F431206

General Info

Members Datasets Scaffolds Average Seq Length
388 187 776 144

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0062748|Ga0466967_0062748_2110_2577
Length 155
Sequence MSRPRLTDVGEWQRDEWVDLMLDDLETWAVIGLSGDRGRTAYSIAELLQRRGKRIVPIHPRFSVAADDDGVLGERGYPTLADVPFPVDVVDVFRRSDAAGEFADQARSMGARGVWFQLGVIDVDAFDRTTRAGVPMVMDTCPAIEWRRRDDPRRA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2643221615 Nocardioides sp. Root224 Isolate Unclassified
186 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
187 2739367898 Nocardioides sp. CF479 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0.77
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 18.56
Rhizosphere 77.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0062748 3300045976 Bacteria 3300
2 JGI24740J21852_10019979 3300001979 Bacteria 2349
3 JGI24737J22298_10047599 3300001990 Bacteria 1307
4 JGI24735J21928_10031514 3300002067 Bacteria 1572
5 Ga0070658_10001484 3300005327 Bacteria 19913
6 Ga0070658_10021164 3300005327 Bacteria 5210
7 Ga0070658_10137548 3300005327 Bacteria 2039
8 Ga0070683_100000230 3300005329 Bacteria 38094
9 Ga0070683_100009013 3300005329 Bacteria 8512
10 Ga0070683_100231239 3300005329 Bacteria 1758
11 Ga0070683_100448785 3300005329 Bacteria 1230
12 Ga0070690_100674745 3300005330 Bacteria 791
13 Ga0070677_10425977 3300005333 Bacteria 705
14 Ga0070680_100039806 3300005336 Bacteria 3803
15 Ga0070682_100086758 3300005337 Bacteria 2039
16 Ga0070682_100385374 3300005337 Bacteria 1056
17 Ga0068868_100045429 3300005338 Bacteria 3436
18 Ga0068868_100384706 3300005338 Bacteria 1208
19 Ga0068868_100950555 3300005338 Bacteria 784
20 Ga0070660_100006432 3300005339 Bacteria 8144
21 Ga0070661_100362030 3300005344 Bacteria 1140
22 Ga0070692_10011489 3300005345 Bacteria 4067
23 Ga0070675_100293143 3300005354 Bacteria 1432
24 Ga0070675_100682156 3300005354 Bacteria 935
25 Ga0070671_100445558 3300005355 Bacteria 1111
26 Ga0070674_100351203 3300005356 Bacteria 1191
27 Ga0070673_100590550 3300005364 Bacteria 1012
28 Ga0070688_100884111 3300005365 Bacteria 704
29 Ga0070659_100008842 3300005366 Bacteria 7379
30 Ga0070659_100194944 3300005366 Bacteria 1666
31 Ga0070700_100503550 3300005441 Bacteria 932
32 Ga0070663_101111954 3300005455 Bacteria 691
33 Ga0070663_102096213 3300005455 Bacteria 510
34 Ga0070678_100141324 3300005456 Bacteria 1927
35 Ga0070678_100341499 3300005456 Bacteria 1285
36 Ga0070662_100121459 3300005457 Bacteria 2003
37 Ga0070681_10914551 3300005458 Bacteria 796
38 Ga0070679_100002540 3300005530 Bacteria 16527
39 Ga0070679_100024993 3300005530 Bacteria 5856
40 Ga0070679_101748133 3300005530 Bacteria 570
41 Ga0070684_100009425 3300005535 Bacteria 7688
42 Ga0070684_100098337 3300005535 Bacteria 2611
43 Ga0070684_100107920 3300005535 Bacteria 2494
44 Ga0070684_100145655 3300005535 Bacteria 2144
45 Ga0068853_100441432 3300005539 Bacteria 1223
46 Ga0070686_100016684 3300005544 Bacteria 4276
47 Ga0070665_100002545 3300005548 Bacteria 20031
48 Ga0070665_100161966 3300005548 Bacteria 2239
49 Ga0068855_100111197 3300005563 Bacteria 3145
50 Ga0068855_100928409 3300005563 Bacteria 918
51 Ga0070664_100044492 3300005564 Bacteria 3749
52 Ga0070664_100066602 3300005564 Bacteria 3076
53 Ga0070664_101184071 3300005564 Bacteria 721
54 Ga0068857_100209348 3300005577 Bacteria 1779
55 Ga0068857_101038390 3300005577 Bacteria 790
56 Ga0068856_100085755 3300005614 Bacteria 3129
57 Ga0068856_100628223 3300005614 Bacteria 1095
58 Ga0070702_100005930 3300005615 Bacteria 5741
59 Ga0070702_100633842 3300005615 Bacteria 806
60 Ga0068852_100911922 3300005616 Bacteria 896
61 Ga0068864_100039276 3300005618 Bacteria 4045
62 Ga0068864_101588247 3300005618 Bacteria 658
63 Ga0068861_100746640 3300005719 Bacteria 914
64 Ga0068861_101459221 3300005719 Bacteria 670
65 Ga0068870_10106158 3300005840 Bacteria 1596
66 Ga0068870_10724602 3300005840 Bacteria 688
67 Ga0068858_100260542 3300005842 Bacteria 1648
68 Ga0068860_101509020 3300005843 Bacteria 694
69 Ga0068862_101972410 3300005844 Bacteria 594
70 Ga0081455_10645322 3300005937 Bacteria 683
71 Ga0075365_10287501 3300006038 Bacteria 1157
72 Ga0075363_100005751 3300006048 Bacteria 5561
73 Ga0075363_100005935 3300006048 Bacteria 5505
74 Ga0075364_10048341 3300006051 Bacteria 2772
75 Ga0075367_10014956 3300006178 Bacteria 4206
76 Ga0075367_10017245 3300006178 Bacteria 3960
77 Ga0097621_101416461 3300006237 Bacteria 658
78 Ga0075370_10126642 3300006353 Bacteria 1489
79 Ga0068871_100109906 3300006358 Bacteria 2318
80 Ga0068865_100107368 3300006881 Bacteria 2053
81 Ga0068865_100218121 3300006881 Bacteria 1490
82 Ga0068865_100511486 3300006881 Bacteria 1003
83 Ga0068865_100548689 3300006881 Bacteria 970
84 Ga0105245_10117856 3300009098 Bacteria 2477
85 Ga0105245_10169917 3300009098 Bacteria 2076
86 Ga0105245_11133985 3300009098 Bacteria 829
87 Ga0105245_11150685 3300009098 Bacteria 823
88 Ga0105245_12219770 3300009098 Bacteria 603
89 Ga0105247_10754545 3300009101 Bacteria 738
90 Ga0105243_10122806 3300009148 Bacteria 2192
91 Ga0105243_10195669 3300009148 Bacteria 1769
92 Ga0105243_12381855 3300009148 Bacteria 568
93 Ga0105242_10137416 3300009176 Bacteria 2117
94 Ga0105242_10346511 3300009176 Bacteria 1371
95 Ga0105248_10502748 3300009177 Bacteria 1366
96 Ga0105237_10138838 3300009545 Bacteria 2425
97 Ga0105237_10891615 3300009545 Bacteria 896
98 Ga0105238_11188281 3300009551 Bacteria 787
99 Ga0105249_10139771 3300009553 Bacteria 2321
100 Ga0105249_10232068 3300009553 Bacteria 1820
101 Ga0105249_10753921 3300009553 Bacteria 1036
102 Ga0105239_10002025 3300010375 Bacteria 26305
103 Ga0105239_10111337 3300010375 Bacteria 3035
104 Ga0105246_10002027 3300011119 Bacteria 12231
105 Ga0105246_11749392 3300011119 Bacteria 592
106 Ga0157369_10103080 3300013105 Bacteria 3039
107 Ga0157369_10264133 3300013105 Bacteria 1795
108 Ga0157374_11477672 3300013296 Bacteria 703
109 Ga0163162_11279880 3300013306 Bacteria 833
110 Ga0163162_11288900 3300013306 Bacteria 830
111 Ga0157372_10024534 3300013307 Bacteria 6553
112 Ga0157372_10940630 3300013307 Bacteria 1002
113 Ga0157372_10940734 3300013307 Bacteria 1002
114 Ga0157372_12553513 3300013307 Bacteria 586
115 Ga0157375_10024427 3300013308 Bacteria 5594
116 Ga0157375_10204942 3300013308 Bacteria 2129
117 Ga0157375_10211839 3300013308 Bacteria 2095
118 Ga0157375_10784211 3300013308 Bacteria 1102
119 Ga0157375_12024930 3300013308 Bacteria 685
120 Ga0157375_12062851 3300013308 Bacteria 678
121 Ga0163163_10077405 3300014325 Bacteria 3321
122 Ga0163163_10190022 3300014325 Bacteria 2102
123 Ga0163163_10698778 3300014325 Bacteria 1078
124 Ga0163163_10724666 3300014325 Bacteria 1058
125 Ga0157380_10549829 3300014326 Bacteria 1132
126 Ga0157380_10758883 3300014326 Bacteria 982
127 Ga0157380_11047228 3300014326 Bacteria 852
128 Ga0157380_11070734 3300014326 Bacteria 844
129 Ga0157377_10117103 3300014745 Bacteria 1610
130 Ga0157379_10015975 3300014968 Bacteria 6599
131 Ga0157379_11206391 3300014968 Bacteria 728
132 Ga0157376_10417907 3300014969 Bacteria 1300
133 Ga0163161_10045557 3300017792 Bacteria 3163
134 Ga0206353_10002821 3300020082 Bacteria 1700
135 Ga0206353_10742086 3300020082 Bacteria 539
136 Ga0206353_11267894 3300020082 Bacteria 597
137 Ga0207647_10005730 3300025904 Bacteria 9072
138 Ga0207647_10121871 3300025904 Bacteria 1537
139 Ga0207643_10497408 3300025908 Bacteria 779
140 Ga0207705_10001869 3300025909 Bacteria 16529
141 Ga0207705_10051684 3300025909 Bacteria 2958
142 Ga0207705_10257369 3300025909 Bacteria 1332
143 Ga0207707_10124953 3300025912 Bacteria 2250
144 Ga0207707_10627345 3300025912 Bacteria 908
145 Ga0207707_10852900 3300025912 Bacteria 756
146 Ga0207671_10172254 3300025914 Bacteria 1681
147 Ga0207671_10539334 3300025914 Bacteria 930
148 Ga0207660_10041704 3300025917 Bacteria 3217
149 Ga0207657_10022839 3300025919 Bacteria 5839
150 Ga0207657_10336628 3300025919 Bacteria 1191
151 Ga0207649_10433257 3300025920 Bacteria 989
152 Ga0207652_10230243 3300025921 Bacteria 1670
153 Ga0207652_10271487 3300025921 Bacteria 1530
154 Ga0207694_10721134 3300025924 Bacteria 841
155 Ga0207687_10129073 3300025927 Bacteria 1902
156 Ga0207687_10209585 3300025927 Bacteria 1528
157 Ga0207687_10628891 3300025927 Bacteria 907
158 Ga0207687_10785331 3300025927 Bacteria 812
159 Ga0207690_10010872 3300025932 Bacteria 5423
160 Ga0207690_10157727 3300025932 Bacteria 1689
161 Ga0207709_10143339 3300025935 Bacteria 1645
162 Ga0207669_10085476 3300025937 Bacteria 2037
163 Ga0207704_10162817 3300025938 Bacteria 1590
164 Ga0207704_10208795 3300025938 Bacteria 1435
165 Ga0207704_10255332 3300025938 Bacteria 1319
166 Ga0207704_10488029 3300025938 Bacteria 990
167 Ga0207704_11075164 3300025938 Bacteria 683
168 Ga0207691_10114085 3300025940 Bacteria 2401
169 Ga0207661_10005811 3300025944 Bacteria 8700
170 Ga0207661_10037258 3300025944 Bacteria 3802
171 Ga0207661_10748146 3300025944 Bacteria 900
172 Ga0207661_12030338 3300025944 Bacteria 521
173 Ga0207679_10011518 3300025945 Bacteria 5732
174 Ga0207679_10060223 3300025945 Bacteria 2820
175 Ga0207667_10115383 3300025949 Bacteria 2768
176 Ga0207712_10029851 3300025961 Bacteria 3661
177 Ga0207712_10375776 3300025961 Bacteria 1188
178 Ga0207658_10347915 3300025986 Bacteria 1290
179 Ga0207677_10029539 3300026023 Bacteria 3485
180 Ga0207703_10045125 3300026035 Bacteria 3544
181 Ga0207703_12230728 3300026035 Bacteria 523
182 Ga0207639_10317643 3300026041 Bacteria 1382
183 Ga0207639_10738226 3300026041 Bacteria 915
184 Ga0207678_10539580 3300026067 Bacteria 1019
185 Ga0207678_10552987 3300026067 Bacteria 1007
186 Ga0207702_10041635 3300026078 Bacteria 3852
187 Ga0207702_10530992 3300026078 Bacteria 1149
188 Ga0207702_10828394 3300026078 Bacteria 915
189 Ga0207648_10456766 3300026089 Bacteria 1164
190 Ga0207676_10032931 3300026095 Bacteria 3912
191 Ga0207674_10019821 3300026116 Bacteria 7278
192 Ga0207674_10812240 3300026116 Bacteria 902
193 Ga0207674_12034666 3300026116 Bacteria 539
194 Ga0207675_100768023 3300026118 Bacteria 976
195 Ga0207683_10087677 3300026121 Bacteria 2768
196 Ga0209813_10066398 3300027866 Bacteria 1164
197 Ga0268266_10002970 3300028379 Bacteria 17485
198 Ga0268266_10578693 3300028379 Bacteria 1077
199 Ga0268266_11111279 3300028379 Bacteria 765
200 Ga0268266_12028107 3300028379 Bacteria 549
201 Ga0268264_10210187 3300028381 Bacteria 1786
202 Ga0316181_1086649 3300030744 Bacteria 684
203 Ga0307413_10422724 3300031824 Bacteria 1050
204 Ga0307409_100091889 3300031995 Bacteria 2489
205 Ga0307414_10541834 3300032004 Bacteria 1036
206 Ga0395905_0124808 3300037471 Bacteria 2420
207 Ga0436365_0990663 3300039437 Bacteria 604
208 Ga0451791_0186682 3300041451 Bacteria 610
209 Ga0451800_0359755 3300041459 Bacteria 576
210 Ga0451802_1423651 3300041460 Bacteria 817
211 Ga0451802_1582089 3300041460 Bacteria 1197
212 Ga0451837_1211387 3300041494 Bacteria 683
213 Ga0451843_0828515 3300041509 Bacteria 780
214 Ga0439464_0020884 3300042439 Bacteria 1795
215 Ga0466972_0216863 3300044658 Bacteria 895
216 Ga0466965_0517565 3300044683 Bacteria 671
217 Ga0466963_0115547 3300044694 Bacteria 1844
218 Ga0466963_0192397 3300044694 Bacteria 1425
219 Ga0466963_0207710 3300044694 Bacteria 1370
220 Ga0466963_0298810 3300044694 Bacteria 1132
221 Ga0466963_0386862 3300044694 Bacteria 986
222 Ga0466957_1045724 3300044842 Bacteria 587
223 Ga0466960_0027860 3300044901 Bacteria 2581
224 Ga0466960_0180268 3300044901 Bacteria 1144
225 Ga0466960_1010904 3300044901 Bacteria 511
226 Ga0451576_0063456 3300045051 Bacteria 3851
227 Ga0466967_0207918 3300045976 Bacteria 1855
228 Ga0466967_0247676 3300045976 Bacteria 1701
229 Ga0495641_0133302 3300046461 Bacteria 1109
230 Ga0495641_0175957 3300046461 Bacteria 958
231 Ga0495667_0974358 3300046559 Bacteria 518
232 Ga0495658_0830652 3300046683 Bacteria 591
233 Ga0495593_0722346 3300047673 Bacteria 500
234 Ga0495614_0290281 3300048089 Bacteria 754
235 Ga0496100_0056754 3300048903 Bacteria 2563
236 Ga0496100_0155179 3300048903 Bacteria 1637
237 Ga0496100_0178949 3300048903 Bacteria 1533
238 Ga0496100_0409438 3300048903 Bacteria 1034
239 Ga0496100_0543100 3300048903 Bacteria 899
240 Ga0496101_0341009 3300048904 Bacteria 1177
241 Ga0496101_0369890 3300048904 Bacteria 1127
242 Ga0496101_0915630 3300048904 Bacteria 690
243 Ga0496102_0005854 3300048905 Bacteria 10462
244 Ga0496102_0157856 3300048905 Bacteria 2133
245 Ga0496102_0344346 3300048905 Bacteria 1403
246 Ga0496102_0502342 3300048905 Bacteria 1135
247 Ga0496103_0155377 3300048906 Bacteria 1466
248 Ga0496103_0168926 3300048906 Bacteria 1404
249 Ga0496104_0013470 3300048907 Bacteria 7368
250 Ga0496105_0008229 3300048908 Bacteria 8106
251 Ga0496105_0274474 3300048908 Bacteria 1361
252 Ga0496106_0282641 3300048909 Bacteria 1329
253 Ga0496106_0287797 3300048909 Bacteria 1317
254 Ga0496106_0748059 3300048909 Bacteria 777
255 Ga0496106_0842424 3300048909 Bacteria 726
256 Ga0496106_0870091 3300048909 Bacteria 713
257 Ga0496107_0091470 3300048910 Bacteria 2224
258 Ga0496107_0278050 3300048910 Bacteria 1246
259 Ga0496107_0420508 3300048910 Bacteria 994
260 Ga0496107_0996650 3300048910 Bacteria 608
261 Ga0496108_0014125 3300048911 Bacteria 6514
262 Ga0496108_0017298 3300048911 Bacteria 5897
263 Ga0496108_0344390 3300048911 Bacteria 1300
264 Ga0496108_0801906 3300048911 Bacteria 812
265 Ga0496108_1459668 3300048911 Bacteria 570
266 Ga0496108_1472110 3300048911 Bacteria 567
267 Ga0496108_1502219 3300048911 Bacteria 560
268 Ga0496109_0009588 3300048912 Bacteria 8257
269 Ga0496109_0012479 3300048912 Bacteria 7336
270 Ga0496109_0015755 3300048912 Bacteria 6598
271 Ga0496109_0174904 3300048912 Bacteria 2015
272 Ga0496109_0261067 3300048912 Bacteria 1631
273 Ga0496109_0390403 3300048912 Bacteria 1315
274 Ga0496109_0411336 3300048912 Bacteria 1278
275 Ga0496109_1077550 3300048912 Bacteria 741
276 Ga0496110_0019050 3300048913 Bacteria 5768
277 Ga0496110_0057576 3300048913 Bacteria 3422
278 Ga0496110_0191575 3300048913 Bacteria 1857
279 Ga0496110_0353588 3300048913 Bacteria 1338
280 Ga0496110_0408636 3300048913 Bacteria 1237
281 Ga0496110_1235178 3300048913 Bacteria 656
282 Ga0496111_0010639 3300048914 Bacteria 6183
283 Ga0496111_0095608 3300048914 Bacteria 2180
284 Ga0496111_0188970 3300048914 Bacteria 1531
285 Ga0496111_0213017 3300048914 Bacteria 1435
286 Ga0496111_0322780 3300048914 Bacteria 1143
287 Ga0496111_1097947 3300048914 Bacteria 567
288 Ga0496111_1155691 3300048914 Bacteria 550
289 Ga0496112_0178412 3300048915 Bacteria 2088
290 Ga0496113_0260518 3300048916 Bacteria 1385
291 Ga0496113_0781908 3300048916 Bacteria 759
292 Ga0496113_1283478 3300048916 Bacteria 570
293 Ga0496114_0003247 3300048917 Bacteria 12485
294 Ga0496114_0004439 3300048917 Bacteria 10886
295 Ga0496114_0167942 3300048917 Bacteria 1911
296 Ga0496114_0408688 3300048917 Bacteria 1202
297 Ga0496114_0499611 3300048917 Bacteria 1076
298 Ga0496114_0573859 3300048917 Bacteria 996
299 Ga0496114_1293360 3300048917 Bacteria 616
300 Ga0496114_1416215 3300048917 Bacteria 582
301 Ga0496115_0041968 3300048918 Bacteria 3643
302 Ga0496115_0233755 3300048918 Bacteria 1515
303 Ga0501031_0528427 3300049568 Bacteria 760
304 Ga0501032_0320624 3300049569 Bacteria 1000
305 Ga0501032_0653897 3300049569 Bacteria 667
306 Ga0501033_1029083 3300049570 Bacteria 550
307 Ga0501034_0008227 3300049571 Bacteria 11042
308 Ga0501034_0012251 3300049571 Bacteria 8861
309 Ga0501034_0015160 3300049571 Bacteria 7922
310 Ga0501036_0001712 3300049572 Bacteria 17046
311 Ga0501036_0121061 3300049572 Bacteria 2210
312 Ga0501036_0476529 3300049572 Bacteria 1039
313 Ga0501037_0043968 3300049573 Bacteria 3282
314 Ga0501037_0097118 3300049573 Bacteria 2129
315 Ga0501038_0034755 3300049574 Bacteria 4429
316 Ga0501038_0371234 3300049574 Bacteria 1111
317 Ga0501038_0591608 3300049574 Bacteria 840
318 Ga0501038_0930268 3300049574 Bacteria 641
319 Ga0501039_0035128 3300049575 Bacteria 3868
320 Ga0501040_0320134 3300049576 Bacteria 1109
321 Ga0501041_0062321 3300049577 Bacteria 2283
322 Ga0501042_0116041 3300049578 Bacteria 1928
323 Ga0501042_0757525 3300049578 Bacteria 706
324 Ga0501042_0947125 3300049578 Bacteria 627
325 Ga0501043_0211304 3300049579 Bacteria 1504
326 Ga0501043_0880573 3300049579 Bacteria 643
327 Ga0501046_0019475 3300049580 Bacteria 5630
328 Ga0501046_1141558 3300049580 Bacteria 537
329 Ga0501047_0075619 3300049581 Bacteria 3241
330 Ga0501047_0250478 3300049581 Bacteria 1620
331 Ga0501048_0168686 3300049582 Bacteria 1550
332 Ga0501067_0001411 3300049583 Bacteria 13021
333 Ga0501067_0001806 3300049583 Bacteria 11762
334 Ga0501067_0387249 3300049583 Bacteria 779
335 Ga0501068_0005663 3300049584 Bacteria 6841
336 Ga0501068_0135751 3300049584 Bacteria 1540
337 Ga0501068_0312785 3300049584 Bacteria 1006
338 Ga0501068_0695807 3300049584 Bacteria 665
339 Ga0501069_0016745 3300049585 Bacteria 3939
340 Ga0501069_0099032 3300049585 Bacteria 1654
341 Ga0501069_0147244 3300049585 Bacteria 1352
342 Ga0501069_0480567 3300049585 Bacteria 740
343 Ga0501070_0013660 3300049586 Bacteria 6840
344 Ga0501070_0019839 3300049586 Bacteria 5637
345 Ga0501070_0449673 3300049586 Bacteria 1039
346 Ga0501071_0167697 3300049587 Bacteria 1643
347 Ga0501071_0201836 3300049587 Bacteria 1494
348 Ga0501071_0422998 3300049587 Bacteria 1018
349 Ga0501072_0004730 3300049588 Bacteria 10371
350 Ga0501072_0131380 3300049588 Bacteria 1996
351 Ga0501072_1608933 3300049588 Bacteria 501
352 Ga0501073_0005112 3300049589 Bacteria 9840
353 Ga0501073_0009486 3300049589 Bacteria 7186
354 Ga0501073_0138662 3300049589 Bacteria 1685
355 Ga0501073_0452703 3300049589 Bacteria 887
356 Ga0501074_0001606 3300049590 Bacteria 15339
357 Ga0501074_0007820 3300049590 Bacteria 7741
358 Ga0501074_0310621 3300049590 Bacteria 1120
359 Ga0501076_0140062 3300049592 Bacteria 1965
360 Ga0501076_1181755 3300049592 Bacteria 630
361 Ga0501077_0005767 3300049593 Bacteria 7544
362 Ga0501079_0028381 3300049741 Bacteria 4294
363 Ga0501079_0032256 3300049741 Bacteria 4027
364 Ga0501079_0309472 3300049741 Bacteria 1236
365 Ga0501079_0543989 3300049741 Bacteria 913
366 Ga0501080_0007227 3300049742 Bacteria 10024
367 Ga0501080_0062065 3300049742 Bacteria 3478
368 Ga0501080_0128341 3300049742 Bacteria 2348
369 Ga0501081_0416458 3300049743 Bacteria 996
370 Ga0501083_0022488 3300049744 Bacteria 4374
371 Ga0501083_0075346 3300049744 Bacteria 2241
372 Ga0501035_0106987 3300049822 Bacteria 2451
373 Ga0501044_0578003 3300049823 Bacteria 1018
374 nmdc:mga03n38_35880_c1 3300050490 Bacteria 2128
375 nmdc:mga03n38_427510_c1 3300050490 Bacteria 733
376 nmdc:mga06z11_33401_c1 3300050494 Bacteria 2517
377 Ga0495655_0190329 3300053083 Bacteria 666
378 Ga0495619_0173466 3300053085 Bacteria 1491
379 Ga0495619_0842220 3300053085 Bacteria 619
380 Ga0501084_0004027 3300054114 Bacteria 11967
381 Ga0501082_0015832 3300060353 Bacteria 6485
382 Ga0501082_0284978 3300060353 Bacteria 1438
383 Ga0501082_0771383 3300060353 Bacteria 841
384 Ga0530510_1268279 3300061734 Bacteria 565
385 Ga0530510_1283283 3300061734 Bacteria 562
386 2644091844 2643221615 Bacteria 5487866
387 2644321647 2643221657 Bacteria 5490246
388 2740167350 2739367898 Bacteria 4367674
389 Ga0466967_0062748
390 JGI24740J21852_10019979
391 JGI24737J22298_10047599
392 JGI24735J21928_10031514
393 Ga0070658_10001484
394 Ga0070658_10021164
395 Ga0070658_10137548
396 Ga0070683_100000230
397 Ga0070683_100009013
398 Ga0070683_100231239
399 Ga0070683_100448785
400 Ga0070690_100674745
401 Ga0070677_10425977
402 Ga0070680_100039806
403 Ga0070682_100086758
404 Ga0070682_100385374
405 Ga0068868_100045429
406 Ga0068868_100384706
407 Ga0068868_100950555
408 Ga0070660_100006432
409 Ga0070661_100362030
410 Ga0070692_10011489
411 Ga0070675_100293143
412 Ga0070675_100682156
413 Ga0070671_100445558
414 Ga0070674_100351203
415 Ga0070673_100590550
416 Ga0070688_100884111
417 Ga0070659_100008842
418 Ga0070659_100194944
419 Ga0070700_100503550
420 Ga0070663_101111954
421 Ga0070663_102096213
422 Ga0070678_100141324
423 Ga0070678_100341499
424 Ga0070662_100121459
425 Ga0070681_10914551
426 Ga0070679_100002540
427 Ga0070679_100024993
428 Ga0070679_101748133
429 Ga0070684_100009425
430 Ga0070684_100098337
431 Ga0070684_100107920
432 Ga0070684_100145655
433 Ga0068853_100441432
434 Ga0070686_100016684
435 Ga0070665_100002545
436 Ga0070665_100161966
437 Ga0068855_100111197
438 Ga0068855_100928409
439 Ga0070664_100044492
440 Ga0070664_100066602
441 Ga0070664_101184071
442 Ga0068857_100209348
443 Ga0068857_101038390
444 Ga0068856_100085755
445 Ga0068856_100628223
446 Ga0070702_100005930
447 Ga0070702_100633842
448 Ga0068852_100911922
449 Ga0068864_100039276
450 Ga0068864_101588247
451 Ga0068861_100746640
452 Ga0068861_101459221
453 Ga0068870_10106158
454 Ga0068870_10724602
455 Ga0068858_100260542
456 Ga0068860_101509020
457 Ga0068862_101972410
458 Ga0081455_10645322
459 Ga0075365_10287501
460 Ga0075363_100005751
461 Ga0075363_100005935
462 Ga0075364_10048341
463 Ga0075367_10014956
464 Ga0075367_10017245
465 Ga0097621_101416461
466 Ga0075370_10126642
467 Ga0068871_100109906
468 Ga0068865_100107368
469 Ga0068865_100218121
470 Ga0068865_100511486
471 Ga0068865_100548689
472 Ga0105245_10117856
473 Ga0105245_10169917
474 Ga0105245_11133985
475 Ga0105245_11150685
476 Ga0105245_12219770
477 Ga0105247_10754545
478 Ga0105243_10122806
479 Ga0105243_10195669
480 Ga0105243_12381855
481 Ga0105242_10137416
482 Ga0105242_10346511
483 Ga0105248_10502748
484 Ga0105237_10138838
485 Ga0105237_10891615
486 Ga0105238_11188281
487 Ga0105249_10139771
488 Ga0105249_10232068
489 Ga0105249_10753921
490 Ga0105239_10002025
491 Ga0105239_10111337
492 Ga0105246_10002027
493 Ga0105246_11749392
494 Ga0157369_10103080
495 Ga0157369_10264133
496 Ga0157374_11477672
497 Ga0163162_11279880
498 Ga0163162_11288900
499 Ga0157372_10024534
500 Ga0157372_10940630
501 Ga0157372_10940734
502 Ga0157372_12553513
503 Ga0157375_10024427
504 Ga0157375_10204942
505 Ga0157375_10211839
506 Ga0157375_10784211
507 Ga0157375_12024930
508 Ga0157375_12062851
509 Ga0163163_10077405
510 Ga0163163_10190022
511 Ga0163163_10698778
512 Ga0163163_10724666
513 Ga0157380_10549829
514 Ga0157380_10758883
515 Ga0157380_11047228
516 Ga0157380_11070734
517 Ga0157377_10117103
518 Ga0157379_10015975
519 Ga0157379_11206391
520 Ga0157376_10417907
521 Ga0163161_10045557
522 Ga0206353_10002821
523 Ga0206353_10742086
524 Ga0206353_11267894
525 Ga0207647_10005730
526 Ga0207647_10121871
527 Ga0207643_10497408
528 Ga0207705_10001869
529 Ga0207705_10051684
530 Ga0207705_10257369
531 Ga0207707_10124953
532 Ga0207707_10627345
533 Ga0207707_10852900
534 Ga0207671_10172254
535 Ga0207671_10539334
536 Ga0207660_10041704
537 Ga0207657_10022839
538 Ga0207657_10336628
539 Ga0207649_10433257
540 Ga0207652_10230243
541 Ga0207652_10271487
542 Ga0207694_10721134
543 Ga0207687_10129073
544 Ga0207687_10209585
545 Ga0207687_10628891
546 Ga0207687_10785331
547 Ga0207690_10010872
548 Ga0207690_10157727
549 Ga0207709_10143339
550 Ga0207669_10085476
551 Ga0207704_10162817
552 Ga0207704_10208795
553 Ga0207704_10255332
554 Ga0207704_10488029
555 Ga0207704_11075164
556 Ga0207691_10114085
557 Ga0207661_10005811
558 Ga0207661_10037258
559 Ga0207661_10748146
560 Ga0207661_12030338
561 Ga0207679_10011518
562 Ga0207679_10060223
563 Ga0207667_10115383
564 Ga0207712_10029851
565 Ga0207712_10375776
566 Ga0207658_10347915
567 Ga0207677_10029539
568 Ga0207703_10045125
569 Ga0207703_12230728
570 Ga0207639_10317643
571 Ga0207639_10738226
572 Ga0207678_10539580
573 Ga0207678_10552987
574 Ga0207702_10041635
575 Ga0207702_10530992
576 Ga0207702_10828394
577 Ga0207648_10456766
578 Ga0207676_10032931
579 Ga0207674_10019821
580 Ga0207674_10812240
581 Ga0207674_12034666
582 Ga0207675_100768023
583 Ga0207683_10087677
584 Ga0209813_10066398
585 Ga0268266_10002970
586 Ga0268266_10578693
587 Ga0268266_11111279
588 Ga0268266_12028107
589 Ga0268264_10210187
590 Ga0316181_1086649
591 Ga0307413_10422724
592 Ga0307409_100091889
593 Ga0307414_10541834
594 Ga0395905_0124808
595 Ga0436365_0990663
596 Ga0451791_0186682
597 Ga0451800_0359755
598 Ga0451802_1423651
599 Ga0451802_1582089
600 Ga0451837_1211387
601 Ga0451843_0828515
602 Ga0439464_0020884
603 Ga0466972_0216863
604 Ga0466965_0517565
605 Ga0466963_0115547
606 Ga0466963_0192397
607 Ga0466963_0207710
608 Ga0466963_0298810
609 Ga0466963_0386862
610 Ga0466957_1045724
611 Ga0466960_0027860
612 Ga0466960_0180268
613 Ga0466960_1010904
614 Ga0451576_0063456
615 Ga0466967_0207918
616 Ga0466967_0247676
617 Ga0495641_0133302
618 Ga0495641_0175957
619 Ga0495667_0974358
620 Ga0495658_0830652
621 Ga0495593_0722346
622 Ga0495614_0290281
623 Ga0496100_0056754
624 Ga0496100_0155179
625 Ga0496100_0178949
626 Ga0496100_0409438
627 Ga0496100_0543100
628 Ga0496101_0341009
629 Ga0496101_0369890
630 Ga0496101_0915630
631 Ga0496102_0005854
632 Ga0496102_0157856
633 Ga0496102_0344346
634 Ga0496102_0502342
635 Ga0496103_0155377
636 Ga0496103_0168926
637 Ga0496104_0013470
638 Ga0496105_0008229
639 Ga0496105_0274474
640 Ga0496106_0282641
641 Ga0496106_0287797
642 Ga0496106_0748059
643 Ga0496106_0842424
644 Ga0496106_0870091
645 Ga0496107_0091470
646 Ga0496107_0278050
647 Ga0496107_0420508
648 Ga0496107_0996650
649 Ga0496108_0014125
650 Ga0496108_0017298
651 Ga0496108_0344390
652 Ga0496108_0801906
653 Ga0496108_1459668
654 Ga0496108_1472110
655 Ga0496108_1502219
656 Ga0496109_0009588
657 Ga0496109_0012479
658 Ga0496109_0015755
659 Ga0496109_0174904
660 Ga0496109_0261067
661 Ga0496109_0390403
662 Ga0496109_0411336
663 Ga0496109_1077550
664 Ga0496110_0019050
665 Ga0496110_0057576
666 Ga0496110_0191575
667 Ga0496110_0353588
668 Ga0496110_0408636
669 Ga0496110_1235178
670 Ga0496111_0010639
671 Ga0496111_0095608
672 Ga0496111_0188970
673 Ga0496111_0213017
674 Ga0496111_0322780
675 Ga0496111_1097947
676 Ga0496111_1155691
677 Ga0496112_0178412
678 Ga0496113_0260518
679 Ga0496113_0781908
680 Ga0496113_1283478
681 Ga0496114_0003247
682 Ga0496114_0004439
683 Ga0496114_0167942
684 Ga0496114_0408688
685 Ga0496114_0499611
686 Ga0496114_0573859
687 Ga0496114_1293360
688 Ga0496114_1416215
689 Ga0496115_0041968
690 Ga0496115_0233755
691 Ga0501031_0528427
692 Ga0501032_0320624
693 Ga0501032_0653897
694 Ga0501033_1029083
695 Ga0501034_0008227
696 Ga0501034_0012251
697 Ga0501034_0015160
698 Ga0501036_0001712
699 Ga0501036_0121061
700 Ga0501036_0476529
701 Ga0501037_0043968
702 Ga0501037_0097118
703 Ga0501038_0034755
704 Ga0501038_0371234
705 Ga0501038_0591608
706 Ga0501038_0930268
707 Ga0501039_0035128
708 Ga0501040_0320134
709 Ga0501041_0062321
710 Ga0501042_0116041
711 Ga0501042_0757525
712 Ga0501042_0947125
713 Ga0501043_0211304
714 Ga0501043_0880573
715 Ga0501046_0019475
716 Ga0501046_1141558
717 Ga0501047_0075619
718 Ga0501047_0250478
719 Ga0501048_0168686
720 Ga0501067_0001411
721 Ga0501067_0001806
722 Ga0501067_0387249
723 Ga0501068_0005663
724 Ga0501068_0135751
725 Ga0501068_0312785
726 Ga0501068_0695807
727 Ga0501069_0016745
728 Ga0501069_0099032
729 Ga0501069_0147244
730 Ga0501069_0480567
731 Ga0501070_0013660
732 Ga0501070_0019839
733 Ga0501070_0449673
734 Ga0501071_0167697
735 Ga0501071_0201836
736 Ga0501071_0422998
737 Ga0501072_0004730
738 Ga0501072_0131380
739 Ga0501072_1608933
740 Ga0501073_0005112
741 Ga0501073_0009486
742 Ga0501073_0138662
743 Ga0501073_0452703
744 Ga0501074_0001606
745 Ga0501074_0007820
746 Ga0501074_0310621
747 Ga0501076_0140062
748 Ga0501076_1181755
749 Ga0501077_0005767
750 Ga0501079_0028381
751 Ga0501079_0032256
752 Ga0501079_0309472
753 Ga0501079_0543989
754 Ga0501080_0007227
755 Ga0501080_0062065
756 Ga0501080_0128341
757 Ga0501081_0416458
758 Ga0501083_0022488
759 Ga0501083_0075346
760 Ga0501035_0106987
761 Ga0501044_0578003
762 nmdc:mga03n38_35880_c1
763 nmdc:mga03n38_427510_c1
764 nmdc:mga06z11_33401_c1
765 Ga0495655_0190329
766 Ga0495619_0173466
767 Ga0495619_0842220
768 Ga0501084_0004027
769 Ga0501082_0015832
770 Ga0501082_0284978
771 Ga0501082_0771383
772 Ga0530510_1268279
773 Ga0530510_1283283
774 2644091844
775 2644321647
776 2740167350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

26

147

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9258 8 138
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9089 2 138
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9068 5 138
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9041 2 138
3q9u-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9031 2 138
ID Description Score Start End Superfamily
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9089 2 138 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9068 5 138 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.888 5 138 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8767 18 131 3.40.50.720
2duwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.86 11 138 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A494SVP1-F1-model_v4 CoA-binding protein 0.9895 1 138
AF-A0A6L6XWT7-F1-model_v4 CoA-binding protein 0.9863 13 138
AF-A0A5C8BW05-F1-model_v4 CoA-binding protein 0.9842 13 138
AF-A0A347Q7I2-F1-model_v4 deleted 0.9838 8 137
AF-A0A4Q2S5W7-F1-model_v4 CoA-binding protein 0.9837 13 140

Map