Ga0501076_0005696 3300049592 Bacteria 8984
351 Ga0501076_0009664 3300049592 Bacteria 7124
352 Ga0501076_0562835 3300049592 Bacteria 940
353 Ga0501077_0001640 3300049593 Bacteria 13442
354 Ga0501079_0000130 3300049741 Bacteria 40553
355 Ga0501079_0101218 3300049741 Bacteria 2234
356 Ga0501079_0194259 3300049741 Bacteria 1584
357 Ga0501080_0005135 3300049742 Bacteria 11661
358 Ga0501080_0116383 3300049742 Bacteria 2478
359 Ga0501080_1460174 3300049742 Bacteria 582
360 Ga0501081_0001035 3300049743 Bacteria 16639
361 Ga0501081_0135961 3300049743 Bacteria 1759
362 Ga0501035_0009238 3300049822 Bacteria 9167
363 Ga0501035_0378008 3300049822 Bacteria 1182
364 Ga0501045_0000191 3300049824 Bacteria 34468
365 Ga0501045_0141536 3300049824 Bacteria 1789
366 Ga0501045_0444719 3300049824 Bacteria 964
367 Ga0501045_1289727 3300049824 Bacteria 532
368 nmdc:mga05p37_51178_c1 3300050507 Bacteria 5080
369 nmdc:mga08y16_267420_c1 3300050511 Bacteria 1765
370 nmdc:mga0n895_1285254_c1 3300050512 Bacteria 703
371 nmdc:mga0n895_959345_c1 3300050512 Bacteria 838
372 nmdc:mga0a205_166704_c1 3300050515 Bacteria 2098
373 Ga0495601_0099357 3300053077 Bacteria 1879
374 Ga0501084_0029415 3300054114 Bacteria 4595
375 Ga0501084_0250450 3300054114 Bacteria 1495
376 Ga0501084_0425317 3300054114 Bacteria 1123
377 Ga0501084_0507808 3300054114 Archaea 1019
378 Ga0501084_0859432 3300054114 Bacteria 763
379 Ga0501082_0021893 3300060353 Bacteria 5510
380 Ga0501082_0272195 3300060353 Bacteria 1474
381 Ga0501082_0456804 3300060353 Bacteria 1116
382 Ga0501082_0861303 3300060353 Bacteria 793
383 Ga0530510_0009200 3300061734 Bacteria 6923
384 Ga0530510_0009714 3300061734 Bacteria 6750
385 Ga0530510_0013484 3300061734 Bacteria 5746
386 Ga0530510_0041270 3300061734 Bacteria 3331
387 Ga0530510_0302526 3300061734 Bacteria 1197
388 Ga0530510_0767448 3300061734 Bacteria 735
389 Ga0501038_0613113
390 Ga0070683_100001446
391 Ga0070683_101324753
392 Ga0070690_100404604
393 Ga0070682_100015452
394 Ga0070682_101585369
395 Ga0070682_101724153
396 Ga0068868_100117992
397 Ga0070660_101702126
398 Ga0070691_10309803
399 Ga0070675_100080871
400 Ga0070671_100324662
401 Ga0070671_101004810
402 Ga0070674_100641043
403 Ga0070674_100702076
404 Ga0070659_100508296
405 Ga0070659_101951326
406 Ga0070667_101505087
407 Ga0070714_100024674
408 Ga0070713_100405450
409 Ga0070701_10878785
410 Ga0070711_100277283
411 Ga0070663_100257864
412 Ga0070663_100278935
413 Ga0070678_100058015
414 Ga0070662_100049154
415 Ga0070681_10008442
416 Ga0068867_100565358
417 Ga0068867_100571357
418 Ga0070706_100157724
419 Ga0070706_100175388
420 Ga0070707_100365438
421 Ga0070698_100037141
422 Ga0070698_100164515
423 Ga0070698_100318600
424 Ga0070698_100341617
425 Ga0070699_100026291
426 Ga0070699_100037161
427 Ga0070699_100872216
428 Ga0070679_100041753
429 Ga0070684_100012357
430 Ga0070684_101179432
431 Ga0070684_101622599
432 Ga0068853_101971951
433 Ga0070672_100795332
434 Ga0070686_101034596
435 Ga0070695_101896329
436 Ga0070696_100090565
437 Ga0070696_100500021
438 Ga0070693_100032063
439 Ga0070693_100526665
440 Ga0070693_101675101
441 Ga0070665_100187390
442 Ga0070665_100688920
443 Ga0070704_100244240
444 Ga0068855_101562810
445 Ga0068855_101623724
446 Ga0070664_100660876
447 Ga0070664_101491352
448 Ga0070664_101886167
449 Ga0068857_100471083
450 Ga0068854_100309396
451 Ga0068854_100414979
452 Ga0068856_100500934
453 Ga0068856_100724215
454 Ga0068859_101810855
455 Ga0068864_101474432
456 Ga0068864_101635794
457 Ga0068866_10196119
458 Ga0068866_10251872
459 Ga0068870_10167653
460 Ga0081455_10031570
461 Ga0081455_10046765
462 Ga0081455_10330417
463 Ga0081455_10560413
464 Ga0081455_10585592
465 Ga0081540_1011397
466 Ga0081540_1027675
467 Ga0070712_101861793
468 Ga0068871_100367986
469 Ga0075428_102429920
470 Ga0075431_100401485
471 Ga0075433_10650782
472 Ga0075433_11478521
473 Ga0075434_100142839
474 Ga0075434_100433121
475 Ga0075429_100113492
476 Ga0068865_100568981
477 Ga0097620_101810041
478 Ga0105240_10099400
479 Ga0111539_10145734
480 Ga0105245_10003423
481 Ga0105245_10109363
482 Ga0105245_10283137
483 Ga0105245_10383715
484 Ga0105245_10875456
485 Ga0105245_10912827
486 Ga0105245_10915045
487 Ga0105245_13024790
488 Ga0105243_10193884
489 Ga0105243_11789528
490 Ga0105241_12509678
491 Ga0105242_10050507
492 Ga0105239_10157729
493 Ga0105239_13014323
494 Ga0105246_10116736
495 Ga0105246_11938146
496 Ga0105246_11969806
497 Ga0157374_10147999
498 Ga0157378_10128065
499 Ga0163162_11210419
500 Ga0157375_10111555
501 Ga0157375_10529553
502 Ga0157375_13043402
503 Ga0163163_11386666
504 Ga0157380_10208346
505 Ga0157379_10759688
506 Ga0157376_10334342
507 Ga0157376_10367936
508 Ga0163161_11862317
509 Ga0207642_10112543
510 Ga0207688_10265624
511 Ga0207699_10368858
512 Ga0207643_10114813
513 Ga0207684_10240567
514 Ga0207695_10120036
515 Ga0207693_11362759
516 Ga0207663_10750551
517 Ga0207660_10092057
518 Ga0207662_10133330
519 Ga0207649_10105659
520 Ga0207652_10060312
521 Ga0207652_10460154
522 Ga0207659_10096258
523 Ga0207687_10033967
524 Ga0207687_10036873
525 Ga0207687_10131704
526 Ga0207687_10361811
527 Ga0207687_11123256
528 Ga0207687_11904056
529 Ga0207664_10022812
530 Ga0207644_10229433
531 Ga0207644_10536402
532 Ga0207644_10848455
533 Ga0207706_10211393
534 Ga0207686_10057863
535 Ga0207709_10900500
536 Ga0207709_10942463
537 Ga0207669_10292652
538 Ga0207669_10567735
539 Ga0207691_10879667
540 Ga0207661_10003413
541 Ga0207661_10260449
542 Ga0207661_10846575
543 Ga0207679_10288766
544 Ga0207651_11144703
545 Ga0207651_11860671
546 Ga0207668_10710320
547 Ga0207668_11527193
548 Ga0207640_10157125
549 Ga0207658_10801927
550 Ga0207677_10110677
551 Ga0207678_10271334
552 Ga0207678_10860623
553 Ga0207708_11169264
554 Ga0207702_10006553
555 Ga0207702_10593016
556 Ga0207648_10070398
557 Ga0207648_10289610
558 Ga0207648_11167642
559 Ga0207648_11358356
560 Ga0207674_10390037
561 Ga0207675_101036083
562 Ga0207675_101691823
563 Ga0207683_10015019
564 Ga0268266_11000674
565 Ga0265320_10006755
566 Ga0307408_100360430
567 Ga0307408_100815828
568 Ga0307407_11401432
569 Ga0307412_11516085
570 Ga0307409_100038058
571 Ga0307409_100596557
572 Ga0307411_11227503
573 Ga0307415_100089295
574 Ga0373951_0174898
575 Ga0373952_0148631
576 Ga0373943_0034784
577 Ga0373935_0057293
578 Ga0373935_0955932
579 Ga0373947_0029763
580 Ga0395899_0741864
581 Ga0395898_0985432
582 Ga0395898_1030396
583 Ga0395901_0140128
584 Ga0395901_0164737
585 Ga0395901_0550864
586 Ga0436363_0977173
587 Ga0439461_0133140
588 Ga0439465_0329003
589 Ga0451853_2226286
590 Ga0439433_0087460
591 Ga0439448_0037395
592 Ga0439455_0019229
593 Ga0439463_155425
594 Ga0439446_0005415
595 Ga0439446_0165766
596 Ga0439458_0029442
597 Ga0439434_0006817
598 Ga0439434_0184147
599 Ga0439435_0252029
600 Ga0439460_0040234
601 Ga0450918_009671
602 Ga0451576_0171276
603 Ga0451576_1313621
604 Ga0466967_1114031
605 Ga0495603_0320537
606 Ga0495629_0075516
607 Ga0495641_0022803
608 Ga0495582_0183877
609 Ga0495605_0270561
610 Ga0495584_0057441
611 Ga0495584_0097952
612 Ga0495594_0019914
613 Ga0495596_0033791
614 Ga0495596_0236025
615 Ga0495620_0335292
616 Ga0495630_0041085
617 Ga0495630_0314737
618 Ga0495644_0036577
619 Ga0495665_0422761
620 Ga0495640_0590440
621 Ga0495586_0029827
622 Ga0495598_0173306
623 Ga0495609_0108835
624 Ga0495656_0255209
625 Ga0495634_0178818
626 Ga0495634_0727833
627 Ga0495647_0001825
628 Ga0495658_0518412
629 Ga0495613_0413427
630 Ga0495624_0273850
631 Ga0495670_0381238
632 Ga0495674_0468106
633 Ga0495676_0056087
634 Ga0495680_0931197
635 Ga0495615_0019854
636 Ga0496100_0016358
637 Ga0496101_0000511
638 Ga0496101_0119170
639 Ga0496101_0744859
640 Ga0496101_1605435
641 Ga0496102_0194247
642 Ga0496102_0291454
643 Ga0496102_1020250
644 Ga0496103_0330593
645 Ga0496104_0000085
646 Ga0496105_0002537
647 Ga0496105_0037651
648 Ga0496105_0298009
649 Ga0496106_0032090
650 Ga0496106_0119589
651 Ga0496106_0267337
652 Ga0496107_0120999
653 Ga0496107_0372570
654 Ga0496107_0428395
655 Ga0496108_0002785
656 Ga0496108_0031507
657 Ga0496108_0079277
658 Ga0496108_0805512
659 Ga0496109_0000212
660 Ga0496109_0007042
661 Ga0496109_0007980
662 Ga0496109_0086040
663 Ga0496109_0525476
664 Ga0496109_1845770
665 Ga0496110_0000288
666 Ga0496110_0017093
667 Ga0496110_0033445
668 Ga0496110_0072436
669 Ga0496110_0235408
670 Ga0496110_0241981
671 Ga0496110_0622292
672 Ga0496110_0778002
673 Ga0496111_0000178
674 Ga0496111_0000284
675 Ga0496111_0016673
676 Ga0496111_0025431
677 Ga0496111_0120104
678 Ga0496112_0131776
679 Ga0496113_0011988
680 Ga0496113_0044728
681 Ga0496113_0092159
682 Ga0496113_0714752
683 Ga0496113_1376895
684 Ga0496114_0000943
685 Ga0496114_0006349
686 Ga0496114_0007657
687 Ga0496114_0121665
688 Ga0496114_1181708
689 Ga0496115_0026275
690 Ga0496115_0709582
691 Ga0501031_0004587
692 Ga0501031_0338116
693 Ga0501032_0022982
694 Ga0501033_0135590
695 Ga0501034_0955178
696 Ga0501036_0138388
697 Ga0501037_0018508
698 Ga0501038_0001935
699 Ga0501039_0000364
700 Ga0501040_0000524
701 Ga0501040_0106600
702 Ga0501040_0408335
703 Ga0501040_0617584
704 Ga0501041_0001318
705 Ga0501041_0441547
706 Ga0501042_0006121
707 Ga0501042_0073272
708 Ga0501042_0088493
709 Ga0501043_0319630
710 Ga0501046_0003462
711 Ga0501046_0724118
712 Ga0501047_1294091
713 Ga0501048_0002423
714 Ga0501048_0022337
715 Ga0501048_0123135
716 Ga0501048_0148312
717 Ga0501067_0002182
718 Ga0501067_0168877
719 Ga0501068_0181017
720 Ga0501068_0854234
721 Ga0501069_0001361
722 Ga0501069_0410654
723 Ga0501070_0264094
724 Ga0501071_0000033
725 Ga0501071_0027551
726 Ga0501071_0508733
727 Ga0501071_0624151
728 Ga0501072_0013480
729 Ga0501072_0047061
730 Ga0501073_0113289
731 Ga0501074_0009071
732 Ga0501075_0000893
733 Ga0501075_0050478
734 Ga0501075_0257822
735 Ga0501075_0451472
736 Ga0501075_0490731
737 Ga0501075_1357359
738 Ga0501076_0005696
739 Ga0501076_0009664
740 Ga0501076_0562835
741 Ga0501077_0001640
742 Ga0501079_0000130
743 Ga0501079_0101218
744 Ga0501079_0194259
745 Ga0501080_0005135
746 Ga0501080_0116383
747 Ga0501080_1460174
748 Ga0501081_0001035
749 Ga0501081_0135961
750 Ga0501035_0009238
751 Ga0501035_0378008
752 Ga0501045_0000191
753 Ga0501045_0141536
754 Ga0501045_0444719
755 Ga0501045_1289727
756 nmdc:mga05p37_51178_c1
757 nmdc:mga08y16_267420_c1
758 nmdc:mga0n895_1285254_c1
759 nmdc:mga0n895_959345_c1
760 nmdc:mga0a205_166704_c1
761 Ga0495601_0099357
762 Ga0501084_0029415
763 Ga0501084_0250450
764 Ga0501084_0425317
765 Ga0501084_0507808
766 Ga0501084_0859432
767 Ga0501082_0021893
768 Ga0501082_0272195
769 Ga0501082_0456804
770 Ga0501082_0861303
771 Ga0530510_0009200
772 Ga0530510_0009714
773 Ga0530510_0013484
774 Ga0530510_0041270
775 Ga0530510_0302526
776 Ga0530510_0767448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

3

125

0.92

Map