F431235

General Info

Members Datasets Scaffolds Average Seq Length
388 257 776 244

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0508071|Ga0496114_0508071_103_870
Length 255
Sequence VDAARGSQSVLIGAAVAEAAALNDFLAGAWVEAAVFELRPDYRALLVAVDGIVPGAGAEVGAALLQAAQAAADAALRATPAEQVPHVAAWRDAYRAFGAKPQRTRNSLEALLRRADAGLPRVNPLTDVYNAISVLHQVPLGGEDLERYRGAPRLIRAGGSEPFDTVAYGATVVEHPEPGEVVWCDDAGVTCRRWNWRQARRTRLRDDTTAALFILDALDPMTDDALQTAADDLLGQLSGLGTDVRSARRLIGAIT

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
252 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
253 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
254 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
255 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
256 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
257 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0.77
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 8.25
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0508071 3300048917 Bacteria 1066
2 JGI24744J21845_10000084 3300002077 Bacteria 12061
3 JGI24742J22300_10018234 3300002244 Bacteria 1189
4 Ga0055540_1001816 3300003792 Bacteria 12097
5 Ga0070676_10049896 3300005328 Bacteria 2451
6 Ga0070690_100162706 3300005330 Bacteria 1530
7 Ga0068868_100043228 3300005338 Bacteria 3519
8 Ga0070660_100094161 3300005339 Bacteria 2366
9 Ga0070689_100013963 3300005340 Bacteria 5826
10 Ga0070691_10007597 3300005341 Bacteria 4968
11 Ga0070661_100072103 3300005344 Bacteria 2541
12 Ga0070668_100026137 3300005347 Bacteria 4428
13 Ga0070669_100138525 3300005353 Bacteria 1874
14 Ga0070671_100023723 3300005355 Bacteria 5022
15 Ga0070674_100039720 3300005356 Bacteria 3179
16 Ga0070673_100233156 3300005364 Bacteria 1597
17 Ga0070673_100525686 3300005364 Bacteria 1073
18 Ga0070688_100009493 3300005365 Bacteria 5324
19 Ga0070659_100072729 3300005366 Bacteria 2736
20 Ga0070659_100536089 3300005366 Bacteria 1001
21 Ga0070667_100013354 3300005367 Bacteria 6787
22 Ga0070703_10055626 3300005406 Bacteria 1279
23 Ga0070709_10182013 3300005434 Bacteria 1476
24 Ga0070709_10216975 3300005434 Bacteria 1362
25 Ga0070714_100104085 3300005435 Bacteria 2504
26 Ga0070714_100237834 3300005435 Bacteria 1680
27 Ga0070714_100626493 3300005435 Bacteria 1034
28 Ga0070713_100369848 3300005436 Bacteria 1334
29 Ga0070710_10001223 3300005437 Bacteria 12159
30 Ga0070710_10117121 3300005437 Bacteria 1608
31 Ga0070701_10030177 3300005438 Bacteria 2681
32 Ga0070711_100041224 3300005439 Bacteria 3117
33 Ga0070711_100042033 3300005439 Bacteria 3088
34 Ga0070711_100087905 3300005439 Bacteria 2232
35 Ga0070711_100157131 3300005439 Bacteria 1720
36 Ga0070705_100033204 3300005440 Bacteria 2874
37 Ga0070700_100006764 3300005441 Bacteria 6144
38 Ga0070694_100042487 3300005444 Bacteria 3037
39 Ga0070678_100018703 3300005456 Bacteria 4496
40 Ga0070662_100050302 3300005457 Bacteria 3006
41 Ga0070681_10136321 3300005458 Bacteria 2385
42 Ga0068867_100002830 3300005459 Bacteria 12196
43 Ga0070685_10024793 3300005466 Bacteria 3297
44 Ga0070706_100034334 3300005467 Bacteria 4685
45 Ga0070707_100012343 3300005468 Bacteria 7976
46 Ga0070698_100001214 3300005471 Bacteria 28664
47 Ga0070679_100215143 3300005530 Bacteria 1884
48 Ga0070679_100267939 3300005530 Bacteria 1662
49 Ga0070684_100136454 3300005535 Bacteria 2216
50 Ga0070697_100004140 3300005536 Bacteria 11111
51 Ga0068853_100033914 3300005539 Bacteria 4331
52 Ga0068853_100138754 3300005539 Bacteria 2181
53 Ga0070672_100406443 3300005543 Bacteria 1168
54 Ga0070695_100123809 3300005545 Bacteria 1773
55 Ga0070696_100068173 3300005546 Bacteria 2497
56 Ga0070665_100074538 3300005548 Bacteria 3400
57 Ga0070665_100085097 3300005548 Bacteria 3167
58 Ga0070665_100601745 3300005548 Bacteria 1112
59 Ga0070704_100057992 3300005549 Bacteria 2756
60 Ga0068855_100028065 3300005563 Bacteria 6731
61 Ga0068857_100251130 3300005577 Bacteria 1621
62 Ga0068854_100016416 3300005578 Bacteria 4935
63 Ga0068856_100071329 3300005614 Bacteria 3439
64 Ga0070702_100005732 3300005615 Bacteria 5816
65 Ga0068866_10006801 3300005718 Bacteria 4773
66 Ga0068861_100020480 3300005719 Bacteria 4739
67 Ga0068861_100167448 3300005719 Bacteria 1818
68 Ga0068861_100189611 3300005719 Bacteria 1718
69 Ga0068861_100557878 3300005719 Bacteria 1045
70 Ga0068870_10027371 3300005840 Bacteria 2851
71 Ga0068858_100011353 3300005842 Bacteria 8412
72 Ga0068860_100045471 3300005843 Bacteria 4187
73 Ga0068860_100138223 3300005843 Bacteria 2340
74 Ga0068862_100031343 3300005844 Bacteria 4487
75 Ga0081455_10000791 3300005937 Bacteria 40660
76 Ga0081455_10020382 3300005937 Bacteria 6244
77 Ga0081455_10021034 3300005937 Bacteria 6126
78 Ga0081455_10070301 3300005937 Bacteria 2907
79 Ga0081455_10083651 3300005937 Bacteria 2607
80 Ga0081538_10001354 3300005981 Bacteria 25218
81 Ga0081540_1000113 3300005983 Bacteria 86554
82 Ga0070717_10038663 3300006028 Bacteria 3879
83 Ga0070717_10093806 3300006028 Bacteria 2538
84 Ga0075365_10075323 3300006038 Bacteria 2277
85 Ga0075364_10065247 3300006051 Bacteria 2390
86 Ga0070715_10017550 3300006163 Bacteria 2710
87 Ga0070715_10023735 3300006163 Bacteria 2406
88 Ga0070716_100016930 3300006173 Bacteria 3771
89 Ga0070716_100149165 3300006173 Bacteria 1502
90 Ga0070712_100036659 3300006175 Bacteria 3338
91 Ga0070712_100057108 3300006175 Bacteria 2740
92 Ga0070712_100071191 3300006175 Bacteria 2487
93 Ga0070712_100074809 3300006175 Bacteria 2434
94 Ga0070712_100081148 3300006175 Bacteria 2349
95 Ga0070712_100205962 3300006175 Bacteria 1548
96 Ga0070712_100267984 3300006175 Bacteria 1371
97 Ga0075369_10000099 3300006186 Bacteria 23108
98 Ga0075369_10006782 3300006186 Bacteria 4343
99 Ga0075369_10023465 3300006186 Bacteria 2550
100 Ga0097621_100173785 3300006237 Bacteria 1858
101 Ga0075370_10002769 3300006353 Bacteria 8212
102 Ga0075370_10044637 3300006353 Bacteria 2506
103 Ga0068871_100110313 3300006358 Bacteria 2313
104 Ga0075433_10084494 3300006852 Bacteria 2802
105 Ga0075434_100336278 3300006871 Bacteria 1530
106 Ga0068865_100035293 3300006881 Bacteria 3361
107 Ga0068865_100469529 3300006881 Bacteria 1044
108 Ga0075436_100521452 3300006914 Bacteria 871
109 Ga0075435_100039256 3300007076 Bacteria 3777
110 Ga0105240_10252536 3300009093 Bacteria 2039
111 Ga0105245_10035033 3300009098 Bacteria 4453
112 Ga0105247_10005855 3300009101 Bacteria 7681
113 Ga0114129_10662345 3300009147 Bacteria 1346
114 Ga0105243_10031431 3300009148 Bacteria 4093
115 Ga0105243_10333303 3300009148 Bacteria 1387
116 Ga0105248_10119435 3300009177 Bacteria 2973
117 Ga0105248_10255748 3300009177 Bacteria 1972
118 Ga0105248_10500905 3300009177 Bacteria 1369
119 Ga0105238_10494118 3300009551 Bacteria 1224
120 Ga0105249_10076643 3300009553 Bacteria 3100
121 Ga0105249_10581641 3300009553 Bacteria 1173
122 Ga0105239_10471906 3300010375 Bacteria 1425
123 Ga0105246_10153388 3300011119 Bacteria 1746
124 Ga0157341_1001706 3300012494 Bacteria 1370
125 Ga0157373_10032827 3300013100 Bacteria 3736
126 Ga0157374_10319479 3300013296 Bacteria 1538
127 Ga0163162_10028982 3300013306 Bacteria 5478
128 Ga0163162_10038168 3300013306 Bacteria 4794
129 Ga0163162_10952609 3300013306 Bacteria 969
130 Ga0163162_11075488 3300013306 Bacteria 911
131 Ga0157372_10027821 3300013307 Bacteria 6162
132 Ga0157372_10403987 3300013307 Bacteria 1592
133 Ga0157375_10051425 3300013308 Bacteria 4046
134 Ga0163163_10285457 3300014325 Bacteria 1702
135 Ga0157380_10054260 3300014326 Bacteria 3180
136 Ga0157380_11014317 3300014326 Bacteria 864
137 Ga0182008_10187703 3300014497 Bacteria 1048
138 Ga0157377_10101163 3300014745 Bacteria 1718
139 Ga0163161_10061105 3300017792 Bacteria 2743
140 Ga0206354_10621879 3300020081 Bacteria 1091
141 Ga0206353_10068725 3300020082 Bacteria 1309
142 Ga0206353_10172267 3300020082 Unclassified 921
143 Ga0207653_10092050 3300025885 Bacteria 1063
144 Ga0207692_10021501 3300025898 Bacteria 2952
145 Ga0207692_10095627 3300025898 Bacteria 1620
146 Ga0207642_10002401 3300025899 Bacteria 5833
147 Ga0207688_10010540 3300025901 Bacteria 5028
148 Ga0207688_10054310 3300025901 Bacteria 2247
149 Ga0207688_10092702 3300025901 Bacteria 1736
150 Ga0207680_10170535 3300025903 Bacteria 1465
151 Ga0207647_10175762 3300025904 Bacteria 1246
152 Ga0207699_10022171 3300025906 Bacteria 3437
153 Ga0207645_10084212 3300025907 Bacteria 2040
154 Ga0207643_10172978 3300025908 Bacteria 1304
155 Ga0207643_10327569 3300025908 Bacteria 958
156 Ga0207643_10345337 3300025908 Bacteria 933
157 Ga0207705_10172542 3300025909 Bacteria 1629
158 Ga0207684_10007395 3300025910 Bacteria 9891
159 Ga0207693_10003634 3300025915 Bacteria 13172
160 Ga0207693_10015101 3300025915 Bacteria 6199
161 Ga0207693_10043834 3300025915 Bacteria 3517
162 Ga0207693_10055236 3300025915 Bacteria 3116
163 Ga0207663_10033492 3300025916 Bacteria 3061
164 Ga0207663_10055580 3300025916 Bacteria 2484
165 Ga0207663_10062719 3300025916 Bacteria 2364
166 Ga0207662_10042600 3300025918 Bacteria 2676
167 Ga0207657_10019832 3300025919 Bacteria 6373
168 Ga0207652_10776438 3300025921 Bacteria 852
169 Ga0207646_10007423 3300025922 Bacteria 11140
170 Ga0207681_10060661 3300025923 Bacteria 2597
171 Ga0207687_10048400 3300025927 Bacteria 2952
172 Ga0207700_10099827 3300025928 Bacteria 2312
173 Ga0207700_10104710 3300025928 Bacteria 2264
174 Ga0207700_10777476 3300025928 Bacteria 856
175 Ga0207664_10046705 3300025929 Bacteria 3400
176 Ga0207664_10080073 3300025929 Bacteria 2654
177 Ga0207664_10293865 3300025929 Bacteria 1428
178 Ga0207690_10056663 3300025932 Bacteria 2645
179 Ga0207706_10013518 3300025933 Bacteria 7419
180 Ga0207706_10060729 3300025933 Bacteria 3329
181 Ga0207706_10522218 3300025933 Bacteria 1024
182 Ga0207709_10056814 3300025935 Bacteria 2424
183 Ga0207709_10161294 3300025935 Bacteria 1564
184 Ga0207704_10052481 3300025938 Bacteria 2472
185 Ga0207665_10008375 3300025939 Bacteria 6822
186 Ga0207665_10244007 3300025939 Bacteria 1325
187 Ga0207691_10004492 3300025940 Bacteria 13506
188 Ga0207691_10048294 3300025940 Bacteria 3903
189 Ga0207711_10107934 3300025941 Bacteria 2472
190 Ga0207711_10429356 3300025941 Bacteria 1229
191 Ga0207689_10021522 3300025942 Bacteria 5422
192 Ga0207661_10337860 3300025944 Bacteria 1357
193 Ga0207667_10202638 3300025949 Bacteria 2035
194 Ga0207667_10222974 3300025949 Bacteria 1931
195 Ga0207712_10022567 3300025961 Bacteria 4146
196 Ga0207712_10405115 3300025961 Bacteria 1147
197 Ga0207668_10087249 3300025972 Bacteria 2282
198 Ga0207668_10134048 3300025972 Bacteria 1895
199 Ga0207640_10062699 3300025981 Bacteria 2467
200 Ga0207658_10027628 3300025986 Bacteria 3989
201 Ga0207658_10061184 3300025986 Bacteria 2813
202 Ga0207677_10023479 3300026023 Bacteria 3811
203 Ga0207703_10028680 3300026035 Bacteria 4391
204 Ga0207639_10258197 3300026041 Bacteria 1523
205 Ga0207678_10015453 3300026067 Bacteria 6711
206 Ga0207678_10321616 3300026067 Bacteria 1331
207 Ga0207708_10013765 3300026075 Bacteria 6046
208 Ga0207648_10007544 3300026089 Bacteria 10674
209 Ga0207676_10207070 3300026095 Bacteria 1737
210 Ga0207674_10024821 3300026116 Bacteria 6399
211 Ga0207674_10083400 3300026116 Bacteria 3196
212 Ga0207674_10128752 3300026116 Bacteria 2496
213 Ga0207675_100023107 3300026118 Bacteria 5782
214 Ga0207675_100115080 3300026118 Bacteria 2541
215 Ga0207683_10007323 3300026121 Bacteria 9456
216 Ga0207683_10014347 3300026121 Bacteria 6751
217 Ga0207698_10089277 3300026142 Bacteria 2517
218 Ga0268266_10349545 3300028379 Bacteria 1389
219 Ga0268266_10558345 3300028379 Bacteria 1097
220 Ga0268264_10033838 3300028381 Bacteria 4201
221 Ga0268264_10291731 3300028381 Bacteria 1532
222 Ga0265314_10059926 3300031711 Unclassified 2600
223 Ga0307405_10126925 3300031731 Bacteria 1756
224 Ga0307413_10063210 3300031824 Bacteria 2294
225 Ga0307407_10271121 3300031903 Bacteria 1171
226 Ga0307412_10016269 3300031911 Bacteria 4428
227 Ga0307416_101060264 3300032002 Bacteria 915
228 Ga0307411_10062317 3300032005 Bacteria 2487
229 Ga0373926_0070520 3300035083 Bacteria 1284
230 Ga0373940_0057812 3300035088 Bacteria 1103
231 Ga0373949_0009189 3300035090 Bacteria 2167
232 Ga0373951_0010069 3300035091 Bacteria 2122
233 Ga0373942_0008603 3300035207 Bacteria 2382
234 Ga0316574_0051183 3300035398 Bacteria 2574
235 Ga0373935_0036506 3300035692 Bacteria 3073
236 Ga0373947_0476901 3300035725 Bacteria 846
237 Ga0373937_0667349 3300036401 Bacteria 985
238 Ga0373925_0246445 3300037068 Bacteria 1432
239 Ga0373925_0486755 3300037068 Bacteria 1012
240 Ga0436364_0036655 3300037853 Bacteria 1162
241 Ga0439461_0003177 3300041410 Bacteria 2688
242 Ga0439465_0002614 3300041413 Bacteria 5875
243 Ga0439434_0108363 3300042435 Bacteria 898
244 Ga0466972_0040253 3300044658 Bacteria 2277
245 Ga0466972_0175926 3300044658 Bacteria 1004
246 Ga0466965_0038159 3300044683 Bacteria 2359
247 Ga0466966_0071507 3300044684 Bacteria 2173
248 Ga0466966_0089863 3300044684 Bacteria 1908
249 Ga0466966_0122600 3300044684 Bacteria 1596
250 Ga0466966_0139397 3300044684 Bacteria 1483
251 Ga0466961_0056954 3300044693 Bacteria 2489
252 Ga0466963_0020253 3300044694 Bacteria 4183
253 Ga0466963_0354503 3300044694 Bacteria 1033
254 Ga0466971_0210475 3300044719 Bacteria 919
255 Ga0466968_0034821 3300044735 Bacteria 2104
256 Ga0466970_0032129 3300044765 Bacteria 2773
257 Ga0466957_0028750 3300044842 Bacteria 3311
258 Ga0466960_0029590 3300044901 Bacteria 2514
259 Ga0466959_0027209 3300045049 Bacteria 4242
260 Ga0466959_0027472 3300045049 Bacteria 4221
261 Ga0466959_0051276 3300045049 Bacteria 3027
262 Ga0466959_0353390 3300045049 Bacteria 1002
263 Ga0466959_0369420 3300045049 Bacteria 977
264 Ga0466958_0042057 3300045836 Bacteria 2751
265 Ga0466958_0047922 3300045836 Bacteria 2580
266 Ga0466958_0196685 3300045836 Bacteria 1282
267 Ga0466967_0002843 3300045976 Bacteria 10991
268 Ga0466967_0087086 3300045976 Bacteria 2831
269 Ga0495592_0073639 3300046454 Bacteria 2483
270 Ga0495592_0135492 3300046454 Bacteria 1718
271 Ga0495592_0220852 3300046454 Bacteria 1267
272 Ga0495629_0031386 3300046459 Bacteria 3763
273 Ga0495629_0113392 3300046459 Eukaryota 1889
274 Ga0495641_0003168 3300046461 Eukaryota 12519
275 Ga0495641_0019196 3300046461 Bacteria 3505
276 Ga0495641_0055877 3300046461 Bacteria 1791
277 Ga0495651_0051771 3300046462 Bacteria 3164
278 Ga0495651_0057191 3300046462 Bacteria 2994
279 Ga0495651_0242965 3300046462 Eukaryota 1234
280 Ga0495653_0269808 3300046463 Bacteria 1121
281 Ga0495580_0250299 3300046472 Bacteria 1213
282 Ga0495639_0084456 3300046475 Bacteria 1483
283 Ga0495662_0110064 3300046476 Bacteria 1350
284 Ga0495618_0455196 3300046514 Eukaryota 776
285 Ga0495628_0052196 3300046516 Bacteria 3230
286 Ga0495628_0226051 3300046516 Bacteria 1404
287 Ga0495630_0029408 3300046517 Bacteria 4086
288 Ga0495630_0456097 3300046517 Bacteria 980
289 Ga0495663_0096028 3300046525 Bacteria 971
290 Ga0495652_0024269 3300046529 Bacteria 5369
291 Ga0495652_0028042 3300046529 Bacteria 4959
292 Ga0495652_0074080 3300046529 Bacteria 2832
293 Ga0495652_0707669 3300046529 Bacteria 677
294 Ga0495640_0027222 3300046533 Bacteria 4125
295 Ga0495587_0129877 3300046536 Bacteria 1440
296 Ga0495645_0080452 3300046543 Bacteria 2339
297 Ga0495645_0161729 3300046543 Bacteria 1547
298 Ga0495645_0175817 3300046543 Bacteria 1470
299 Ga0495633_0075685 3300046558 Bacteria 1567
300 Ga0495667_0034328 3300046559 Bacteria 3392
301 Ga0495656_0000987 3300046615 Bacteria 9206
302 Ga0495635_0010164 3300046663 Eukaryota 6582
303 Ga0495635_0243717 3300046663 Bacteria 1212
304 Ga0495635_0303388 3300046663 Bacteria 1070
305 Ga0495661_0043288 3300046665 Bacteria 2769
306 Ga0495657_0014867 3300046675 Bacteria 5709
307 Ga0495657_0265264 3300046675 Bacteria 1031
308 Ga0495599_0071220 3300046678 Bacteria 2170
309 Ga0495599_0210991 3300046678 Bacteria 1190
310 Ga0495624_0005025 3300046690 Eukaryota 9572
311 Ga0495624_0382182 3300046690 Bacteria 846
312 Ga0495670_0000581 3300046691 Bacteria 17433
313 Ga0495600_0154129 3300046809 Eukaryota 1487
314 Ga0495600_0196495 3300046809 Bacteria 1296
315 Ga0495604_0009428 3300047317 Bacteria 7722
316 Ga0495604_0087863 3300047317 Bacteria 2314
317 Ga0495636_0001206 3300047318 Bacteria 9775
318 Ga0495674_0006716 3300047319 Bacteria 11022
319 Ga0495672_0022583 3300047320 Bacteria 4087
320 Ga0495676_0024053 3300047321 Eukaryota 5278
321 Ga0495676_0166145 3300047321 Bacteria 1557
322 Ga0495680_0030825 3300047322 Bacteria 4372
323 Ga0495677_0042833 3300047445 Bacteria 1659
324 Ga0495685_010093 3300047447 Bacteria 3164
325 Ga0495681_0017901 3300047470 Bacteria 3921
326 Ga0495684_0009533 3300047471 Bacteria 7486
327 Ga0495684_0068814 3300047471 Bacteria 2692
328 Ga0495593_0125849 3300047673 Bacteria 1303
329 Ga0495602_0025899 3300048088 Eukaryota 5668
330 Ga0496100_0326939 3300048903 Bacteria 1153
331 Ga0496101_0125997 3300048904 Bacteria 1940
332 Ga0496101_0247845 3300048904 Bacteria 1387
333 Ga0496101_0744719 3300048904 Bacteria 773
334 Ga0496102_0071322 3300048905 Bacteria 3190
335 Ga0496102_0180364 3300048905 Bacteria 1989
336 Ga0496102_0202715 3300048905 Bacteria 1870
337 Ga0496102_0222412 3300048905 Bacteria 1780
338 Ga0496103_0022693 3300048906 Bacteria 3779
339 Ga0496103_0045335 3300048906 Bacteria 2713
340 Ga0496103_0070919 3300048906 Bacteria 2180
341 Ga0496103_0082319 3300048906 Bacteria 2025
342 Ga0496104_0164285 3300048907 Bacteria 2129
343 Ga0496107_0004746 3300048910 Bacteria 9233
344 Ga0496107_0233276 3300048910 Bacteria 1369
345 Ga0496108_0174649 3300048911 Bacteria 1859
346 Ga0496109_0062684 3300048912 Bacteria 3400
347 Ga0496110_0053753 3300048913 Bacteria 3541
348 Ga0496110_0086131 3300048913 Bacteria 2804
349 Ga0496110_0195651 3300048913 Bacteria 1836
350 Ga0496111_0038907 3300048914 Bacteria 3408
351 Ga0496111_0065314 3300048914 Bacteria 2641
352 Ga0496111_0068579 3300048914 Bacteria 2577
353 Ga0496112_0688527 3300048915 Bacteria 950
354 Ga0496113_0107167 3300048916 Bacteria 2171
355 Ga0496114_0105708 3300048917 Bacteria 2408
356 Ga0496114_0204318 3300048917 Bacteria 1731
357 Ga0496114_0425633 3300048917 Bacteria 1176
358 Ga0496115_0033017 3300048918 Bacteria 4085
359 Ga0496115_0095190 3300048918 Bacteria 2437
360 Ga0496115_0125111 3300048918 Bacteria 2117
361 Ga0496116_0000423 3300048919 Bacteria 59658
362 Ga0496117_0046895 3300048920 Bacteria 3105
363 Ga0496118_0081618 3300048921 Bacteria 2269
364 Ga0496119_0000661 3300048922 Bacteria 46203
365 Ga0496126_0058558 3300048929 Bacteria 3472
366 Ga0501036_0311928 3300049572 Bacteria 1315
367 nmdc:mga00v17_259549_c1 3300050491 Bacteria 1127
368 nmdc:mga07m45_21392_c1 3300050496 Bacteria 3522
369 nmdc:mga07m45_61291_c1 3300050496 Bacteria 2130
370 nmdc:mga05p37_153879_c1 3300050507 Bacteria 2466
371 nmdc:mga0n895_50618_c1 3300050512 Bacteria 4073
372 nmdc:mga08x19_278236_c1 3300050514 Bacteria 1159
373 nmdc:mga08x19_364910_c1 3300050514 Bacteria 1010
374 nmdc:mga0a205_55585_c1 3300050515 Bacteria 3823
375 nmdc:mga0sz30_2668_c1 3300050516 Bacteria 3470
376 Ga0495619_0099721 3300053085 Bacteria 1976
377 Ga0500643_003376 3300053087 Bacteria 7723
378 Ga0500590_000283 3300053148 Bacteria 16088
379 Ga0500616_0009516 3300053153 Bacteria 5906
380 Ga0500627_0008147 3300053158 Bacteria 3702
381 Ga0466962_0263465 3300061719 Bacteria 849
382 2855391101 2855386786 Bacteria 4752232
383 2857740964 2857740372 Bacteria 4782044
384 2902816439 2902810491 Bacteria 6794147
385 2904498434 2904497146 Bacteria 4731781
386 2910814593 2910809715 Bacteria 4982797
387 2946005452 2946003308 Bacteria 3857229
388 8054112130 8054107350 Bacteria 5022511
389 Ga0496114_0508071
390 JGI24744J21845_10000084
391 JGI24742J22300_10018234
392 Ga0055540_1001816
393 Ga0070676_10049896
394 Ga0070690_100162706
395 Ga0068868_100043228
396 Ga0070660_100094161
397 Ga0070689_100013963
398 Ga0070691_10007597
399 Ga0070661_100072103
400 Ga0070668_100026137
401 Ga0070669_100138525
402 Ga0070671_100023723
403 Ga0070674_100039720
404 Ga0070673_100233156
405 Ga0070673_100525686
406 Ga0070688_100009493
407 Ga0070659_100072729
408 Ga0070659_100536089
409 Ga0070667_100013354
410 Ga0070703_10055626
411 Ga0070709_10182013
412 Ga0070709_10216975
413 Ga0070714_100104085
414 Ga0070714_100237834
415 Ga0070714_100626493
416 Ga0070713_100369848
417 Ga0070710_10001223
418 Ga0070710_10117121
419 Ga0070701_10030177
420 Ga0070711_100041224
421 Ga0070711_100042033
422 Ga0070711_100087905
423 Ga0070711_100157131
424 Ga0070705_100033204
425 Ga0070700_100006764
426 Ga0070694_100042487
427 Ga0070678_100018703
428 Ga0070662_100050302
429 Ga0070681_10136321
430 Ga0068867_100002830
431 Ga0070685_10024793
432 Ga0070706_100034334
433 Ga0070707_100012343
434 Ga0070698_100001214
435 Ga0070679_100215143
436 Ga0070679_100267939
437 Ga0070684_100136454
438 Ga0070697_100004140
439 Ga0068853_100033914
440 Ga0068853_100138754
441 Ga0070672_100406443
442 Ga0070695_100123809
443 Ga0070696_100068173
444 Ga0070665_100074538
445 Ga0070665_100085097
446 Ga0070665_100601745
447 Ga0070704_100057992
448 Ga0068855_100028065
449 Ga0068857_100251130
450 Ga0068854_100016416
451 Ga0068856_100071329
452 Ga0070702_100005732
453 Ga0068866_10006801
454 Ga0068861_100020480
455 Ga0068861_100167448
456 Ga0068861_100189611
457 Ga0068861_100557878
458 Ga0068870_10027371
459 Ga0068858_100011353
460 Ga0068860_100045471
461 Ga0068860_100138223
462 Ga0068862_100031343
463 Ga0081455_10000791
464 Ga0081455_10020382
465 Ga0081455_10021034
466 Ga0081455_10070301
467 Ga0081455_10083651
468 Ga0081538_10001354
469 Ga0081540_1000113
470 Ga0070717_10038663
471 Ga0070717_10093806
472 Ga0075365_10075323
473 Ga0075364_10065247
474 Ga0070715_10017550
475 Ga0070715_10023735
476 Ga0070716_100016930
477 Ga0070716_100149165
478 Ga0070712_100036659
479 Ga0070712_100057108
480 Ga0070712_100071191
481 Ga0070712_100074809
482 Ga0070712_100081148
483 Ga0070712_100205962
484 Ga0070712_100267984
485 Ga0075369_10000099
486 Ga0075369_10006782
487 Ga0075369_10023465
488 Ga0097621_100173785
489 Ga0075370_10002769
490 Ga0075370_10044637
491 Ga0068871_100110313
492 Ga0075433_10084494
493 Ga0075434_100336278
494 Ga0068865_100035293
495 Ga0068865_100469529
496 Ga0075436_100521452
497 Ga0075435_100039256
498 Ga0105240_10252536
499 Ga0105245_10035033
500 Ga0105247_10005855
501 Ga0114129_10662345
502 Ga0105243_10031431
503 Ga0105243_10333303
504 Ga0105248_10119435
505 Ga0105248_10255748
506 Ga0105248_10500905
507 Ga0105238_10494118
508 Ga0105249_10076643
509 Ga0105249_10581641
510 Ga0105239_10471906
511 Ga0105246_10153388
512 Ga0157341_1001706
513 Ga0157373_10032827
514 Ga0157374_10319479
515 Ga0163162_10028982
516 Ga0163162_10038168
517 Ga0163162_10952609
518 Ga0163162_11075488
519 Ga0157372_10027821
520 Ga0157372_10403987
521 Ga0157375_10051425
522 Ga0163163_10285457
523 Ga0157380_10054260
524 Ga0157380_11014317
525 Ga0182008_10187703
526 Ga0157377_10101163
527 Ga0163161_10061105
528 Ga0206354_10621879
529 Ga0206353_10068725
530 Ga0206353_10172267
531 Ga0207653_10092050
532 Ga0207692_10021501
533 Ga0207692_10095627
534 Ga0207642_10002401
535 Ga0207688_10010540
536 Ga0207688_10054310
537 Ga0207688_10092702
538 Ga0207680_10170535
539 Ga0207647_10175762
540 Ga0207699_10022171
541 Ga0207645_10084212
542 Ga0207643_10172978
543 Ga0207643_10327569
544 Ga0207643_10345337
545 Ga0207705_10172542
546 Ga0207684_10007395
547 Ga0207693_10003634
548 Ga0207693_10015101
549 Ga0207693_10043834
550 Ga0207693_10055236
551 Ga0207663_10033492
552 Ga0207663_10055580
553 Ga0207663_10062719
554 Ga0207662_10042600
555 Ga0207657_10019832
556 Ga0207652_10776438
557 Ga0207646_10007423
558 Ga0207681_10060661
559 Ga0207687_10048400
560 Ga0207700_10099827
561 Ga0207700_10104710
562 Ga0207700_10777476
563 Ga0207664_10046705
564 Ga0207664_10080073
565 Ga0207664_10293865
566 Ga0207690_10056663
567 Ga0207706_10013518
568 Ga0207706_10060729
569 Ga0207706_10522218
570 Ga0207709_10056814
571 Ga0207709_10161294
572 Ga0207704_10052481
573 Ga0207665_10008375
574 Ga0207665_10244007
575 Ga0207691_10004492
576 Ga0207691_10048294
577 Ga0207711_10107934
578 Ga0207711_10429356
579 Ga0207689_10021522
580 Ga0207661_10337860
581 Ga0207667_10202638
582 Ga0207667_10222974
583 Ga0207712_10022567
584 Ga0207712_10405115
585 Ga0207668_10087249
586 Ga0207668_10134048
587 Ga0207640_10062699
588 Ga0207658_10027628
589 Ga0207658_10061184
590 Ga0207677_10023479
591 Ga0207703_10028680
592 Ga0207639_10258197
593 Ga0207678_10015453
594 Ga0207678_10321616
595 Ga0207708_10013765
596 Ga0207648_10007544
597 Ga0207676_10207070
598 Ga0207674_10024821
599 Ga0207674_10083400
600 Ga0207674_10128752
601 Ga0207675_100023107
602 Ga0207675_100115080
603 Ga0207683_10007323
604 Ga0207683_10014347
605 Ga0207698_10089277
606 Ga0268266_10349545
607 Ga0268266_10558345
608 Ga0268264_10033838
609 Ga0268264_10291731
610 Ga0265314_10059926
611 Ga0307405_10126925
612 Ga0307413_10063210
613 Ga0307407_10271121
614 Ga0307412_10016269
615 Ga0307416_101060264
616 Ga0307411_10062317
617 Ga0373926_0070520
618 Ga0373940_0057812
619 Ga0373949_0009189
620 Ga0373951_0010069
621 Ga0373942_0008603
622 Ga0316574_0051183
623 Ga0373935_0036506
624 Ga0373947_0476901
625 Ga0373937_0667349
626 Ga0373925_0246445
627 Ga0373925_0486755
628 Ga0436364_0036655
629 Ga0439461_0003177
630 Ga0439465_0002614
631 Ga0439434_0108363
632 Ga0466972_0040253
633 Ga0466972_0175926
634 Ga0466965_0038159
635 Ga0466966_0071507
636 Ga0466966_0089863
637 Ga0466966_0122600
638 Ga0466966_0139397
639 Ga0466961_0056954
640 Ga0466963_0020253
641 Ga0466963_0354503
642 Ga0466971_0210475
643 Ga0466968_0034821
644 Ga0466970_0032129
645 Ga0466957_0028750
646 Ga0466960_0029590
647 Ga0466959_0027209
648 Ga0466959_0027472
649 Ga0466959_0051276
650 Ga0466959_0353390
651 Ga0466959_0369420
652 Ga0466958_0042057
653 Ga0466958_0047922
654 Ga0466958_0196685
655 Ga0466967_0002843
656 Ga0466967_0087086
657 Ga0495592_0073639
658 Ga0495592_0135492
659 Ga0495592_0220852
660 Ga0495629_0031386
661 Ga0495629_0113392
662 Ga0495641_0003168
663 Ga0495641_0019196
664 Ga0495641_0055877
665 Ga0495651_0051771
666 Ga0495651_0057191
667 Ga0495651_0242965
668 Ga0495653_0269808
669 Ga0495580_0250299
670 Ga0495639_0084456
671 Ga0495662_0110064
672 Ga0495618_0455196
673 Ga0495628_0052196
674 Ga0495628_0226051
675 Ga0495630_0029408
676 Ga0495630_0456097
677 Ga0495663_0096028
678 Ga0495652_0024269
679 Ga0495652_0028042
680 Ga0495652_0074080
681 Ga0495652_0707669
682 Ga0495640_0027222
683 Ga0495587_0129877
684 Ga0495645_0080452
685 Ga0495645_0161729
686 Ga0495645_0175817
687 Ga0495633_0075685
688 Ga0495667_0034328
689 Ga0495656_0000987
690 Ga0495635_0010164
691 Ga0495635_0243717
692 Ga0495635_0303388
693 Ga0495661_0043288
694 Ga0495657_0014867
695 Ga0495657_0265264
696 Ga0495599_0071220
697 Ga0495599_0210991
698 Ga0495624_0005025
699 Ga0495624_0382182
700 Ga0495670_0000581
701 Ga0495600_0154129
702 Ga0495600_0196495
703 Ga0495604_0009428
704 Ga0495604_0087863
705 Ga0495636_0001206
706 Ga0495674_0006716
707 Ga0495672_0022583
708 Ga0495676_0024053
709 Ga0495676_0166145
710 Ga0495680_0030825
711 Ga0495677_0042833
712 Ga0495685_010093
713 Ga0495681_0017901
714 Ga0495684_0009533
715 Ga0495684_0068814
716 Ga0495593_0125849
717 Ga0495602_0025899
718 Ga0496100_0326939
719 Ga0496101_0125997
720 Ga0496101_0247845
721 Ga0496101_0744719
722 Ga0496102_0071322
723 Ga0496102_0180364
724 Ga0496102_0202715
725 Ga0496102_0222412
726 Ga0496103_0022693
727 Ga0496103_0045335
728 Ga0496103_0070919
729 Ga0496103_0082319
730 Ga0496104_0164285
731 Ga0496107_0004746
732 Ga0496107_0233276
733 Ga0496108_0174649
734 Ga0496109_0062684
735 Ga0496110_0053753
736 Ga0496110_0086131
737 Ga0496110_0195651
738 Ga0496111_0038907
739 Ga0496111_0065314
740 Ga0496111_0068579
741 Ga0496112_0688527
742 Ga0496113_0107167
743 Ga0496114_0105708
744 Ga0496114_0204318
745 Ga0496114_0425633
746 Ga0496115_0033017
747 Ga0496115_0095190
748 Ga0496115_0125111
749 Ga0496116_0000423
750 Ga0496117_0046895
751 Ga0496118_0081618
752 Ga0496119_0000661
753 Ga0496126_0058558
754 Ga0501036_0311928
755 nmdc:mga00v17_259549_c1
756 nmdc:mga07m45_21392_c1
757 nmdc:mga07m45_61291_c1
758 nmdc:mga05p37_153879_c1
759 nmdc:mga0n895_50618_c1
760 nmdc:mga08x19_278236_c1
761 nmdc:mga08x19_364910_c1
762 nmdc:mga0a205_55585_c1
763 nmdc:mga0sz30_2668_c1
764 Ga0495619_0099721
765 Ga0500643_003376
766 Ga0500590_000283
767 Ga0500616_0009516
768 Ga0500627_0008147
769 Ga0466962_0263465
770 2855391101
771 2857740964
772 2902816439
773 2904498434
774 2910814593
775 2946005452
776 8054112130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03483

B3_4

B3/4 domain

89

231

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wi5-assembly2.cif.gz_B de novo designed protein foldit4 0.7492 188 238
7db7-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phenylalanyl-trna synthetase in complex with compound gdi05-001 0.7003 14 244
6p8t-assembly1.cif.gz_B acinetobacter baumannii trna synthetase in complex with compound 1 0.6996 14 244
5y3a-assembly2.cif.gz_G crystal structure of ragulator complex (p18 49-161) 0.6976 187 222
7k9m-assembly1.cif.gz_B-2 crystal structure of the complex of m. tuberculosis phers with cognate precursor trna and 5'-o-(n-phenylalanyl)sulfamoyl-adenosine 0.6969 14 244
ID Description Score Start End Superfamily
af_Q55CR0_1_124_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7702 196 224 3.30.450.50
af_P9WFQ1_1_102_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7596 197 239 3.30.70.930
2xhgA02 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Nonribosomal peptide synthetase, condensation domain 0.7582 194 225 3.30.559.30
af_K8FE02_395_485_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.7301 193 225 3.30.1370.10
af_Q5IRJ7_6_128_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7141 195 226 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A0A6UJF9-F1-model_v4 B3/B4 tRNA-binding domain-containing protein 0.9859 12 238 GO:0003723
GO:0004826
AF-A0A3M7H497-F1-model_v4 B3/B4 tRNA-binding domain-containing protein 0.9812 4 237 GO:0003723
GO:0004826
AF-A0A7V8NGV3-F1-model_v4 B3/B4 tRNA-binding domain-containing protein 0.979 7 235 GO:0003723
GO:0004826
AF-A0A7W9Q5R8-F1-model_v4 DNA/RNA-binding domain of Phe-tRNA-synthetase-like protein 0.9784 10 237 GO:0003723
GO:0004826
AF-A0A428R1V3-F1-model_v4 B3/B4 tRNA-binding domain-containing protein 0.9777 1 238 GO:0003723
GO:0004826

Map