F431077

General Info

Members Datasets Scaffolds Average Seq Length
388 203 776 318

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100119115|Ga0075434_1001191152
Length 360
Sequence MGVLTKDARSRGQGLPGHPIEDARAIVSLNPSPPSMPASLAGIRYPSSRVLLPRTRLAYIHLRNLLSDAKRDRAARVSAYVAIWLPEELVTLYLRTGEVVNATVGDAAGSRAVAISEALERVPAEPEYGEICFHEAEPEQLACMFAAQSLEPQPWPNDLAPSDATKLFPFLMSTVFDGAVEILADDTVNYLVFEGGTVARAFLAAAHHGTLIDRVSKLFTREGRVGKIELRRWPSPLSLPEQAPPRLIQAYRELSASLIRALVERGRDSAPAIAEHARLNLIDKHPALDGFSTNGRVPCDPLCDSKALTTAVAAWIKDVMWTAADQDSDSAEELLRKLTWERRHLFQSAGLFEKLPWKMT

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.26
Rhizosphere 99.48
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100119115 3300006871 Bacteria 2654
2 Ga0065712_10133087 3300005290 Bacteria 1526
3 Ga0065707_10084553 3300005295 Bacteria 7065
4 Ga0070676_10031744 3300005328 Bacteria 3022
5 Ga0070683_100003552 3300005329 Bacteria 12685
6 Ga0070683_100019767 3300005329 Bacteria 5986
7 Ga0070683_100050428 3300005329 Bacteria 3853
8 Ga0070690_100106155 3300005330 Bacteria 1868
9 Ga0070670_100008398 3300005331 Bacteria 8803
10 Ga0070670_100012636 3300005331 Bacteria 7229
11 Ga0070670_100099553 3300005331 Bacteria 2502
12 Ga0070670_100112302 3300005331 Bacteria 2349
13 Ga0070670_100286893 3300005331 Bacteria 1438
14 Ga0070677_10012165 3300005333 Bacteria 2983
15 Ga0070680_100019542 3300005336 Bacteria 5370
16 Ga0070680_100187001 3300005336 Bacteria 1745
17 Ga0068868_100031092 3300005338 Bacteria 4097
18 Ga0068868_100051562 3300005338 Bacteria 3237
19 Ga0070691_10001622 3300005341 Bacteria 9747
20 Ga0070687_100029535 3300005343 Bacteria 2670
21 Ga0070661_100000704 3300005344 Bacteria 24498
22 Ga0070661_100051550 3300005344 Bacteria 3012
23 Ga0070661_100206478 3300005344 Bacteria 1502
24 Ga0070692_10012701 3300005345 Bacteria 3909
25 Ga0070668_100000424 3300005347 Bacteria 27996
26 Ga0070668_100129722 3300005347 Bacteria 2022
27 Ga0070669_100000845 3300005353 Bacteria 22224
28 Ga0070669_100018147 3300005353 Bacteria 5027
29 Ga0070669_100019161 3300005353 Bacteria 4890
30 Ga0070675_100006436 3300005354 Bacteria 9014
31 Ga0070675_100060669 3300005354 Bacteria 3122
32 Ga0070675_100555901 3300005354 Unclassified 1038
33 Ga0070674_100036343 3300005356 Bacteria 3306
34 Ga0070674_100101474 3300005356 Bacteria 2097
35 Ga0070673_100042454 3300005364 Bacteria 3506
36 Ga0070673_100051822 3300005364 Bacteria 3217
37 Ga0070688_100014200 3300005365 Bacteria 4509
38 Ga0070688_100031828 3300005365 Bacteria 3176
39 Ga0070659_100008205 3300005366 Bacteria 7624
40 Ga0070659_100016273 3300005366 Bacteria 5583
41 Ga0070667_100001910 3300005367 Bacteria 18487
42 Ga0070667_100025672 3300005367 Bacteria 4899
43 Ga0070667_100176910 3300005367 Bacteria 1886
44 Ga0070709_10001888 3300005434 Bacteria 11366
45 Ga0070709_10026223 3300005434 Bacteria 3452
46 Ga0070714_100003575 3300005435 Bacteria 11627
47 Ga0070714_100009199 3300005435 Bacteria 7757
48 Ga0070714_100090099 3300005435 Bacteria 2686
49 Ga0070713_100001556 3300005436 Bacteria 14670
50 Ga0070713_100008877 3300005436 Bacteria 7157
51 Ga0070713_100011083 3300005436 Bacteria 6546
52 Ga0070710_10172574 3300005437 Bacteria 1348
53 Ga0070708_100000006 3300005445 Bacteria 150596
54 Ga0070663_100055375 3300005455 Bacteria 2839
55 Ga0070678_100273790 3300005456 Unclassified 1425
56 Ga0070662_100056746 3300005457 Bacteria 2843
57 Ga0070662_100174009 3300005457 Bacteria 1693
58 Ga0070681_10000981 3300005458 Bacteria 24147
59 Ga0070681_10002640 3300005458 Bacteria 16456
60 Ga0070681_10035065 3300005458 Bacteria 5040
61 Ga0068867_100017247 3300005459 Bacteria 5128
62 Ga0070685_10014011 3300005466 Bacteria 4243
63 Ga0070706_100059110 3300005467 Unclassified 3538
64 Ga0070679_100000476 3300005530 Bacteria 34246
65 Ga0070679_100051441 3300005530 Bacteria 4103
66 Ga0070679_100141938 3300005530 Bacteria 2380
67 Ga0070679_100404330 3300005530 Bacteria 1311
68 Ga0070684_100018357 3300005535 Bacteria 5761
69 Ga0070684_100034291 3300005535 Bacteria 4339
70 Ga0070684_100179606 3300005535 Bacteria 1924
71 Ga0070684_100187769 3300005535 Bacteria 1880
72 Ga0070684_100326106 3300005535 Bacteria 1411
73 Ga0068853_100101126 3300005539 Bacteria 2549
74 Ga0068853_100153660 3300005539 Bacteria 2073
75 Ga0070672_100003410 3300005543 Bacteria 10310
76 Ga0070672_100142525 3300005543 Bacteria 1978
77 Ga0070693_100002739 3300005547 Bacteria 8119
78 Ga0070665_100016394 3300005548 Bacteria 7431
79 Ga0070665_100136404 3300005548 Bacteria 2457
80 Ga0070665_100137334 3300005548 Bacteria 2448
81 Ga0068855_100038141 3300005563 Bacteria 5709
82 Ga0068855_100068989 3300005563 Bacteria 4115
83 Ga0070664_100004260 3300005564 Bacteria 11503
84 Ga0070664_100008153 3300005564 Bacteria 8472
85 Ga0070664_100047343 3300005564 Bacteria 3632
86 Ga0070664_100489424 3300005564 Bacteria 1133
87 Ga0068857_100002362 3300005577 Bacteria 15385
88 Ga0068857_100006414 3300005577 Bacteria 10087
89 Ga0068857_100009160 3300005577 Bacteria 8591
90 Ga0068856_100201273 3300005614 Unclassified 2006
91 Ga0068852_100060988 3300005616 Bacteria 3276
92 Ga0068852_100085872 3300005616 Bacteria 2804
93 Ga0068852_100117710 3300005616 Bacteria 2427
94 Ga0068859_100226753 3300005617 Bacteria 1956
95 Ga0068864_100097180 3300005618 Bacteria 2607
96 Ga0068864_100356128 3300005618 Unclassified 1382
97 Ga0068866_10003665 3300005718 Bacteria 6295
98 Ga0068866_10100740 3300005718 Bacteria 1593
99 Ga0068861_100001999 3300005719 Bacteria 13184
100 Ga0068861_100009964 3300005719 Bacteria 6580
101 Ga0068861_100190750 3300005719 Bacteria 1713
102 Ga0068863_100017896 3300005841 Bacteria 6781
103 Ga0068862_100000229 3300005844 Bacteria 62419
104 Ga0070717_10001447 3300006028 Bacteria 16370
105 Ga0070717_10191067 3300006028 Bacteria 1789
106 Ga0070712_100148381 3300006175 Unclassified 1797
107 Ga0075428_100003592 3300006844 Bacteria 16998
108 Ga0075428_100286424 3300006844 Bacteria 1772
109 Ga0075430_100010496 3300006846 Bacteria 7841
110 Ga0075430_100020569 3300006846 Bacteria 5613
111 Ga0075433_10005554 3300006852 Bacteria 9904
112 Ga0075433_10027882 3300006852 Bacteria 4796
113 Ga0075434_100010884 3300006871 Bacteria 8552
114 Ga0075434_100018709 3300006871 Bacteria 6694
115 Ga0075434_100080814 3300006871 Bacteria 3248
116 Ga0075434_100208476 3300006871 Unclassified 1975
117 Ga0075429_100024251 3300006880 Bacteria 5262
118 Ga0068865_100006011 3300006881 Bacteria 7394
119 Ga0068865_100108419 3300006881 Bacteria 2044
120 Ga0097620_100226773 3300006931 Bacteria 1956
121 Ga0075435_100056641 3300007076 Bacteria 3169
122 Ga0075435_100129650 3300007076 Unclassified 2110
123 Ga0075435_100266957 3300007076 Bacteria 1459
124 Ga0105240_10122647 3300009093 Bacteria 3127
125 Ga0111539_10016112 3300009094 Bacteria 9275
126 Ga0111539_10156974 3300009094 Bacteria 2662
127 Ga0105245_10055693 3300009098 Bacteria 3553
128 Ga0105245_10403492 3300009098 Unclassified 1367
129 Ga0114129_10005444 3300009147 Bacteria 17986
130 Ga0114129_10020028 3300009147 Bacteria 9521
131 Ga0105241_10070861 3300009174 Bacteria 2705
132 Ga0105242_10009851 3300009176 Bacteria 7321
133 Ga0105248_10058707 3300009177 Bacteria 4321
134 Ga0105248_10065073 3300009177 Bacteria 4093
135 Ga0105237_10269894 3300009545 Bacteria 1704
136 Ga0105238_10112490 3300009551 Bacteria 2702
137 Ga0105238_10140752 3300009551 Bacteria 2389
138 Ga0105249_10000179 3300009553 Bacteria 74358
139 Ga0105249_10014689 3300009553 Bacteria 6923
140 Ga0105246_10046701 3300011119 Bacteria 2955
141 Ga0105246_10164829 3300011119 Bacteria 1691
142 Ga0157371_10028181 3300013102 Bacteria 4069
143 Ga0157369_10034346 3300013105 Bacteria 5567
144 Ga0157369_10325852 3300013105 Bacteria 1596
145 Ga0157374_10103276 3300013296 Bacteria 2735
146 Ga0157374_10499754 3300013296 Bacteria 1220
147 Ga0157378_10013705 3300013297 Bacteria 7091
148 Ga0163162_10023012 3300013306 Bacteria 6145
149 Ga0163162_10029644 3300013306 Bacteria 5416
150 Ga0157372_10016687 3300013307 Bacteria 7882
151 Ga0157372_10428681 3300013307 Bacteria 1541
152 Ga0157375_10006593 3300013308 Bacteria 10101
153 Ga0157375_10044198 3300013308 Bacteria 4326
154 Ga0157375_10078008 3300013308 Bacteria 3344
155 Ga0163163_10057313 3300014325 Bacteria 3852
156 Ga0163163_10431152 3300014325 Unclassified 1377
157 Ga0157380_10006512 3300014326 Bacteria 8234
158 Ga0157380_10021694 3300014326 Bacteria 4821
159 Ga0157380_10575562 3300014326 Bacteria 1109
160 Ga0157376_10038748 3300014969 Bacteria 3880
161 Ga0157376_10118078 3300014969 Bacteria 2346
162 Ga0163161_10010557 3300017792 Bacteria 6397
163 Ga0207697_10002219 3300025315 Bacteria 10144
164 Ga0207642_10024614 3300025899 Bacteria 2423
165 Ga0207688_10042919 3300025901 Bacteria 2518
166 Ga0207699_10024058 3300025906 Bacteria 3325
167 Ga0207699_10139512 3300025906 Bacteria 1592
168 Ga0207645_10000164 3300025907 Bacteria 52549
169 Ga0207645_10018616 3300025907 Bacteria 4563
170 Ga0207645_10198435 3300025907 Unclassified 1320
171 Ga0207684_10051329 3300025910 Unclassified 3499
172 Ga0207707_10007011 3300025912 Bacteria 9828
173 Ga0207707_10016102 3300025912 Bacteria 6520
174 Ga0207707_10192273 3300025912 Bacteria 1780
175 Ga0207695_10031761 3300025913 Bacteria 5786
176 Ga0207693_10008377 3300025915 Bacteria 8459
177 Ga0207693_10039915 3300025915 Unclassified 3696
178 Ga0207693_10097593 3300025915 Bacteria 2304
179 Ga0207663_10069522 3300025916 Unclassified 2265
180 Ga0207663_10072638 3300025916 Bacteria 2224
181 Ga0207662_10033931 3300025918 Bacteria 2978
182 Ga0207649_10013962 3300025920 Bacteria 4494
183 Ga0207649_10085839 3300025920 Bacteria 2049
184 Ga0207649_10108716 3300025920 Unclassified 1849
185 Ga0207649_10227989 3300025920 Bacteria 1331
186 Ga0207652_10001439 3300025921 Bacteria 21080
187 Ga0207652_10122278 3300025921 Bacteria 2316
188 Ga0207652_10215975 3300025921 Bacteria 1727
189 Ga0207652_10249323 3300025921 Bacteria 1601
190 Ga0207646_10225787 3300025922 Archaea 1692
191 Ga0207681_10002375 3300025923 Bacteria 11969
192 Ga0207681_10021313 3300025923 Bacteria 4118
193 Ga0207694_10090794 3300025924 Bacteria 2410
194 Ga0207694_10102786 3300025924 Bacteria 2266
195 Ga0207650_10010554 3300025925 Bacteria 6341
196 Ga0207650_10043095 3300025925 Bacteria 3311
197 Ga0207650_10216582 3300025925 Bacteria 1540
198 Ga0207659_10070480 3300025926 Bacteria 2549
199 Ga0207687_10096206 3300025927 Bacteria 2170
200 Ga0207700_10005993 3300025928 Bacteria 7313
201 Ga0207700_10006618 3300025928 Bacteria 7021
202 Ga0207700_10011579 3300025928 Bacteria 5632
203 Ga0207664_10044917 3300025929 Unclassified 3462
204 Ga0207664_10070901 3300025929 Bacteria 2805
205 Ga0207664_10074170 3300025929 Bacteria 2748
206 Ga0207644_10156295 3300025931 Bacteria 1769
207 Ga0207690_10006063 3300025932 Bacteria 7161
208 Ga0207706_10000199 3300025933 Bacteria 65959
209 Ga0207706_10100396 3300025933 Bacteria 2546
210 Ga0207686_10034110 3300025934 Bacteria 3043
211 Ga0207704_10013321 3300025938 Bacteria 4112
212 Ga0207691_10002168 3300025940 Bacteria 19197
213 Ga0207691_10002577 3300025940 Bacteria 17720
214 Ga0207691_10023436 3300025940 Bacteria 5811
215 Ga0207711_10021759 3300025941 Bacteria 5355
216 Ga0207711_10075683 3300025941 Bacteria 2930
217 Ga0207661_10004069 3300025944 Bacteria 10210
218 Ga0207661_10018107 3300025944 Bacteria 5231
219 Ga0207661_10058409 3300025944 Bacteria 3104
220 Ga0207679_10001393 3300025945 Bacteria 15233
221 Ga0207679_10002709 3300025945 Bacteria 10956
222 Ga0207679_10019596 3300025945 Bacteria 4547
223 Ga0207679_10035970 3300025945 Bacteria 3508
224 Ga0207679_10133527 3300025945 Bacteria 1995
225 Ga0207667_10021593 3300025949 Bacteria 7132
226 Ga0207667_10226811 3300025949 Bacteria 1913
227 Ga0207712_10001409 3300025961 Bacteria 16392
228 Ga0207712_10001568 3300025961 Bacteria 15391
229 Ga0207712_10040595 3300025961 Bacteria 3195
230 Ga0207668_10001288 3300025972 Bacteria 14924
231 Ga0207668_10118971 3300025972 Bacteria 1997
232 Ga0207658_10016723 3300025986 Bacteria 5049
233 Ga0207658_10147415 3300025986 Unclassified 1913
234 Ga0207658_10152632 3300025986 Bacteria 1884
235 Ga0207658_10226426 3300025986 Bacteria 1576
236 Ga0207677_10151734 3300026023 Bacteria 1789
237 Ga0207677_10258921 3300026023 Unclassified 1417
238 Ga0207639_10105792 3300026041 Bacteria 2283
239 Ga0207678_10016638 3300026067 Bacteria 6461
240 Ga0207641_10075457 3300026088 Bacteria 2911
241 Ga0207648_10010080 3300026089 Bacteria 8985
242 Ga0207648_10033459 3300026089 Bacteria 4534
243 Ga0207676_10093279 3300026095 Bacteria 2478
244 Ga0207674_10000687 3300026116 Bacteria 44015
245 Ga0207674_10001632 3300026116 Bacteria 28867
246 Ga0207674_10011250 3300026116 Bacteria 10059
247 Ga0207674_10169332 3300026116 Unclassified 2138
248 Ga0207675_100000275 3300026118 Bacteria 49008
249 Ga0207675_100002797 3300026118 Bacteria 17149
250 Ga0207683_10311174 3300026121 Unclassified 1442
251 Ga0207428_10042313 3300027907 Bacteria 3683
252 Ga0268266_10478994 3300028379 Unclassified 1186
253 Ga0268265_10001416 3300028380 Bacteria 20295
254 Ga0268264_10158530 3300028381 Bacteria 2036
255 Ga0265332_10009311 3300031238 Bacteria 4386
256 Ga0265332_10010011 3300031238 Bacteria 4223
257 Ga0265327_10038620 3300031251 Bacteria 2603
258 Ga0307408_100004998 3300031548 Bacteria 8900
259 Ga0307408_100037716 3300031548 Bacteria 3405
260 Ga0265314_10009159 3300031711 Bacteria 8401
261 Ga0265314_10015565 3300031711 Bacteria 6031
262 Ga0307413_10263488 3300031824 Bacteria 1286
263 Ga0307409_100283778 3300031995 Bacteria 1532
264 Ga0373926_0000513 3300035083 Bacteria 10290
265 Ga0373934_0000055 3300035086 Bacteria 38912
266 Ga0373934_0002207 3300035086 Bacteria 7150
267 Ga0373934_0004135 3300035086 Bacteria 5348
268 Ga0373923_0002242 3300035111 Bacteria 5884
269 Ga0373923_0034709 3300035111 Bacteria 2049
270 Ga0373956_0000677 3300035119 Bacteria 13979
271 Ga0373956_0089078 3300035119 Bacteria 1422
272 Ga0373957_0011777 3300035120 Bacteria 2928
273 Ga0373943_0018160 3300035170 Unclassified 3228
274 Ga0373955_0035624 3300035172 Bacteria 2636
275 Ga0373955_0233659 3300035172 Bacteria 1100
276 Ga0373924_0012811 3300035410 Bacteria 3139
277 Ga0373935_0016090 3300035692 Unclassified 4526
278 Ga0373933_0017807 3300035724 Unclassified 3987
279 Ga0373933_0077943 3300035724 Bacteria 2026
280 Ga0373947_0003037 3300035725 Bacteria 9984
281 Ga0373947_0080862 3300035725 Bacteria 2011
282 Ga0373947_0126590 3300035725 Unclassified 1627
283 Ga0373947_0274921 3300035725 Unclassified 1119
284 Ga0373937_0000332 3300036401 Bacteria 44807
285 Ga0373937_0001988 3300036401 Bacteria 17089
286 Ga0373925_0001411 3300037068 Bacteria 20869
287 Ga0373925_0135203 3300037068 Unclassified 1926
288 Ga0373925_0199116 3300037068 Bacteria 1592
289 Ga0373925_0206165 3300037068 Bacteria 1565
290 Ga0395905_0338411 3300037471 Bacteria 1396
291 Ga0436364_1302114 3300037853 Unclassified 1016
292 Ga0439448_0073182 3300042005 Bacteria 1143
293 Ga0439448_0096017 3300042005 Unclassified 1004
294 Ga0451577_0000001 3300042876 Bacteria 2461803
295 Ga0466966_0084699 3300044684 Bacteria 1971
296 Ga0466959_0080340 3300045049 Unclassified 2351
297 Ga0451576_0048545 3300045051 Bacteria 4458
298 Ga0451576_0195040 3300045051 Bacteria 2115
299 Ga0466967_0062098 3300045976 Bacteria 3316
300 Ga0466967_0251603 3300045976 Bacteria 1688
301 Ga0495592_0004747 3300046454 Bacteria 9977
302 Ga0495592_0131112 3300046454 Bacteria 1753
303 Ga0495629_0005502 3300046459 Bacteria 9459
304 Ga0495629_0006008 3300046459 Bacteria 9030
305 Ga0495651_0000644 3300046462 Bacteria 26939
306 Ga0495651_0002180 3300046462 Bacteria 15122
307 Ga0495651_0066087 3300046462 Bacteria 2761
308 Ga0495653_0000235 3300046463 Bacteria 44573
309 Ga0495653_0012923 3300046463 Bacteria 6813
310 Ga0495582_0007291 3300046473 Bacteria 6127
311 Ga0495582_0026653 3300046473 Bacteria 3168
312 Ga0495639_0001974 3300046475 Bacteria 9082
313 Ga0495639_0009127 3300046475 Bacteria 4250
314 Ga0495639_0031391 3300046475 Bacteria 2365
315 Ga0495594_0003691 3300046499 Bacteria 7860
316 Ga0495594_0046387 3300046499 Bacteria 2387
317 Ga0495608_0000945 3300046511 Bacteria 20441
318 Ga0495628_0027770 3300046516 Unclassified 4599
319 Ga0495628_0055768 3300046516 Bacteria 3112
320 Ga0495628_0142074 3300046516 Bacteria 1832
321 Ga0495630_0004649 3300046517 Bacteria 9634
322 Ga0495652_0001309 3300046529 Bacteria 27773
323 Ga0495652_0012740 3300046529 Bacteria 7575
324 Ga0495652_0115081 3300046529 Bacteria 2156
325 Ga0495665_0000328 3300046531 Bacteria 24141
326 Ga0495665_0109330 3300046531 Unclassified 1450
327 Ga0495587_0000163 3300046536 Bacteria 48430
328 Ga0495587_0019031 3300046536 Bacteria 4255
329 Ga0495587_0030800 3300046536 Bacteria 3252
330 Ga0495645_0000311 3300046543 Bacteria 35086
331 Ga0495645_0000429 3300046543 Bacteria 28928
332 Ga0495645_0095052 3300046543 Bacteria 2125
333 Ga0495645_0119325 3300046543 Unclassified 1858
334 Ga0495645_0134391 3300046543 Bacteria 1731
335 Ga0495667_0001262 3300046559 Bacteria 16592
336 Ga0495667_0031695 3300046559 Bacteria 3546
337 Ga0495667_0100802 3300046559 Unclassified 1868
338 Ga0495635_0000194 3300046663 Bacteria 38505
339 Ga0495588_0001322 3300046674 Bacteria 10579
340 Ga0495657_0000303 3300046675 Bacteria 44902
341 Ga0495599_0000119 3300046678 Bacteria 53129
342 Ga0495599_0012121 3300046678 Bacteria 5307
343 Ga0495623_0000362 3300046679 Bacteria 29744
344 Ga0495623_0054697 3300046679 Bacteria 2517
345 Ga0495623_0089531 3300046679 Bacteria 1891
346 Ga0495646_0005434 3300046680 Bacteria 8051
347 Ga0495658_0001067 3300046683 Bacteria 14472
348 Ga0495658_0067616 3300046683 Bacteria 2067
349 Ga0495613_0010692 3300046689 Bacteria 6806
350 Ga0495613_0020543 3300046689 Unclassified 4923
351 Ga0495600_0001820 3300046809 Bacteria 11940
352 Ga0495600_0153229 3300046809 Bacteria 1492
353 Ga0495581_0012287 3300047315 Unclassified 4960
354 Ga0495604_0000308 3300047317 Bacteria 43765
355 Ga0495604_0041881 3300047317 Bacteria 3590
356 Ga0495636_0019747 3300047318 Bacteria 2711
357 Ga0495674_0044718 3300047319 Bacteria 3935
358 Ga0495674_0090405 3300047319 Bacteria 2616
359 Ga0495674_0269389 3300047319 Unclassified 1398
360 Ga0495680_0029665 3300047322 Unclassified 4477
361 Ga0495675_0013282 3300047444 Bacteria 5197
362 Ga0495675_0074950 3300047444 Bacteria 2132
363 Ga0495684_0002144 3300047471 Bacteria 15813
364 Ga0495684_0008942 3300047471 Bacteria 7736
365 Ga0495593_0000726 3300047673 Bacteria 19078
366 Ga0495602_0004322 3300048088 Bacteria 14804
367 Ga0495602_0006394 3300048088 Bacteria 12359
368 Ga0495614_0000483 3300048089 Bacteria 16419
369 Ga0496104_0211326 3300048907 Bacteria 1852
370 Ga0501070_0111434 3300049586 Bacteria 2262
371 Ga0501080_0602068 3300049742 Unclassified 976
372 nmdc:mga05p37_22968_c1 3300050507 Bacteria 7565
373 nmdc:mga05p37_94710_c1 3300050507 Bacteria 3679
374 nmdc:mga09592_15007_c1 3300050508 Bacteria 6328
375 nmdc:mga0qj67_193656_c1 3300050509 Bacteria 1652
376 nmdc:mga08y16_64488_c1 3300050511 Bacteria 3825
377 nmdc:mga08y16_68251_c1 3300050511 Bacteria 3707
378 nmdc:mga0n895_136641_c1 3300050512 Bacteria 2478
379 nmdc:mga0n895_34511_c1 3300050512 Bacteria 4870
380 nmdc:mga0n895_5677_c1 3300050512 Bacteria 10458
381 nmdc:mga0n895_80155_c1 3300050512 Bacteria 3252
382 nmdc:mga0rr50_207147_c1 3300050513 Bacteria 1614
383 nmdc:mga0a205_18724_c1 3300050515 Bacteria 6517
384 nmdc:mga0a205_9606_c1 3300050515 Bacteria 8854
385 Ga0495601_0009459 3300053077 Bacteria 5766
386 Ga0495601_0140854 3300053077 Bacteria 1573
387 Ga0495612_0001083 3300053078 Bacteria 11158
388 Ga0495619_0040961 3300053085 Bacteria 3028
389 Ga0075434_100119115
390 Ga0065712_10133087
391 Ga0065707_10084553
392 Ga0070676_10031744
393 Ga0070683_100003552
394 Ga0070683_100019767
395 Ga0070683_100050428
396 Ga0070690_100106155
397 Ga0070670_100008398
398 Ga0070670_100012636
399 Ga0070670_100099553
400 Ga0070670_100112302
401 Ga0070670_100286893
402 Ga0070677_10012165
403 Ga0070680_100019542
404 Ga0070680_100187001
405 Ga0068868_100031092
406 Ga0068868_100051562
407 Ga0070691_10001622
408 Ga0070687_100029535
409 Ga0070661_100000704
410 Ga0070661_100051550
411 Ga0070661_100206478
412 Ga0070692_10012701
413 Ga0070668_100000424
414 Ga0070668_100129722
415 Ga0070669_100000845
416 Ga0070669_100018147
417 Ga0070669_100019161
418 Ga0070675_100006436
419 Ga0070675_100060669
420 Ga0070675_100555901
421 Ga0070674_100036343
422 Ga0070674_100101474
423 Ga0070673_100042454
424 Ga0070673_100051822
425 Ga0070688_100014200
426 Ga0070688_100031828
427 Ga0070659_100008205
428 Ga0070659_100016273
429 Ga0070667_100001910
430 Ga0070667_100025672
431 Ga0070667_100176910
432 Ga0070709_10001888
433 Ga0070709_10026223
434 Ga0070714_100003575
435 Ga0070714_100009199
436 Ga0070714_100090099
437 Ga0070713_100001556
438 Ga0070713_100008877
439 Ga0070713_100011083
440 Ga0070710_10172574
441 Ga0070708_100000006
442 Ga0070663_100055375
443 Ga0070678_100273790
444 Ga0070662_100056746
445 Ga0070662_100174009
446 Ga0070681_10000981
447 Ga0070681_10002640
448 Ga0070681_10035065
449 Ga0068867_100017247
450 Ga0070685_10014011
451 Ga0070706_100059110
452 Ga0070679_100000476
453 Ga0070679_100051441
454 Ga0070679_100141938
455 Ga0070679_100404330
456 Ga0070684_100018357
457 Ga0070684_100034291
458 Ga0070684_100179606
459 Ga0070684_100187769
460 Ga0070684_100326106
461 Ga0068853_100101126
462 Ga0068853_100153660
463 Ga0070672_100003410
464 Ga0070672_100142525
465 Ga0070693_100002739
466 Ga0070665_100016394
467 Ga0070665_100136404
468 Ga0070665_100137334
469 Ga0068855_100038141
470 Ga0068855_100068989
471 Ga0070664_100004260
472 Ga0070664_100008153
473 Ga0070664_100047343
474 Ga0070664_100489424
475 Ga0068857_100002362
476 Ga0068857_100006414
477 Ga0068857_100009160
478 Ga0068856_100201273
479 Ga0068852_100060988
480 Ga0068852_100085872
481 Ga0068852_100117710
482 Ga0068859_100226753
483 Ga0068864_100097180
484 Ga0068864_100356128
485 Ga0068866_10003665
486 Ga0068866_10100740
487 Ga0068861_100001999
488 Ga0068861_100009964
489 Ga0068861_100190750
490 Ga0068863_100017896
491 Ga0068862_100000229
492 Ga0070717_10001447
493 Ga0070717_10191067
494 Ga0070712_100148381
495 Ga0075428_100003592
496 Ga0075428_100286424
497 Ga0075430_100010496
498 Ga0075430_100020569
499 Ga0075433_10005554
500 Ga0075433_10027882
501 Ga0075434_100010884
502 Ga0075434_100018709
503 Ga0075434_100080814
504 Ga0075434_100208476
505 Ga0075429_100024251
506 Ga0068865_100006011
507 Ga0068865_100108419
508 Ga0097620_100226773
509 Ga0075435_100056641
510 Ga0075435_100129650
511 Ga0075435_100266957
512 Ga0105240_10122647
513 Ga0111539_10016112
514 Ga0111539_10156974
515 Ga0105245_10055693
516 Ga0105245_10403492
517 Ga0114129_10005444
518 Ga0114129_10020028
519 Ga0105241_10070861
520 Ga0105242_10009851
521 Ga0105248_10058707
522 Ga0105248_10065073
523 Ga0105237_10269894
524 Ga0105238_10112490
525 Ga0105238_10140752
526 Ga0105249_10000179
527 Ga0105249_10014689
528 Ga0105246_10046701
529 Ga0105246_10164829
530 Ga0157371_10028181
531 Ga0157369_10034346
532 Ga0157369_10325852
533 Ga0157374_10103276
534 Ga0157374_10499754
535 Ga0157378_10013705
536 Ga0163162_10023012
537 Ga0163162_10029644
538 Ga0157372_10016687
539 Ga0157372_10428681
540 Ga0157375_10006593
541 Ga0157375_10044198
542 Ga0157375_10078008
543 Ga0163163_10057313
544 Ga0163163_10431152
545 Ga0157380_10006512
546 Ga0157380_10021694
547 Ga0157380_10575562
548 Ga0157376_10038748
549 Ga0157376_10118078
550 Ga0163161_10010557
551 Ga0207697_10002219
552 Ga0207642_10024614
553 Ga0207688_10042919
554 Ga0207699_10024058
555 Ga0207699_10139512
556 Ga0207645_10000164
557 Ga0207645_10018616
558 Ga0207645_10198435
559 Ga0207684_10051329
560 Ga0207707_10007011
561 Ga0207707_10016102
562 Ga0207707_10192273
563 Ga0207695_10031761
564 Ga0207693_10008377
565 Ga0207693_10039915
566 Ga0207693_10097593
567 Ga0207663_10069522
568 Ga0207663_10072638
569 Ga0207662_10033931
570 Ga0207649_10013962
571 Ga0207649_10085839
572 Ga0207649_10108716
573 Ga0207649_10227989
574 Ga0207652_10001439
575 Ga0207652_10122278
576 Ga0207652_10215975
577 Ga0207652_10249323
578 Ga0207646_10225787
579 Ga0207681_10002375
580 Ga0207681_10021313
581 Ga0207694_10090794
582 Ga0207694_10102786
583 Ga0207650_10010554
584 Ga0207650_10043095
585 Ga0207650_10216582
586 Ga0207659_10070480
587 Ga0207687_10096206
588 Ga0207700_10005993
589 Ga0207700_10006618
590 Ga0207700_10011579
591 Ga0207664_10044917
592 Ga0207664_10070901
593 Ga0207664_10074170
594 Ga0207644_10156295
595 Ga0207690_10006063
596 Ga0207706_10000199
597 Ga0207706_10100396
598 Ga0207686_10034110
599 Ga0207704_10013321
600 Ga0207691_10002168
601 Ga0207691_10002577
602 Ga0207691_10023436
603 Ga0207711_10021759
604 Ga0207711_10075683
605 Ga0207661_10004069
606 Ga0207661_10018107
607 Ga0207661_10058409
608 Ga0207679_10001393
609 Ga0207679_10002709
610 Ga0207679_10019596
611 Ga0207679_10035970
612 Ga0207679_10133527
613 Ga0207667_10021593
614 Ga0207667_10226811
615 Ga0207712_10001409
616 Ga0207712_10001568
617 Ga0207712_10040595
618 Ga0207668_10001288
619 Ga0207668_10118971
620 Ga0207658_10016723
621 Ga0207658_10147415
622 Ga0207658_10152632
623 Ga0207658_10226426
624 Ga0207677_10151734
625 Ga0207677_10258921
626 Ga0207639_10105792
627 Ga0207678_10016638
628 Ga0207641_10075457
629 Ga0207648_10010080
630 Ga0207648_10033459
631 Ga0207676_10093279
632 Ga0207674_10000687
633 Ga0207674_10001632
634 Ga0207674_10011250
635 Ga0207674_10169332
636 Ga0207675_100000275
637 Ga0207675_100002797
638 Ga0207683_10311174
639 Ga0207428_10042313
640 Ga0268266_10478994
641 Ga0268265_10001416
642 Ga0268264_10158530
643 Ga0265332_10009311
644 Ga0265332_10010011
645 Ga0265327_10038620
646 Ga0307408_100004998
647 Ga0307408_100037716
648 Ga0265314_10009159
649 Ga0265314_10015565
650 Ga0307413_10263488
651 Ga0307409_100283778
652 Ga0373926_0000513
653 Ga0373934_0000055
654 Ga0373934_0002207
655 Ga0373934_0004135
656 Ga0373923_0002242
657 Ga0373923_0034709
658 Ga0373956_0000677
659 Ga0373956_0089078
660 Ga0373957_0011777
661 Ga0373943_0018160
662 Ga0373955_0035624
663 Ga0373955_0233659
664 Ga0373924_0012811
665 Ga0373935_0016090
666 Ga0373933_0017807
667 Ga0373933_0077943
668 Ga0373947_0003037
669 Ga0373947_0080862
670 Ga0373947_0126590
671 Ga0373947_0274921
672 Ga0373937_0000332
673 Ga0373937_0001988
674 Ga0373925_0001411
675 Ga0373925_0135203
676 Ga0373925_0199116
677 Ga0373925_0206165
678 Ga0395905_0338411
679 Ga0436364_1302114
680 Ga0439448_0073182
681 Ga0439448_0096017
682 Ga0451577_0000001
683 Ga0466966_0084699
684 Ga0466959_0080340
685 Ga0451576_0048545
686 Ga0451576_0195040
687 Ga0466967_0062098
688 Ga0466967_0251603
689 Ga0495592_0004747
690 Ga0495592_0131112
691 Ga0495629_0005502
692 Ga0495629_0006008
693 Ga0495651_0000644
694 Ga0495651_0002180
695 Ga0495651_0066087
696 Ga0495653_0000235
697 Ga0495653_0012923
698 Ga0495582_0007291
699 Ga0495582_0026653
700 Ga0495639_0001974
701 Ga0495639_0009127
702 Ga0495639_0031391
703 Ga0495594_0003691
704 Ga0495594_0046387
705 Ga0495608_0000945
706 Ga0495628_0027770
707 Ga0495628_0055768
708 Ga0495628_0142074
709 Ga0495630_0004649
710 Ga0495652_0001309
711 Ga0495652_0012740
712 Ga0495652_0115081
713 Ga0495665_0000328
714 Ga0495665_0109330
715 Ga0495587_0000163
716 Ga0495587_0019031
717 Ga0495587_0030800
718 Ga0495645_0000311
719 Ga0495645_0000429
720 Ga0495645_0095052
721 Ga0495645_0119325
722 Ga0495645_0134391
723 Ga0495667_0001262
724 Ga0495667_0031695
725 Ga0495667_0100802
726 Ga0495635_0000194
727 Ga0495588_0001322
728 Ga0495657_0000303
729 Ga0495599_0000119
730 Ga0495599_0012121
731 Ga0495623_0000362
732 Ga0495623_0054697
733 Ga0495623_0089531
734 Ga0495646_0005434
735 Ga0495658_0001067
736 Ga0495658_0067616
737 Ga0495613_0010692
738 Ga0495613_0020543
739 Ga0495600_0001820
740 Ga0495600_0153229
741 Ga0495581_0012287
742 Ga0495604_0000308
743 Ga0495604_0041881
744 Ga0495636_0019747
745 Ga0495674_0044718
746 Ga0495674_0090405
747 Ga0495674_0269389
748 Ga0495680_0029665
749 Ga0495675_0013282
750 Ga0495675_0074950
751 Ga0495684_0002144
752 Ga0495684_0008942
753 Ga0495593_0000726
754 Ga0495602_0004322
755 Ga0495602_0006394
756 Ga0495614_0000483
757 Ga0496104_0211326
758 Ga0501070_0111434
759 Ga0501080_0602068
760 nmdc:mga05p37_22968_c1
761 nmdc:mga05p37_94710_c1
762 nmdc:mga09592_15007_c1
763 nmdc:mga0qj67_193656_c1
764 nmdc:mga08y16_64488_c1
765 nmdc:mga08y16_68251_c1
766 nmdc:mga0n895_136641_c1
767 nmdc:mga0n895_34511_c1
768 nmdc:mga0n895_5677_c1
769 nmdc:mga0n895_80155_c1
770 nmdc:mga0rr50_207147_c1
771 nmdc:mga0a205_18724_c1
772 nmdc:mga0a205_9606_c1
773 Ga0495601_0009459
774 Ga0495601_0140854
775 Ga0495612_0001083
776 Ga0495619_0040961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.7357 41 59
5aeo-assembly2.cif.gz_B virulence-associated protein vapg from the intracellular pathogen rhodococcus equi 0.7271 30 90
7b1z-assembly2.cif.gz_B virulence-associated protein vapb from the intracellular pathogen rhodococcus equi 0.7264 30 90
4wac-assembly1.cif.gz_A crystal structure of tarm 0.7174 35 71
4x7r-assembly1.cif.gz_A crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp 0.6792 29 71
ID Description Score Start End Superfamily
af_A0A0G2JTH1_445_522_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8032 33 63 3.30.160.20
af_Q47158_1_148_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.774 42 65 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7404 40 59 3.40.630.30
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7278 35 71 3.40.50.2000
5aeoB00 Mainly Beta;Beta Barrel;Lipocalin;Rhodococcus equi virulence-associated protein 0.7271 30 90 2.40.128.480
ID Description Score Start End GO Terms
AF-A0A534PKU4-F1-model_v4 Response regulator 0.9291 118 156 GO:0000160
AF-A0A2V7T5C2-F1-model_v4 Uncharacterized protein 0.8818 1 314
AF-A0A2V7T5C2-F1-model_v4 Uncharacterized protein 0.8766 1 314
AF-A0A7C2M0G0-F1-model_v4 DUF4388 domain-containing protein 0.8421 23 315
AF-A0A2V7M937-F1-model_v4 Uncharacterized protein 0.8394 199 315

Map