F431202

General Info

Members Datasets Scaffolds Average Seq Length
388 82 388 177

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0005651|Ga0466963_0005651_565_1104
Length 179
Sequence VAVADVLLGYIGEFPTPERLLAATNQARSDGFNCIDAFSPFPVEGMAEALSLKRDHRVGWITIAGGLFGILGMLAIQLFVNWDYPIEVGGRPLFAWPAFAVVDFELMILCAVLFAVVGMLVIIRLPKLYHPIFSTPRFGLASEDRFFLYIDHQDPKFDPQQTRAYLGSLGAWTVEPVRP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008316 3300001979 Bacteria 4143
2 JGI24740J21852_10009432 3300001979 Bacteria 3821
3 JGI24740J21852_10027819 3300001979 Bacteria 1876
4 JGI24739J22299_10009852 3300001989 Bacteria 3553
5 JGI24737J22298_10024330 3300001990 Bacteria 1918
6 JGI24735J21928_10003971 3300002067 Bacteria 5003
7 JGI24735J21928_10009779 3300002067 Bacteria 3072
8 JGI24735J21928_10011995 3300002067 Bacteria 2741
9 Ga0070658_10006398 3300005327 Bacteria 9545
10 Ga0070658_10038242 3300005327 Bacteria 3870
11 Ga0070658_10229835 3300005327 Bacteria 1570
12 Ga0070658_10446916 3300005327 Bacteria 1113
13 Ga0070658_10601937 3300005327 Unclassified 953
14 Ga0070658_10843150 3300005327 Unclassified 797
15 Ga0070683_100021193 3300005329 Bacteria 5796
16 Ga0070683_100021741 3300005329 Bacteria 5728
17 Ga0070683_100088445 3300005329 Bacteria 2906
18 Ga0070683_100094195 3300005329 Bacteria 2814
19 Ga0070680_100009168 3300005336 Bacteria 7587
20 Ga0070680_100052604 3300005336 Bacteria 3323
21 Ga0070680_100136860 3300005336 Bacteria 2052
22 Ga0070680_100142463 3300005336 Bacteria 2010
23 Ga0070680_100154012 3300005336 Bacteria 1930
24 Ga0070680_100581824 3300005336 Unclassified 960
25 Ga0070682_100454230 3300005337 Unclassified 982
26 Ga0070660_100001242 3300005339 Bacteria 17319
27 Ga0070660_100066554 3300005339 Bacteria 2805
28 Ga0070660_100078682 3300005339 Bacteria 2585
29 Ga0070660_100461535 3300005339 Bacteria 1054
30 Ga0070660_100466543 3300005339 Bacteria 1048
31 Ga0070660_100675403 3300005339 Bacteria 865
32 Ga0070691_10000792 3300005341 Bacteria 12601
33 Ga0070661_100022514 3300005344 Bacteria 4512
34 Ga0070661_100057779 3300005344 Bacteria 2842
35 Ga0070661_100140225 3300005344 Bacteria 1821
36 Ga0070692_10022876 3300005345 Bacteria 3058
37 Ga0070692_10087696 3300005345 Bacteria 1686
38 Ga0070692_10092778 3300005345 Bacteria 1643
39 Ga0070692_10163395 3300005345 Bacteria 1277
40 Ga0070692_10267949 3300005345 Bacteria 1030
41 Ga0070659_100004047 3300005366 Bacteria 10447
42 Ga0070659_100204703 3300005366 Bacteria 1625
43 Ga0070659_100223273 3300005366 Bacteria 1556
44 Ga0070659_100732760 3300005366 Unclassified 856
45 Ga0070714_100098648 3300005435 Bacteria 2570
46 Ga0070714_100408520 3300005435 Bacteria 1285
47 Ga0070663_100003073 3300005455 Bacteria 9545
48 Ga0070663_100064379 3300005455 Bacteria 2650
49 Ga0070663_100115543 3300005455 Bacteria 2021
50 Ga0070663_100202590 3300005455 Unclassified 1549
51 Ga0070663_100284634 3300005455 Bacteria 1318
52 Ga0070663_100414703 3300005455 Bacteria 1103
53 Ga0070663_100462645 3300005455 Unclassified 1047
54 Ga0070663_100851654 3300005455 Bacteria 785
55 Ga0070663_101397716 3300005455 Bacteria 620
56 Ga0070662_100074571 3300005457 Bacteria 2510
57 Ga0070662_100298335 3300005457 Bacteria 1308
58 Ga0070681_10082009 3300005458 Bacteria 3180
59 Ga0070681_10477462 3300005458 Bacteria 1159
60 Ga0070679_100008042 3300005530 Bacteria 9909
61 Ga0070679_100095345 3300005530 Bacteria 2963
62 Ga0070679_100127394 3300005530 Bacteria 2527
63 Ga0070679_100287976 3300005530 Bacteria 1594
64 Ga0070679_100405589 3300005530 Bacteria 1309
65 Ga0070679_100548475 3300005530 Bacteria 1100
66 Ga0070679_101162711 3300005530 Bacteria 717
67 Ga0070684_100002935 3300005535 Bacteria 12681
68 Ga0070684_100051853 3300005535 Bacteria 3566
69 Ga0070684_100191871 3300005535 Bacteria 1859
70 Ga0070684_101075874 3300005535 Bacteria 755
71 Ga0068853_100014114 3300005539 Bacteria 6539
72 Ga0068853_100025432 3300005539 Bacteria 4967
73 Ga0068853_100442490 3300005539 Bacteria 1221
74 Ga0068853_100486521 3300005539 Bacteria 1164
75 Ga0070696_100566346 3300005546 Unclassified 912
76 Ga0070693_100022392 3300005547 Bacteria 3359
77 Ga0068855_100008787 3300005563 Bacteria 12209
78 Ga0068855_100439731 3300005563 Bacteria 1424
79 Ga0068855_100575892 3300005563 Unclassified 1216
80 Ga0068855_100639641 3300005563 Unclassified 1143
81 Ga0068855_100718801 3300005563 Bacteria 1067
82 Ga0068855_101036270 3300005563 Bacteria 860
83 Ga0068855_101844818 3300005563 Unclassified 613
84 Ga0070664_100070647 3300005564 Bacteria 2990
85 Ga0070664_100450522 3300005564 Bacteria 1181
86 Ga0068857_100004705 3300005577 Bacteria 11571
87 Ga0068857_100070129 3300005577 Bacteria 3121
88 Ga0068857_100160572 3300005577 Bacteria 2039
89 Ga0068857_100226799 3300005577 Bacteria 1707
90 Ga0068857_100560993 3300005577 Bacteria 1076
91 Ga0068857_101093955 3300005577 Bacteria 769
92 Ga0068854_100022978 3300005578 Bacteria 4255
93 Ga0068854_100026222 3300005578 Bacteria 4003
94 Ga0068854_100068315 3300005578 Unclassified 2591
95 Ga0068854_100428286 3300005578 Bacteria 1100
96 Ga0068854_101388237 3300005578 Unclassified 635
97 Ga0068856_100156595 3300005614 Bacteria 2288
98 Ga0068856_100229801 3300005614 Bacteria 1870
99 Ga0068856_100372247 3300005614 Bacteria 1447
100 Ga0068856_100587850 3300005614 Unclassified 1134
101 Ga0068856_101434399 3300005614 Unclassified 704
102 Ga0068852_100072113 3300005616 Bacteria 3034
103 Ga0068852_100122632 3300005616 Bacteria 2382
104 Ga0068852_100182494 3300005616 Bacteria 1974
105 Ga0068852_100424707 3300005616 Bacteria 1312
106 Ga0068852_100491822 3300005616 Bacteria 1220
107 Ga0068852_100662630 3300005616 Bacteria 1052
108 Ga0068852_100986345 3300005616 Bacteria 861
109 Ga0068852_101735988 3300005616 Bacteria 647
110 Ga0068851_10007120 3300005834 Bacteria 5123
111 Ga0105240_10036173 3300009093 Bacteria 6354
112 Ga0105240_11217201 3300009093 Unclassified 797
113 Ga0105241_10283654 3300009174 Bacteria 1415
114 Ga0105237_10003734 3300009545 Bacteria 17933
115 Ga0105238_10037054 3300009551 Bacteria 4960
116 Ga0105238_10299360 3300009551 Bacteria 1592
117 Ga0105238_10715108 3300009551 Unclassified 1014
118 Ga0157373_10003861 3300013100 Bacteria 11322
119 Ga0157373_10263958 3300013100 Bacteria 1218
120 Ga0157373_10277010 3300013100 Bacteria 1188
121 Ga0157373_10286116 3300013100 Unclassified 1169
122 Ga0157373_10428904 3300013100 Bacteria 950
123 Ga0157373_10475642 3300013100 Unclassified 901
124 Ga0157373_10498865 3300013100 Bacteria 879
125 Ga0157371_10227187 3300013102 Bacteria 1341
126 Ga0157371_10254427 3300013102 Bacteria 1265
127 Ga0157371_10462447 3300013102 Bacteria 934
128 Ga0157371_10716960 3300013102 Bacteria 749
129 Ga0157370_10002480 3300013104 Bacteria 22253
130 Ga0157370_10018585 3300013104 Bacteria 6988
131 Ga0157370_10049972 3300013104 Bacteria 3999
132 Ga0157370_10115599 3300013104 Bacteria 2506
133 Ga0157370_10339753 3300013104 Bacteria 1384
134 Ga0157370_10748173 3300013104 Bacteria 891
135 Ga0157370_11141467 3300013104 Unclassified 704
136 Ga0157369_10141605 3300013105 Bacteria 2544
137 Ga0157369_10150045 3300013105 Bacteria 2463
138 Ga0157369_10163071 3300013105 Bacteria 2352
139 Ga0157369_10224817 3300013105 Bacteria 1964
140 Ga0157369_10262853 3300013105 Bacteria 1800
141 Ga0157369_10945511 3300013105 Bacteria 883
142 Ga0157369_11127250 3300013105 Bacteria 801
143 Ga0157369_11661637 3300013105 Bacteria 649
144 Ga0157369_11739048 3300013105 Bacteria 633
145 Ga0157372_10017788 3300013307 Bacteria 7632
146 Ga0157372_10117443 3300013307 Bacteria 3051
147 Ga0157372_10478545 3300013307 Bacteria 1452
148 Ga0157372_10581993 3300013307 Bacteria 1305
149 Ga0157372_10655641 3300013307 Bacteria 1222
150 Ga0157372_11339377 3300013307 Bacteria 826
151 Ga0206353_10626766 3300020082 Bacteria 2281
152 Ga0207656_10402397 3300025321 Bacteria 688
153 Ga0207647_10002138 3300025904 Bacteria 15110
154 Ga0207647_10016389 3300025904 Bacteria 5058
155 Ga0207647_10136706 3300025904 Bacteria 1438
156 Ga0207705_10002941 3300025909 Bacteria 13022
157 Ga0207705_10025771 3300025909 Bacteria 4195
158 Ga0207705_10031779 3300025909 Bacteria 3770
159 Ga0207705_10035593 3300025909 Bacteria 3562
160 Ga0207705_10037527 3300025909 Bacteria 3467
161 Ga0207705_10053056 3300025909 Bacteria 2920
162 Ga0207705_10053970 3300025909 Bacteria 2896
163 Ga0207705_10076051 3300025909 Bacteria 2440
164 Ga0207705_10107688 3300025909 Bacteria 2056
165 Ga0207705_10147445 3300025909 Bacteria 1761
166 Ga0207705_10168914 3300025909 Bacteria 1646
167 Ga0207654_10111982 3300025911 Bacteria 1700
168 Ga0207707_10073083 3300025912 Bacteria 2990
169 Ga0207707_10268950 3300025912 Bacteria 1477
170 Ga0207695_10004985 3300025913 Bacteria 17867
171 Ga0207695_10575542 3300025913 Unclassified 1008
172 Ga0207671_10028169 3300025914 Bacteria 4199
173 Ga0207660_10002135 3300025917 Bacteria 13124
174 Ga0207660_10006368 3300025917 Bacteria 7649
175 Ga0207660_10066933 3300025917 Bacteria 2600
176 Ga0207660_10071263 3300025917 Bacteria 2528
177 Ga0207660_10481080 3300025917 Bacteria 1006
178 Ga0207657_10000956 3300025919 Bacteria 30551
179 Ga0207657_10003342 3300025919 Bacteria 17151
180 Ga0207657_10012492 3300025919 Bacteria 8381
181 Ga0207657_10045893 3300025919 Bacteria 3830
182 Ga0207657_10050650 3300025919 Bacteria 3614
183 Ga0207657_10079891 3300025919 Bacteria 2751
184 Ga0207657_10142214 3300025919 Bacteria 1960
185 Ga0207657_10143170 3300025919 Bacteria 1952
186 Ga0207657_10398424 3300025919 Bacteria 1083
187 Ga0207649_10008752 3300025920 Bacteria 5526
188 Ga0207649_10036712 3300025920 Bacteria 2954
189 Ga0207649_10205977 3300025920 Bacteria 1392
190 Ga0207652_10001384 3300025921 Bacteria 21584
191 Ga0207652_10010035 3300025921 Bacteria 7626
192 Ga0207652_10076801 3300025921 Bacteria 2913
193 Ga0207652_10163762 3300025921 Bacteria 1994
194 Ga0207652_10524618 3300025921 Bacteria 1065
195 Ga0207652_10672268 3300025921 Bacteria 925
196 Ga0207694_10011916 3300025924 Bacteria 6557
197 Ga0207694_10828621 3300025924 Unclassified 782
198 Ga0207664_10265516 3300025929 Unclassified 1502
199 Ga0207664_10745898 3300025929 Bacteria 880
200 Ga0207664_11094952 3300025929 Bacteria 712
201 Ga0207690_10039076 3300025932 Bacteria 3094
202 Ga0207690_10089739 3300025932 Bacteria 2168
203 Ga0207690_10106353 3300025932 Bacteria 2013
204 Ga0207690_10172817 3300025932 Bacteria 1620
205 Ga0207706_10024756 3300025933 Bacteria 5380
206 Ga0207706_10088437 3300025933 Bacteria 2723
207 Ga0207706_10263058 3300025933 Bacteria 1506
208 Ga0207706_10455616 3300025933 Bacteria 1106
209 Ga0207706_10530146 3300025933 Bacteria 1015
210 Ga0207661_10000577 3300025944 Bacteria 23403
211 Ga0207661_10000853 3300025944 Bacteria 20010
212 Ga0207661_10107530 3300025944 Bacteria 2353
213 Ga0207661_10382191 3300025944 Bacteria 1274
214 Ga0207679_10043897 3300025945 Bacteria 3222
215 Ga0207679_10294399 3300025945 Bacteria 1396
216 Ga0207667_10006230 3300025949 Bacteria 14477
217 Ga0207667_10034165 3300025949 Bacteria 5463
218 Ga0207667_10054640 3300025949 Bacteria 4200
219 Ga0207667_10134965 3300025949 Bacteria 2541
220 Ga0207667_10465865 3300025949 Bacteria 1283
221 Ga0207667_10618183 3300025949 Bacteria 1091
222 Ga0207640_10024244 3300025981 Bacteria 3658
223 Ga0207640_10191114 3300025981 Bacteria 1543
224 Ga0207640_10215844 3300025981 Bacteria 1465
225 Ga0207640_10389932 3300025981 Bacteria 1131
226 Ga0207639_10012178 3300026041 Bacteria 5984
227 Ga0207639_10067659 3300026041 Bacteria 2780
228 Ga0207639_11089589 3300026041 Bacteria 749
229 Ga0207678_10001246 3300026067 Bacteria 23484
230 Ga0207678_10019861 3300026067 Bacteria 5905
231 Ga0207678_10070339 3300026067 Bacteria 3000
232 Ga0207678_10092116 3300026067 Bacteria 2591
233 Ga0207678_10173458 3300026067 Bacteria 1841
234 Ga0207678_10202863 3300026067 Bacteria 1696
235 Ga0207678_10532755 3300026067 Unclassified 1026
236 Ga0207702_10003159 3300026078 Bacteria 15246
237 Ga0207702_10174075 3300026078 Bacteria 1976
238 Ga0207702_10191212 3300026078 Bacteria 1891
239 Ga0207702_10260723 3300026078 Bacteria 1632
240 Ga0207702_10383412 3300026078 Bacteria 1352
241 Ga0207702_10629464 3300026078 Bacteria 1054
242 Ga0207702_11497338 3300026078 Unclassified 668
243 Ga0207674_10001151 3300026116 Bacteria 34261
244 Ga0207674_10010421 3300026116 Bacteria 10532
245 Ga0207674_11148283 3300026116 Bacteria 746
246 Ga0207698_10002850 3300026142 Bacteria 10341
247 Ga0207698_10084747 3300026142 Bacteria 2570
248 Ga0207698_10141730 3300026142 Unclassified 2072
249 Ga0207698_10197990 3300026142 Bacteria 1796
250 Ga0207698_10450820 3300026142 Bacteria 1242
251 Ga0207698_10609416 3300026142 Bacteria 1077
252 Ga0207698_10707801 3300026142 Bacteria 1003
253 Ga0395899_0032125 3300037312 Bacteria 3943
254 Ga0395899_0037672 3300037312 Bacteria 3625
255 Ga0395899_0038527 3300037312 Bacteria 3580
256 Ga0395899_0046562 3300037312 Bacteria 3230
257 Ga0395899_0134836 3300037312 Bacteria 1760
258 Ga0395899_0141342 3300037312 Unclassified 1712
259 Ga0395899_0162375 3300037312 Bacteria 1577
260 Ga0395899_0192557 3300037312 Bacteria 1426
261 Ga0395899_0201820 3300037312 Bacteria 1386
262 Ga0395899_0221774 3300037312 Bacteria 1309
263 Ga0395899_0245837 3300037312 Bacteria 1229
264 Ga0395899_0282561 3300037312 Bacteria 1128
265 Ga0395899_0304556 3300037312 Unclassified 1077
266 Ga0395899_0371458 3300037312 Bacteria 952
267 Ga0395900_0019910 3300037418 Bacteria 6840
268 Ga0395900_0021488 3300037418 Bacteria 6600
269 Ga0395900_0052765 3300037418 Bacteria 4185
270 Ga0395900_0062098 3300037418 Bacteria 3840
271 Ga0395900_0091576 3300037418 Bacteria 3124
272 Ga0395900_0111311 3300037418 Bacteria 2812
273 Ga0395900_0143807 3300037418 Bacteria 2440
274 Ga0395900_0162346 3300037418 Bacteria 2278
275 Ga0395900_0202993 3300037418 Bacteria 2005
276 Ga0395900_0313074 3300037418 Bacteria 1552
277 Ga0395900_0327158 3300037418 Bacteria 1511
278 Ga0395900_0346604 3300037418 Bacteria 1459
279 Ga0395900_0527051 3300037418 Bacteria 1128
280 Ga0395900_0529498 3300037418 Bacteria 1125
281 Ga0395900_0598353 3300037418 Unclassified 1043
282 Ga0395900_0659371 3300037418 Bacteria 982
283 Ga0395900_0675943 3300037418 Bacteria 967
284 Ga0395900_1022993 3300037418 Unclassified 745
285 Ga0395900_1063765 3300037418 Bacteria 727
286 Ga0395898_0070510 3300037466 Bacteria 3378
287 Ga0395898_0072159 3300037466 Bacteria 3335
288 Ga0395898_0121879 3300037466 Bacteria 2498
289 Ga0395898_0313138 3300037466 Bacteria 1497
290 Ga0395898_0343899 3300037466 Bacteria 1422
291 Ga0395898_0343901 3300037466 Bacteria 1422
292 Ga0395898_0452319 3300037466 Unclassified 1223
293 Ga0395898_0778591 3300037466 Bacteria 897
294 Ga0395898_0820532 3300037466 Unclassified 870
295 Ga0395905_0040025 3300037471 Bacteria 4397
296 Ga0395905_0049889 3300037471 Bacteria 3922
297 Ga0395905_0050354 3300037471 Bacteria 3902
298 Ga0395905_0061785 3300037471 Bacteria 3504
299 Ga0395905_0090918 3300037471 Bacteria 2861
300 Ga0395905_0096751 3300037471 Bacteria 2771
301 Ga0395905_0102426 3300037471 Bacteria 2687
302 Ga0395905_0115066 3300037471 Bacteria 2527
303 Ga0395905_0134838 3300037471 Bacteria 2322
304 Ga0395905_0259467 3300037471 Bacteria 1622
305 Ga0395905_0299073 3300037471 Bacteria 1496
306 Ga0395905_0310047 3300037471 Bacteria 1466
307 Ga0395905_0557108 3300037471 Bacteria 1047
308 Ga0395905_0634150 3300037471 Unclassified 970
309 Ga0395905_0956479 3300037471 Bacteria 759
310 Ga0395901_0051811 3300038443 Bacteria 4266
311 Ga0395901_0066390 3300038443 Bacteria 3757
312 Ga0395901_0171645 3300038443 Bacteria 2275
313 Ga0395901_0196603 3300038443 Bacteria 2114
314 Ga0395901_0290271 3300038443 Bacteria 1697
315 Ga0395901_0301071 3300038443 Bacteria 1662
316 Ga0395901_0313709 3300038443 Bacteria 1623
317 Ga0395901_0456174 3300038443 Bacteria 1307
318 Ga0395901_0553483 3300038443 Unclassified 1165
319 Ga0395901_0583952 3300038443 Bacteria 1128
320 Ga0395901_0646815 3300038443 Bacteria 1061
321 Ga0395901_0728642 3300038443 Unclassified 986
322 Ga0395901_0754906 3300038443 Bacteria 965
323 Ga0466969_0214268 3300044656 Bacteria 877
324 Ga0466965_0250831 3300044683 Bacteria 949
325 Ga0466966_0034473 3300044684 Bacteria 3272
326 Ga0466966_0042369 3300044684 Bacteria 2922
327 Ga0466966_0418689 3300044684 Bacteria 805
328 Ga0466966_0459264 3300044684 Bacteria 766
329 Ga0466961_0019996 3300044693 Bacteria 4308
330 Ga0466961_0075418 3300044693 Bacteria 2138
331 Ga0466961_0164561 3300044693 Bacteria 1381
332 Ga0466961_0165395 3300044693 Bacteria 1377
333 Ga0466963_0000208 3300044694 Bacteria 24989
334 Ga0466963_0005651 3300044694 Bacteria 7344
335 Ga0466963_0017595 3300044694 Bacteria 4458
336 Ga0466963_0019189 3300044694 Bacteria 4284
337 Ga0466963_0024350 3300044694 Bacteria 3853
338 Ga0466963_0061604 3300044694 Bacteria 2508
339 Ga0466963_0107202 3300044694 Bacteria 1916
340 Ga0466963_0116224 3300044694 Bacteria 1839
341 Ga0466963_0297224 3300044694 Bacteria 1135
342 Ga0466963_0379666 3300044694 Bacteria 996
343 Ga0466963_0476671 3300044694 Bacteria 881
344 Ga0466964_0016408 3300044706 Bacteria 2828
345 Ga0466964_0019839 3300044706 Bacteria 2587
346 Ga0466971_0001120 3300044719 Bacteria 11137
347 Ga0466971_0042606 3300044719 Bacteria 2040
348 Ga0466971_0052797 3300044719 Bacteria 1831
349 Ga0466971_0069537 3300044719 Unclassified 1597
350 Ga0466971_0345789 3300044719 Bacteria 719
351 Ga0466968_0009538 3300044735 Bacteria 3735
352 Ga0466970_0111781 3300044765 Unclassified 1492
353 Ga0466970_0450843 3300044765 Unclassified 737
354 Ga0466957_0003171 3300044842 Bacteria 8972
355 Ga0466957_0016559 3300044842 Bacteria 4311
356 Ga0466957_0109637 3300044842 Bacteria 1749
357 Ga0466957_0224717 3300044842 Bacteria 1241
358 Ga0466957_0367339 3300044842 Bacteria 979
359 Ga0466957_0480335 3300044842 Bacteria 859
360 Ga0466959_0022818 3300045049 Bacteria 4627
361 Ga0466959_0038020 3300045049 Bacteria 3557
362 Ga0466959_0121062 3300045049 Bacteria 1860
363 Ga0466959_0382189 3300045049 Bacteria 958
364 Ga0466958_0002920 3300045836 Bacteria 8737
365 Ga0466958_0090205 3300045836 Bacteria 1896
366 Ga0466958_0127901 3300045836 Bacteria 1594
367 Ga0466958_0128809 3300045836 Bacteria 1588
368 Ga0466958_0151150 3300045836 Bacteria 1464
369 Ga0466958_0153946 3300045836 Bacteria 1451
370 Ga0466958_0292479 3300045836 Bacteria 1045
371 Ga0466967_0000567 3300045976 Bacteria 18158
372 Ga0466967_0003028 3300045976 Bacteria 10783
373 Ga0466967_0012389 3300045976 Bacteria 6518
374 Ga0466967_0099015 3300045976 Bacteria 2662
375 Ga0466967_0113639 3300045976 Bacteria 2491
376 Ga0466967_0168516 3300045976 Bacteria 2059
377 Ga0466967_0195520 3300045976 Bacteria 1913
378 Ga0466967_0277692 3300045976 Unclassified 1607
379 Ga0466967_0358387 3300045976 Bacteria 1413
380 Ga0466967_0377755 3300045976 Bacteria 1375
381 Ga0466967_0565976 3300045976 Bacteria 1119
382 Ga0466967_0769254 3300045976 Bacteria 955
383 Ga0466967_0824954 3300045976 Unclassified 921
384 Ga0466967_0890293 3300045976 Bacteria 885
385 Ga0466967_1309538 3300045976 Bacteria 722
386 Ga0466962_0002141 3300061719 Bacteria 9326
387 Ga0466962_0038537 3300061719 Bacteria 2289
388 Ga0466962_0310348 3300061719 Bacteria 781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0000208 Ga0466963_0000208_9536_10045 169
2 3300044706 Ga0466964_0019839 Ga0466964_0019839_1469_1978 169
3 3300045976 Ga0466967_0000567 Ga0466967_0000567_9536_10045 169
4 3300045976 Ga0466967_0824954 Ga0466967_0824954_101_634 169
5 3300037312 Ga0395899_0134836 Ga0395899_0134836_291_824 172
6 3300037418 Ga0395900_0143807 Ga0395900_0143807_1196_1729 172
7 3300037418 Ga0395900_0313074 Ga0395900_0313074_227_760 172
8 3300037466 Ga0395898_0121879 Ga0395898_0121879_1347_1880 172
9 3300037471 Ga0395905_0090918 Ga0395905_0090918_1243_1776 172
10 3300037471 Ga0395905_0259467 Ga0395905_0259467_256_789 172
11 3300038443 Ga0395901_0066390 Ga0395901_0066390_291_824 172
12 3300038443 Ga0395901_0301071 Ga0395901_0301071_1038_1571 172
13 3300013307 Ga0157372_11339377 Ga0157372_113393772 176
14 3300037312 Ga0395899_0192557 Ga0395899_0192557_34_564 176
15 3300037418 Ga0395900_0162346 Ga0395900_0162346_748_1278 176
16 3300037466 Ga0395898_0778591 Ga0395898_0778591_230_760 176
17 3300037471 Ga0395905_0040025 Ga0395905_0040025_3027_3557 176
18 3300038443 Ga0395901_0171645 Ga0395901_0171645_639_1169 176
19 3300001979 JGI24740J21852_10008316 JGI24740J21852_100083163 177
20 3300001979 JGI24740J21852_10009432 JGI24740J21852_100094323 177
21 3300001979 JGI24740J21852_10027819 JGI24740J21852_100278192 177
22 3300001989 JGI24739J22299_10009852 JGI24739J22299_100098522 177
23 3300001990 JGI24737J22298_10024330 JGI24737J22298_100243302 177
24 3300002067 JGI24735J21928_10003971 JGI24735J21928_100039714 177
25 3300002067 JGI24735J21928_10009779 JGI24735J21928_100097793 177
26 3300002067 JGI24735J21928_10011995 JGI24735J21928_100119954 177
27 3300005327 Ga0070658_10006398 Ga0070658_100063982 177
28 3300005327 Ga0070658_10038242 Ga0070658_100382425 177
29 3300005327 Ga0070658_10229835 Ga0070658_102298352 177
30 3300005327 Ga0070658_10446916 Ga0070658_104469162 177
31 3300005327 Ga0070658_10601937 Ga0070658_106019371 177
32 3300005327 Ga0070658_10843150 Ga0070658_108431501 177
33 3300005329 Ga0070683_100021193 Ga0070683_1000211933 177
34 3300005329 Ga0070683_100021741 Ga0070683_1000217413 177
35 3300005329 Ga0070683_100088445 Ga0070683_1000884452 177
36 3300005329 Ga0070683_100094195 Ga0070683_1000941952 177
37 3300005336 Ga0070680_100009168 Ga0070680_1000091686 177
38 3300005336 Ga0070680_100052604 Ga0070680_1000526042 177
39 3300005336 Ga0070680_100136860 Ga0070680_1001368602 177
40 3300005336 Ga0070680_100142463 Ga0070680_1001424632 177
41 3300005336 Ga0070680_100154012 Ga0070680_1001540122 177
42 3300005336 Ga0070680_100581824 Ga0070680_1005818242 177
43 3300005337 Ga0070682_100454230 Ga0070682_1004542301 177
44 3300005339 Ga0070660_100001242 Ga0070660_1000012428 177
45 3300005339 Ga0070660_100066554 Ga0070660_1000665544 177
46 3300005339 Ga0070660_100078682 Ga0070660_1000786823 177
47 3300005339 Ga0070660_100461535 Ga0070660_1004615352 177
48 3300005339 Ga0070660_100466543 Ga0070660_1004665432 177
49 3300005339 Ga0070660_100675403 Ga0070660_1006754032 177
50 3300005341 Ga0070691_10000792 Ga0070691_100007922 177
51 3300005344 Ga0070661_100022514 Ga0070661_1000225143 177
52 3300005344 Ga0070661_100057779 Ga0070661_1000577792 177
53 3300005344 Ga0070661_100140225 Ga0070661_1001402252 177
54 3300005345 Ga0070692_10022876 Ga0070692_100228763 177
55 3300005345 Ga0070692_10087696 Ga0070692_100876962 177
56 3300005345 Ga0070692_10092778 Ga0070692_100927783 177
57 3300005345 Ga0070692_10163395 Ga0070692_101633952 177
58 3300005345 Ga0070692_10267949 Ga0070692_102679492 177
59 3300005366 Ga0070659_100004047 Ga0070659_1000040479 177
60 3300005366 Ga0070659_100204703 Ga0070659_1002047032 177
61 3300005366 Ga0070659_100223273 Ga0070659_1002232732 177
62 3300005366 Ga0070659_100732760 Ga0070659_1007327601 177
63 3300005435 Ga0070714_100098648 Ga0070714_1000986481 177
64 3300005435 Ga0070714_100408520 Ga0070714_1004085202 177
65 3300005455 Ga0070663_100003073 Ga0070663_1000030737 177
66 3300005455 Ga0070663_100064379 Ga0070663_1000643792 177
67 3300005455 Ga0070663_100115543 Ga0070663_1001155432 177
68 3300005455 Ga0070663_100202590 Ga0070663_1002025903 177
69 3300005455 Ga0070663_100284634 Ga0070663_1002846342 177
70 3300005455 Ga0070663_100414703 Ga0070663_1004147032 177
71 3300005455 Ga0070663_100462645 Ga0070663_1004626452 177
72 3300005455 Ga0070663_100851654 Ga0070663_1008516541 177
73 3300005455 Ga0070663_101397716 Ga0070663_1013977161 177
74 3300005457 Ga0070662_100074571 Ga0070662_1000745713 177
75 3300005457 Ga0070662_100298335 Ga0070662_1002983352 177
76 3300005458 Ga0070681_10082009 Ga0070681_100820092 177
77 3300005458 Ga0070681_10477462 Ga0070681_104774622 177
78 3300005530 Ga0070679_100008042 Ga0070679_1000080425 177
79 3300005530 Ga0070679_100095345 Ga0070679_1000953452 177
80 3300005530 Ga0070679_100127394 Ga0070679_1001273942 177
81 3300005530 Ga0070679_100287976 Ga0070679_1002879762 177
82 3300005530 Ga0070679_100405589 Ga0070679_1004055893 177
83 3300005530 Ga0070679_100548475 Ga0070679_1005484752 177
84 3300005530 Ga0070679_101162711 Ga0070679_1011627111 177
85 3300005535 Ga0070684_100002935 Ga0070684_1000029353 177
86 3300005535 Ga0070684_100051853 Ga0070684_1000518532 177
87 3300005535 Ga0070684_100191871 Ga0070684_1001918712 177
88 3300005535 Ga0070684_101075874 Ga0070684_1010758741 177
89 3300005539 Ga0068853_100014114 Ga0068853_1000141143 177
90 3300005539 Ga0068853_100025432 Ga0068853_1000254325 177
91 3300005539 Ga0068853_100442490 Ga0068853_1004424902 177
92 3300005539 Ga0068853_100486521 Ga0068853_1004865212 177
93 3300005546 Ga0070696_100566346 Ga0070696_1005663462 177
94 3300005547 Ga0070693_100022392 Ga0070693_1000223923 177
95 3300005563 Ga0068855_100008787 Ga0068855_1000087875 177
96 3300005563 Ga0068855_100439731 Ga0068855_1004397313 177
97 3300005563 Ga0068855_100575892 Ga0068855_1005758921 177
98 3300005563 Ga0068855_100639641 Ga0068855_1006396412 177
99 3300005563 Ga0068855_100718801 Ga0068855_1007188012 177
100 3300005563 Ga0068855_101036270 Ga0068855_1010362701 177
101 3300005563 Ga0068855_101844818 Ga0068855_1018448181 177
102 3300005564 Ga0070664_100070647 Ga0070664_1000706472 177
103 3300005564 Ga0070664_100450522 Ga0070664_1004505222 177
104 3300005577 Ga0068857_100004705 Ga0068857_1000047057 177
105 3300005577 Ga0068857_100070129 Ga0068857_1000701292 177
106 3300005577 Ga0068857_100160572 Ga0068857_1001605723 177
107 3300005577 Ga0068857_100226799 Ga0068857_1002267992 177
108 3300005577 Ga0068857_100560993 Ga0068857_1005609932 177
109 3300005577 Ga0068857_101093955 Ga0068857_1010939552 177
110 3300005578 Ga0068854_100022978 Ga0068854_1000229784 177
111 3300005578 Ga0068854_100026222 Ga0068854_1000262222 177
112 3300005578 Ga0068854_100068315 Ga0068854_1000683153 177
113 3300005578 Ga0068854_100428286 Ga0068854_1004282862 177
114 3300005578 Ga0068854_101388237 Ga0068854_1013882372 177
115 3300005614 Ga0068856_100156595 Ga0068856_1001565952 177
116 3300005614 Ga0068856_100229801 Ga0068856_1002298012 177
117 3300005614 Ga0068856_100372247 Ga0068856_1003722472 177
118 3300005614 Ga0068856_100587850 Ga0068856_1005878502 177
119 3300005614 Ga0068856_101434399 Ga0068856_1014343991 177
120 3300005616 Ga0068852_100072113 Ga0068852_1000721132 177
121 3300005616 Ga0068852_100122632 Ga0068852_1001226322 177
122 3300005616 Ga0068852_100182494 Ga0068852_1001824942 177
123 3300005616 Ga0068852_100424707 Ga0068852_1004247072 177
124 3300005616 Ga0068852_100491822 Ga0068852_1004918222 177
125 3300005616 Ga0068852_100662630 Ga0068852_1006626302 177
126 3300005616 Ga0068852_100986345 Ga0068852_1009863451 177
127 3300005616 Ga0068852_101735988 Ga0068852_1017359881 177
128 3300005834 Ga0068851_10007120 Ga0068851_100071207 177
129 3300009093 Ga0105240_10036173 Ga0105240_100361734 177
130 3300009093 Ga0105240_11217201 Ga0105240_112172012 177
131 3300009174 Ga0105241_10283654 Ga0105241_102836542 177
132 3300009545 Ga0105237_10003734 Ga0105237_100037344 177
133 3300009551 Ga0105238_10037054 Ga0105238_100370546 177
134 3300009551 Ga0105238_10299360 Ga0105238_102993602 177
135 3300009551 Ga0105238_10715108 Ga0105238_107151082 177
136 3300013100 Ga0157373_10003861 Ga0157373_100038613 177
137 3300013100 Ga0157373_10263958 Ga0157373_102639582 177
138 3300013100 Ga0157373_10277010 Ga0157373_102770102 177
139 3300013100 Ga0157373_10286116 Ga0157373_102861162 177
140 3300013100 Ga0157373_10428904 Ga0157373_104289042 177
141 3300013100 Ga0157373_10475642 Ga0157373_104756422 177
142 3300013100 Ga0157373_10498865 Ga0157373_104988652 177
143 3300013102 Ga0157371_10227187 Ga0157371_102271873 177
144 3300013102 Ga0157371_10254427 Ga0157371_102544272 177
145 3300013102 Ga0157371_10462447 Ga0157371_104624472 177
146 3300013102 Ga0157371_10716960 Ga0157371_107169601 177
147 3300013104 Ga0157370_10002480 Ga0157370_1000248016 177
148 3300013104 Ga0157370_10018585 Ga0157370_100185852 177
149 3300013104 Ga0157370_10049972 Ga0157370_100499723 177
150 3300013104 Ga0157370_10115599 Ga0157370_101155992 177
151 3300013104 Ga0157370_10339753 Ga0157370_103397533 177
152 3300013104 Ga0157370_10748173 Ga0157370_107481732 177
153 3300013104 Ga0157370_11141467 Ga0157370_111414671 177
154 3300013105 Ga0157369_10141605 Ga0157369_101416052 177
155 3300013105 Ga0157369_10150045 Ga0157369_101500452 177
156 3300013105 Ga0157369_10163071 Ga0157369_101630714 177
157 3300013105 Ga0157369_10224817 Ga0157369_102248173 177
158 3300013105 Ga0157369_10262853 Ga0157369_102628532 177
159 3300013105 Ga0157369_10945511 Ga0157369_109455112 177
160 3300013105 Ga0157369_11127250 Ga0157369_111272502 177
161 3300013105 Ga0157369_11661637 Ga0157369_116616371 177
162 3300013105 Ga0157369_11739048 Ga0157369_117390481 177
163 3300013307 Ga0157372_10017788 Ga0157372_100177886 177
164 3300013307 Ga0157372_10117443 Ga0157372_101174434 177
165 3300013307 Ga0157372_10478545 Ga0157372_104785452 177
166 3300013307 Ga0157372_10581993 Ga0157372_105819932 177
167 3300013307 Ga0157372_10655641 Ga0157372_106556412 177
168 3300020082 Ga0206353_10626766 Ga0206353_106267664 177
169 3300025321 Ga0207656_10402397 Ga0207656_104023972 177
170 3300025904 Ga0207647_10002138 Ga0207647_100021387 177
171 3300025904 Ga0207647_10016389 Ga0207647_100163894 177
172 3300025904 Ga0207647_10136706 Ga0207647_101367062 177
173 3300025909 Ga0207705_10002941 Ga0207705_100029414 177
174 3300025909 Ga0207705_10025771 Ga0207705_100257713 177
175 3300025909 Ga0207705_10031779 Ga0207705_100317793 177
176 3300025909 Ga0207705_10035593 Ga0207705_100355932 177
177 3300025909 Ga0207705_10037527 Ga0207705_100375272 177
178 3300025909 Ga0207705_10053056 Ga0207705_100530563 177
179 3300025909 Ga0207705_10053970 Ga0207705_100539702 177
180 3300025909 Ga0207705_10076051 Ga0207705_100760514 177
181 3300025909 Ga0207705_10107688 Ga0207705_101076881 177
182 3300025909 Ga0207705_10147445 Ga0207705_101474453 177
183 3300025909 Ga0207705_10168914 Ga0207705_101689142 177
184 3300025911 Ga0207654_10111982 Ga0207654_101119822 177
185 3300025912 Ga0207707_10073083 Ga0207707_100730834 177
186 3300025912 Ga0207707_10268950 Ga0207707_102689502 177
187 3300025913 Ga0207695_10004985 Ga0207695_1000498512 177
188 3300025913 Ga0207695_10575542 Ga0207695_105755422 177
189 3300025914 Ga0207671_10028169 Ga0207671_100281693 177
190 3300025917 Ga0207660_10002135 Ga0207660_100021358 177
191 3300025917 Ga0207660_10006368 Ga0207660_100063682 177
192 3300025917 Ga0207660_10066933 Ga0207660_100669332 177
193 3300025917 Ga0207660_10071263 Ga0207660_100712632 177
194 3300025917 Ga0207660_10481080 Ga0207660_104810801 177
195 3300025919 Ga0207657_10000956 Ga0207657_1000095610 177
196 3300025919 Ga0207657_10003342 Ga0207657_1000334210 177
197 3300025919 Ga0207657_10012492 Ga0207657_100124926 177
198 3300025919 Ga0207657_10045893 Ga0207657_100458935 177
199 3300025919 Ga0207657_10050650 Ga0207657_100506502 177
200 3300025919 Ga0207657_10079891 Ga0207657_100798914 177
201 3300025919 Ga0207657_10142214 Ga0207657_101422142 177
202 3300025919 Ga0207657_10143170 Ga0207657_101431703 177
203 3300025919 Ga0207657_10398424 Ga0207657_103984242 177
204 3300025920 Ga0207649_10008752 Ga0207649_100087523 177
205 3300025920 Ga0207649_10036712 Ga0207649_100367124 177
206 3300025920 Ga0207649_10205977 Ga0207649_102059772 177
207 3300025921 Ga0207652_10001384 Ga0207652_1000138411 177
208 3300025921 Ga0207652_10010035 Ga0207652_100100353 177
209 3300025921 Ga0207652_10076801 Ga0207652_100768014 177
210 3300025921 Ga0207652_10163762 Ga0207652_101637623 177
211 3300025921 Ga0207652_10524618 Ga0207652_105246182 177
212 3300025921 Ga0207652_10672268 Ga0207652_106722682 177
213 3300025924 Ga0207694_10011916 Ga0207694_100119163 177
214 3300025924 Ga0207694_10828621 Ga0207694_108286212 177
215 3300025929 Ga0207664_10265516 Ga0207664_102655162 177
216 3300025929 Ga0207664_10745898 Ga0207664_107458982 177
217 3300025929 Ga0207664_11094952 Ga0207664_110949521 177
218 3300025932 Ga0207690_10039076 Ga0207690_100390763 177
219 3300025932 Ga0207690_10089739 Ga0207690_100897393 177
220 3300025932 Ga0207690_10106353 Ga0207690_101063531 177
221 3300025932 Ga0207690_10172817 Ga0207690_101728173 177
222 3300025933 Ga0207706_10024756 Ga0207706_100247562 177
223 3300025933 Ga0207706_10088437 Ga0207706_100884374 177
224 3300025933 Ga0207706_10263058 Ga0207706_102630583 177
225 3300025933 Ga0207706_10455616 Ga0207706_104556161 177
226 3300025933 Ga0207706_10530146 Ga0207706_105301462 177
227 3300025944 Ga0207661_10000577 Ga0207661_1000057716 177
228 3300025944 Ga0207661_10000853 Ga0207661_100008539 177
229 3300025944 Ga0207661_10107530 Ga0207661_101075302 177
230 3300025944 Ga0207661_10382191 Ga0207661_103821912 177
231 3300025945 Ga0207679_10043897 Ga0207679_100438974 177
232 3300025945 Ga0207679_10294399 Ga0207679_102943993 177
233 3300025949 Ga0207667_10006230 Ga0207667_100062305 177
234 3300025949 Ga0207667_10034165 Ga0207667_100341653 177
235 3300025949 Ga0207667_10054640 Ga0207667_100546403 177
236 3300025949 Ga0207667_10134965 Ga0207667_101349652 177
237 3300025949 Ga0207667_10465865 Ga0207667_104658652 177
238 3300025949 Ga0207667_10618183 Ga0207667_106181832 177
239 3300025981 Ga0207640_10024244 Ga0207640_100242443 177
240 3300025981 Ga0207640_10191114 Ga0207640_101911141 177
241 3300025981 Ga0207640_10215844 Ga0207640_102158443 177
242 3300025981 Ga0207640_10389932 Ga0207640_103899322 177
243 3300026041 Ga0207639_10012178 Ga0207639_100121784 177
244 3300026041 Ga0207639_10067659 Ga0207639_100676593 177
245 3300026041 Ga0207639_11089589 Ga0207639_110895892 177
246 3300026067 Ga0207678_10001246 Ga0207678_100012464 177
247 3300026067 Ga0207678_10019861 Ga0207678_100198612 177
248 3300026067 Ga0207678_10070339 Ga0207678_100703394 177
249 3300026067 Ga0207678_10092116 Ga0207678_100921162 177
250 3300026067 Ga0207678_10173458 Ga0207678_101734583 177
251 3300026067 Ga0207678_10202863 Ga0207678_102028632 177
252 3300026067 Ga0207678_10532755 Ga0207678_105327552 177
253 3300026078 Ga0207702_10003159 Ga0207702_1000315910 177
254 3300026078 Ga0207702_10174075 Ga0207702_101740752 177
255 3300026078 Ga0207702_10191212 Ga0207702_101912123 177
256 3300026078 Ga0207702_10260723 Ga0207702_102607232 177
257 3300026078 Ga0207702_10383412 Ga0207702_103834121 177
258 3300026078 Ga0207702_10629464 Ga0207702_106294642 177
259 3300026078 Ga0207702_11497338 Ga0207702_114973382 177
260 3300026116 Ga0207674_10001151 Ga0207674_100011515 177
261 3300026116 Ga0207674_10010421 Ga0207674_100104212 177
262 3300026116 Ga0207674_11148283 Ga0207674_111482831 177
263 3300026142 Ga0207698_10002850 Ga0207698_100028506 177
264 3300026142 Ga0207698_10084747 Ga0207698_100847472 177
265 3300026142 Ga0207698_10141730 Ga0207698_101417303 177
266 3300026142 Ga0207698_10197990 Ga0207698_101979903 177
267 3300026142 Ga0207698_10450820 Ga0207698_104508202 177
268 3300026142 Ga0207698_10609416 Ga0207698_106094162 177
269 3300026142 Ga0207698_10707801 Ga0207698_107078012 177
270 3300037312 Ga0395899_0032125 Ga0395899_0032125_1570_2103 177
271 3300037312 Ga0395899_0037672 Ga0395899_0037672_2091_2624 177
272 3300037312 Ga0395899_0038527 Ga0395899_0038527_2541_3074 177
273 3300037312 Ga0395899_0046562 Ga0395899_0046562_894_1427 177
274 3300037312 Ga0395899_0141342 Ga0395899_0141342_45_578 177
275 3300037312 Ga0395899_0162375 Ga0395899_0162375_74_607 177
276 3300037312 Ga0395899_0201820 Ga0395899_0201820_90_623 177
277 3300037312 Ga0395899_0221774 Ga0395899_0221774_375_908 177
278 3300037312 Ga0395899_0245837 Ga0395899_0245837_432_965 177
279 3300037312 Ga0395899_0282561 Ga0395899_0282561_286_819 177
280 3300037312 Ga0395899_0304556 Ga0395899_0304556_401_934 177
281 3300037312 Ga0395899_0371458 Ga0395899_0371458_247_780 177
282 3300037418 Ga0395900_0019910 Ga0395900_0019910_5091_5624 177
283 3300037418 Ga0395900_0021488 Ga0395900_0021488_5038_5571 177
284 3300037418 Ga0395900_0052765 Ga0395900_0052765_331_864 177
285 3300037418 Ga0395900_0062098 Ga0395900_0062098_574_1107 177
286 3300037418 Ga0395900_0091576 Ga0395900_0091576_1926_2459 177
287 3300037418 Ga0395900_0111311 Ga0395900_0111311_1327_1860 177
288 3300037418 Ga0395900_0202993 Ga0395900_0202993_1418_1951 177
289 3300037418 Ga0395900_0327158 Ga0395900_0327158_402_935 177
290 3300037418 Ga0395900_0346604 Ga0395900_0346604_907_1440 177
291 3300037418 Ga0395900_0527051 Ga0395900_0527051_286_819 177
292 3300037418 Ga0395900_0529498 Ga0395900_0529498_503_1036 177
293 3300037418 Ga0395900_0598353 Ga0395900_0598353_110_643 177
294 3300037418 Ga0395900_0659371 Ga0395900_0659371_288_821 177
295 3300037418 Ga0395900_0675943 Ga0395900_0675943_81_614 177
296 3300037418 Ga0395900_1022993 Ga0395900_1022993_131_664 177
297 3300037418 Ga0395900_1063765 Ga0395900_1063765_72_605 177
298 3300037466 Ga0395898_0070510 Ga0395898_0070510_1574_2107 177
299 3300037466 Ga0395898_0072159 Ga0395898_0072159_1357_1890 177
300 3300037466 Ga0395898_0313138 Ga0395898_0313138_402_935 177
301 3300037466 Ga0395898_0343899 Ga0395898_0343899_286_819 177
302 3300037466 Ga0395898_0343901 Ga0395898_0343901_286_819 177
303 3300037466 Ga0395898_0452319 Ga0395898_0452319_162_695 177
304 3300037466 Ga0395898_0820532 Ga0395898_0820532_122_655 177
305 3300037471 Ga0395905_0049889 Ga0395905_0049889_1498_2031 177
306 3300037471 Ga0395905_0050354 Ga0395905_0050354_2422_2955 177
307 3300037471 Ga0395905_0061785 Ga0395905_0061785_1745_2278 177
308 3300037471 Ga0395905_0096751 Ga0395905_0096751_1345_1878 177
309 3300037471 Ga0395905_0102426 Ga0395905_0102426_1515_2048 177
310 3300037471 Ga0395905_0115066 Ga0395905_0115066_1975_2508 177
311 3300037471 Ga0395905_0134838 Ga0395905_0134838_80_613 177
312 3300037471 Ga0395905_0299073 Ga0395905_0299073_459_992 177
313 3300037471 Ga0395905_0310047 Ga0395905_0310047_624_1157 177
314 3300037471 Ga0395905_0557108 Ga0395905_0557108_287_820 177
315 3300037471 Ga0395905_0634150 Ga0395905_0634150_146_679 177
316 3300037471 Ga0395905_0956479 Ga0395905_0956479_125_658 177
317 3300038443 Ga0395901_0051811 Ga0395901_0051811_163_696 177
318 3300038443 Ga0395901_0196603 Ga0395901_0196603_916_1449 177
319 3300038443 Ga0395901_0290271 Ga0395901_0290271_161_694 177
320 3300038443 Ga0395901_0313709 Ga0395901_0313709_109_642 177
321 3300038443 Ga0395901_0456174 Ga0395901_0456174_216_749 177
322 3300038443 Ga0395901_0553483 Ga0395901_0553483_208_741 177
323 3300038443 Ga0395901_0583952 Ga0395901_0583952_310_843 177
324 3300038443 Ga0395901_0646815 Ga0395901_0646815_106_639 177
325 3300038443 Ga0395901_0728642 Ga0395901_0728642_125_658 177
326 3300038443 Ga0395901_0754906 Ga0395901_0754906_399_932 177
327 3300044656 Ga0466969_0214268 Ga0466969_0214268_14_547 177
328 3300044683 Ga0466965_0250831 Ga0466965_0250831_228_761 177
329 3300044684 Ga0466966_0034473 Ga0466966_0034473_264_797 177
330 3300044684 Ga0466966_0042369 Ga0466966_0042369_1206_1739 177
331 3300044684 Ga0466966_0418689 Ga0466966_0418689_115_648 177
332 3300044684 Ga0466966_0459264 Ga0466966_0459264_39_572 177
333 3300044693 Ga0466961_0019996 Ga0466961_0019996_3523_4056 177
334 3300044693 Ga0466961_0075418 Ga0466961_0075418_866_1399 177
335 3300044693 Ga0466961_0164561 Ga0466961_0164561_281_814 177
336 3300044693 Ga0466961_0165395 Ga0466961_0165395_562_1095 177
337 3300044694 Ga0466963_0005651 Ga0466963_0005651_565_1104 177
338 3300044694 Ga0466963_0017595 Ga0466963_0017595_417_950 177
339 3300044694 Ga0466963_0019189 Ga0466963_0019189_307_840 177
340 3300044694 Ga0466963_0024350 Ga0466963_0024350_3044_3577 177
341 3300044694 Ga0466963_0061604 Ga0466963_0061604_813_1346 177
342 3300044694 Ga0466963_0107202 Ga0466963_0107202_82_615 177
343 3300044694 Ga0466963_0116224 Ga0466963_0116224_749_1282 177
344 3300044694 Ga0466963_0297224 Ga0466963_0297224_471_1004 177
345 3300044694 Ga0466963_0379666 Ga0466963_0379666_406_939 177
346 3300044694 Ga0466963_0476671 Ga0466963_0476671_49_582 177
347 3300044706 Ga0466964_0016408 Ga0466964_0016408_681_1214 177
348 3300044719 Ga0466971_0001120 Ga0466971_0001120_8522_9061 177
349 3300044719 Ga0466971_0042606 Ga0466971_0042606_666_1199 177
350 3300044719 Ga0466971_0052797 Ga0466971_0052797_1273_1806 177
351 3300044719 Ga0466971_0069537 Ga0466971_0069537_985_1518 177
352 3300044719 Ga0466971_0345789 Ga0466971_0345789_106_639 177
353 3300044735 Ga0466968_0009538 Ga0466968_0009538_1828_2361 177
354 3300044765 Ga0466970_0111781 Ga0466970_0111781_308_841 177
355 3300044765 Ga0466970_0450843 Ga0466970_0450843_165_698 177
356 3300044842 Ga0466957_0003171 Ga0466957_0003171_2883_3416 177
357 3300044842 Ga0466957_0016559 Ga0466957_0016559_1106_1645 177
358 3300044842 Ga0466957_0109637 Ga0466957_0109637_296_829 177
359 3300044842 Ga0466957_0224717 Ga0466957_0224717_241_774 177
360 3300044842 Ga0466957_0367339 Ga0466957_0367339_222_755 177
361 3300044842 Ga0466957_0480335 Ga0466957_0480335_57_590 177
362 3300045049 Ga0466959_0022818 Ga0466959_0022818_3621_4160 177
363 3300045049 Ga0466959_0038020 Ga0466959_0038020_1430_1963 177
364 3300045049 Ga0466959_0121062 Ga0466959_0121062_153_686 177
365 3300045049 Ga0466959_0382189 Ga0466959_0382189_236_769 177
366 3300045836 Ga0466958_0002920 Ga0466958_0002920_6173_6712 177
367 3300045836 Ga0466958_0090205 Ga0466958_0090205_348_881 177
368 3300045836 Ga0466958_0127901 Ga0466958_0127901_28_561 177
369 3300045836 Ga0466958_0128809 Ga0466958_0128809_736_1269 177
370 3300045836 Ga0466958_0151150 Ga0466958_0151150_612_1145 177
371 3300045836 Ga0466958_0153946 Ga0466958_0153946_567_1100 177
372 3300045836 Ga0466958_0292479 Ga0466958_0292479_186_719 177
373 3300045976 Ga0466967_0003028 Ga0466967_0003028_1147_1680 177
374 3300045976 Ga0466967_0012389 Ga0466967_0012389_1534_2067 177
375 3300045976 Ga0466967_0099015 Ga0466967_0099015_1105_1638 177
376 3300045976 Ga0466967_0113639 Ga0466967_0113639_1142_1675 177
377 3300045976 Ga0466967_0168516 Ga0466967_0168516_988_1521 177
378 3300045976 Ga0466967_0195520 Ga0466967_0195520_137_670 177
379 3300045976 Ga0466967_0277692 Ga0466967_0277692_237_770 177
380 3300045976 Ga0466967_0358387 Ga0466967_0358387_306_839 177
381 3300045976 Ga0466967_0377755 Ga0466967_0377755_44_577 177
382 3300045976 Ga0466967_0565976 Ga0466967_0565976_468_1001 177
383 3300045976 Ga0466967_0769254 Ga0466967_0769254_55_594 177
384 3300045976 Ga0466967_0890293 Ga0466967_0890293_20_553 177
385 3300045976 Ga0466967_1309538 Ga0466967_1309538_117_650 177
386 3300061719 Ga0466962_0002141 Ga0466962_0002141_5117_5656 177
387 3300061719 Ga0466962_0038537 Ga0466962_0038537_346_879 177
388 3300061719 Ga0466962_0310348 Ga0466962_0310348_28_561 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

8

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aa8-assembly1.cif.gz_C crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli 0.6511 3 43
4y6i-assembly1.cif.gz_B crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation 0.6461 2 43
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.6352 4 177
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.6323 4 177
2j9d-assembly2.cif.gz_F structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.6225 4 36
ID Description Score Start End Superfamily
af_Q7T3C3_31_149_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7261 3 36 3.30.70.120
1nzaA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.686 4 43 3.30.70.120
af_Q58953_1_90_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6585 143 174 3.30.70.260
af_P69488_1_112_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.647 2 43 3.30.70.120
4iyqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.618 1 39 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A068NV70-F1-model_v4 Uncharacterized protein 0.7529 139 174
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.6934 1 177 GO:0016020
AF-A0A4Q3UM68-F1-model_v4 Uncharacterized protein 0.6918 136 176
AF-A0A518CNK7-F1-model_v4 Cytochrome c domain-containing protein 0.6696 2 177 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A7T7KJL9-F1-model_v4 DUF3341 domain-containing protein 0.6695 2 177 GO:0016020

Feature Viewer

pLDDT pTM Quality
68.21 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map