F431054

General Info

Members Datasets Scaffolds Average Seq Length
388 213 776 199

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100396175|Ga0070695_1003961751
Length 189
Sequence LRTIVKGKNYEVPEPVREYAQRKLRRLERLLDDQSDATVELSVDQHRSVQASHLLDVTLVVHGQTLRSSAAAATHKAGIDAVLDKVERRAVTFRETSRVRKSSETVRGAGSAPETGIVKVKRFAIEPMFEEDAVARMEELGHSFFVFVNAENERVSILYRRREGDYGLIEPVVGGGYTKGGPIRRSGAH

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 7.47
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 13.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100396175 3300005545 Bacteria 1046
2 Ga0070676_10051723 3300005328 Bacteria 2413
3 Ga0070683_100103723 3300005329 Bacteria 2680
4 Ga0070683_100327896 3300005329 Bacteria 1457
5 Ga0070690_100075611 3300005330 Bacteria 2196
6 Ga0070690_100392115 3300005330 Bacteria 1018
7 Ga0070670_100234108 3300005331 Bacteria 1599
8 Ga0068869_100218354 3300005334 Bacteria 1510
9 Ga0068869_100353139 3300005334 Bacteria 1199
10 Ga0070680_100253747 3300005336 Bacteria 1487
11 Ga0070680_100284616 3300005336 Bacteria 1401
12 Ga0070682_100164777 3300005337 Bacteria 1534
13 Ga0068868_100052418 3300005338 Bacteria 3212
14 Ga0068868_100443693 3300005338 Bacteria 1128
15 Ga0070689_100041016 3300005340 Bacteria 3551
16 Ga0070687_100020822 3300005343 Bacteria 3073
17 Ga0070687_100049147 3300005343 Bacteria 2172
18 Ga0070687_100295081 3300005343 Bacteria 1026
19 Ga0070661_100053641 3300005344 Unclassified 2951
20 Ga0070692_10297707 3300005345 Bacteria 984
21 Ga0070692_10313472 3300005345 Bacteria 962
22 Ga0070668_100093434 3300005347 Bacteria 2374
23 Ga0070669_100086278 3300005353 Bacteria 2345
24 Ga0070675_100022470 3300005354 Bacteria 5040
25 Ga0070674_100247539 3300005356 Bacteria 1398
26 Ga0070673_100022750 3300005364 Bacteria 4568
27 Ga0070688_100020391 3300005365 Bacteria 3854
28 Ga0070659_100157534 3300005366 Bacteria 1855
29 Ga0070667_100252197 3300005367 Bacteria 1578
30 Ga0070667_100493461 3300005367 Bacteria 1122
31 Ga0070703_10034207 3300005406 Bacteria 1550
32 Ga0070701_10362451 3300005438 Bacteria 908
33 Ga0070705_100226179 3300005440 Bacteria 1298
34 Ga0070705_100317933 3300005440 Bacteria 1122
35 Ga0070700_100172926 3300005441 Bacteria 1497
36 Ga0070694_100007237 3300005444 Bacteria 6758
37 Ga0070694_100039784 3300005444 Bacteria 3132
38 Ga0070694_100074219 3300005444 Bacteria 2351
39 Ga0070694_100304751 3300005444 Bacteria 1222
40 Ga0070708_100013321 3300005445 Bacteria 6730
41 Ga0070708_100121437 3300005445 Bacteria 2410
42 Ga0070708_100966748 3300005445 Unclassified 799
43 Ga0070663_100120174 3300005455 Bacteria 1984
44 Ga0070663_100377898 3300005455 Unclassified 1153
45 Ga0070678_100113280 3300005456 Unclassified 2126
46 Ga0070662_100898218 3300005457 Bacteria 756
47 Ga0068867_100003110 3300005459 Bacteria 11701
48 Ga0070685_10063592 3300005466 Bacteria 2167
49 Ga0070706_100000164 3300005467 Bacteria 84577
50 Ga0070706_100075298 3300005467 Bacteria 3123
51 Ga0070706_100683960 3300005467 Bacteria 952
52 Ga0070707_100000583 3300005468 Bacteria 36726
53 Ga0070707_100003168 3300005468 Bacteria 15566
54 Ga0070707_100089442 3300005468 Bacteria 2980
55 Ga0070707_100218106 3300005468 Bacteria 1859
56 Ga0070698_100052298 3300005471 Bacteria 4156
57 Ga0070698_100118800 3300005471 Bacteria 2605
58 Ga0070698_100293181 3300005471 Bacteria 1558
59 Ga0070698_100304137 3300005471 Bacteria 1525
60 Ga0070699_100000536 3300005518 Bacteria 35818
61 Ga0070699_100075930 3300005518 Bacteria 2925
62 Ga0070699_100214363 3300005518 Bacteria 1715
63 Ga0070679_100125467 3300005530 Bacteria 2549
64 Ga0070679_100524848 3300005530 Bacteria 1128
65 Ga0070684_100274649 3300005535 Bacteria 1543
66 Ga0070697_100002368 3300005536 Bacteria 14499
67 Ga0070697_100110861 3300005536 Viruses 2287
68 Ga0070697_100322402 3300005536 Bacteria 1331
69 Ga0070697_100615057 3300005536 Bacteria 955
70 Ga0068853_100196236 3300005539 Bacteria 1836
71 Ga0070686_100017953 3300005544 Bacteria 4143
72 Ga0070686_100019577 3300005544 Bacteria 3991
73 Ga0070686_100089225 3300005544 Bacteria 2059
74 Ga0070695_100017071 3300005545 Bacteria 4402
75 Ga0070695_100069524 3300005545 Bacteria 2301
76 Ga0070696_100010379 3300005546 Bacteria 6241
77 Ga0070696_100132988 3300005546 Bacteria 1812
78 Ga0070696_100154374 3300005546 Bacteria 1687
79 Ga0070693_100047741 3300005547 Bacteria 2437
80 Ga0070693_100065772 3300005547 Bacteria 2120
81 Ga0070693_100309351 3300005547 Bacteria 1068
82 Ga0070665_100357139 3300005548 Bacteria 1467
83 Ga0070704_100062038 3300005549 Bacteria 2678
84 Ga0070704_100125759 3300005549 Bacteria 1978
85 Ga0070704_100632123 3300005549 Bacteria 943
86 Ga0068857_100488471 3300005577 Bacteria 1154
87 Ga0068856_100865798 3300005614 Bacteria 923
88 Ga0068856_100965699 3300005614 Bacteria 871
89 Ga0070702_100084128 3300005615 Bacteria 1913
90 Ga0068852_100309445 3300005616 Bacteria 1531
91 Ga0068859_100048900 3300005617 Bacteria 4247
92 Ga0068864_100007479 3300005618 Bacteria 8998
93 Ga0068866_10011642 3300005718 Bacteria 3813
94 Ga0068861_100159994 3300005719 Bacteria 1857
95 Ga0068861_100723960 3300005719 Bacteria 927
96 Ga0068870_10035689 3300005840 Unclassified 2554
97 Ga0068860_100046585 3300005843 Bacteria 4134
98 Ga0068860_100067450 3300005843 Bacteria 3399
99 Ga0068860_100365386 3300005843 Bacteria 1422
100 Ga0068862_100613440 3300005844 Bacteria 1046
101 Ga0081455_10124828 3300005937 Bacteria 2022
102 Ga0081539_10007283 3300005985 Bacteria 10155
103 Ga0081539_10023265 3300005985 Bacteria 4065
104 Ga0075365_10317202 3300006038 Bacteria 1098
105 Ga0097621_100277727 3300006237 Bacteria 1474
106 Ga0097621_100627998 3300006237 Bacteria 984
107 Ga0075428_100042054 3300006844 Bacteria 5026
108 Ga0075431_100214541 3300006847 Bacteria 1965
109 Ga0075434_100945935 3300006871 Viruses 876
110 Ga0068865_100120806 3300006881 Bacteria 1948
111 Ga0097620_100048901 3300006931 Bacteria 4247
112 Ga0097620_101283210 3300006931 Unclassified 807
113 Ga0105251_10114358 3300009011 Bacteria 1228
114 Ga0105240_10838800 3300009093 Bacteria 993
115 Ga0111539_10016989 3300009094 Bacteria 9006
116 Ga0105245_10105353 3300009098 Bacteria 2616
117 Ga0105245_10614897 3300009098 Bacteria 1114
118 Ga0105245_10918095 3300009098 Bacteria 918
119 Ga0105247_10068253 3300009101 Bacteria 2217
120 Ga0114129_10012756 3300009147 Bacteria 11962
121 Ga0114129_10050093 3300009147 Bacteria 5868
122 Ga0114129_10170188 3300009147 Bacteria 2971
123 Ga0105243_10024359 3300009148 Bacteria 4615
124 Ga0105243_10068104 3300009148 Bacteria 2868
125 Ga0105243_10522119 3300009148 Bacteria 1129
126 Ga0105243_11092067 3300009148 Unclassified 806
127 Ga0105241_10494435 3300009174 Bacteria 1089
128 Ga0105241_10994647 3300009174 Bacteria 784
129 Ga0105242_10066868 3300009176 Bacteria 2970
130 Ga0105242_10214989 3300009176 Unclassified 1715
131 Ga0105242_10278813 3300009176 Bacteria 1518
132 Ga0105249_10037603 3300009553 Bacteria 4392
133 Ga0105249_10059613 3300009553 Bacteria 3500
134 Ga0105246_10311624 3300011119 Unclassified 1275
135 Ga0105246_10459561 3300011119 Bacteria 1072
136 Ga0105246_10564420 3300011119 Bacteria 977
137 Ga0157371_10304258 3300013102 Bacteria 1155
138 Ga0157374_11334967 3300013296 Unclassified 739
139 Ga0157378_10031357 3300013297 Bacteria 4696
140 Ga0157378_10170012 3300013297 Bacteria 2044
141 Ga0157378_10392506 3300013297 Bacteria 1365
142 Ga0163162_10167910 3300013306 Bacteria 2318
143 Ga0163162_11146666 3300013306 Bacteria 881
144 Ga0163162_11200494 3300013306 Bacteria 861
145 Ga0157375_10138372 3300013308 Bacteria 2560
146 Ga0157375_10407303 3300013308 Unclassified 1526
147 Ga0157375_10570322 3300013308 Bacteria 1292
148 Ga0163163_10023674 3300014325 Bacteria 5831
149 Ga0163163_10118545 3300014325 Bacteria 2679
150 Ga0163163_10122090 3300014325 Bacteria 2640
151 Ga0163163_10216077 3300014325 Bacteria 1966
152 Ga0163163_10717289 3300014325 Bacteria 1063
153 Ga0157380_10015756 3300014326 Bacteria 5560
154 Ga0157380_10921590 3300014326 Bacteria 901
155 Ga0182008_10085977 3300014497 Bacteria 1549
156 Ga0157377_10038164 3300014745 Unclassified 2651
157 Ga0157377_10043771 3300014745 Bacteria 2493
158 Ga0157379_10143838 3300014968 Bacteria 2150
159 Ga0157379_10355705 3300014968 Bacteria 1341
160 Ga0157379_10536535 3300014968 Unclassified 1087
161 Ga0163161_10039637 3300017792 Bacteria 3383
162 Ga0207642_10135182 3300025899 Bacteria 1292
163 Ga0207688_10012387 3300025901 Bacteria 4639
164 Ga0207645_10299767 3300025907 Bacteria 1070
165 Ga0207643_10084559 3300025908 Bacteria 1842
166 Ga0207684_10000452 3300025910 Bacteria 53994
167 Ga0207684_10146657 3300025910 Bacteria 2030
168 Ga0207684_10292082 3300025910 Unclassified 1405
169 Ga0207707_10810169 3300025912 Bacteria 780
170 Ga0207663_10697683 3300025916 Bacteria 803
171 Ga0207660_10409969 3300025917 Bacteria 1092
172 Ga0207662_10012565 3300025918 Bacteria 4718
173 Ga0207662_10273439 3300025918 Bacteria 1116
174 Ga0207662_10442139 3300025918 Unclassified 888
175 Ga0207657_10119187 3300025919 Bacteria 2172
176 Ga0207649_10174874 3300025920 Bacteria 1498
177 Ga0207646_10003632 3300025922 Bacteria 17258
178 Ga0207646_10023209 3300025922 Bacteria 5701
179 Ga0207646_10049195 3300025922 Bacteria 3776
180 Ga0207646_10228723 3300025922 Bacteria 1680
181 Ga0207681_10125699 3300025923 Bacteria 1888
182 Ga0207650_10138687 3300025925 Bacteria 1910
183 Ga0207659_10141335 3300025926 Bacteria 1869
184 Ga0207659_10384252 3300025926 Bacteria 1171
185 Ga0207687_10144541 3300025927 Bacteria 1808
186 Ga0207687_10282671 3300025927 Unclassified 1330
187 Ga0207706_10130617 3300025933 Bacteria 2209
188 Ga0207706_10149122 3300025933 Bacteria 2057
189 Ga0207706_10290769 3300025933 Bacteria 1425
190 Ga0207706_10532662 3300025933 Bacteria 1012
191 Ga0207686_10092482 3300025934 Bacteria 2000
192 Ga0207686_10681702 3300025934 Unclassified 815
193 Ga0207709_10264577 3300025935 Bacteria 1263
194 Ga0207709_10302441 3300025935 Unclassified 1190
195 Ga0207670_10096115 3300025936 Bacteria 2106
196 Ga0207665_10186471 3300025939 Bacteria 1505
197 Ga0207691_10015057 3300025940 Bacteria 7360
198 Ga0207689_10173386 3300025942 Bacteria 1778
199 Ga0207689_10482091 3300025942 Bacteria 1038
200 Ga0207661_10070121 3300025944 Bacteria 2861
201 Ga0207661_10725425 3300025944 Bacteria 914
202 Ga0207679_11011048 3300025945 Bacteria 762
203 Ga0207679_11262290 3300025945 Bacteria 678
204 Ga0207651_10057501 3300025960 Bacteria 2683
205 Ga0207651_10128077 3300025960 Bacteria 1938
206 Ga0207712_10103169 3300025961 Bacteria 2125
207 Ga0207712_10192450 3300025961 Unclassified 1611
208 Ga0207640_10465495 3300025981 Bacteria 1045
209 Ga0207677_10189160 3300026023 Bacteria 1627
210 Ga0207678_10012791 3300026067 Bacteria 7369
211 Ga0207678_10330175 3300026067 Unclassified 1313
212 Ga0207708_10002055 3300026075 Bacteria 14820
213 Ga0207708_10332687 3300026075 Bacteria 1242
214 Ga0207702_10454236 3300026078 Bacteria 1243
215 Ga0207641_10132879 3300026088 Bacteria 2237
216 Ga0207648_10019729 3300026089 Bacteria 6082
217 Ga0207676_10076470 3300026095 Bacteria 2705
218 Ga0207674_10010314 3300026116 Bacteria 10597
219 Ga0207675_100170076 3300026118 Bacteria 2083
220 Ga0207683_10088400 3300026121 Bacteria 2757
221 Ga0207683_10221556 3300026121 Unclassified 1724
222 Ga0207698_10212191 3300026142 Bacteria 1743
223 Ga0207698_10252806 3300026142 Bacteria 1614
224 Ga0268266_10632754 3300028379 Bacteria 1029
225 Ga0268264_10027896 3300028381 Bacteria 4616
226 Ga0316578_10070323 3300031728 Bacteria 2072
227 Ga0307406_10145018 3300031901 Bacteria 1686
228 Ga0307406_10640701 3300031901 Bacteria 881
229 Ga0307407_10327173 3300031903 Bacteria 1078
230 Ga0307409_100083757 3300031995 Unclassified 2587
231 Ga0307409_100565087 3300031995 Bacteria 1119
232 Ga0307416_100093497 3300032002 Bacteria 2590
233 Ga0307416_100780073 3300032002 Bacteria 1050
234 Ga0307411_10102529 3300032005 Unclassified 2028
235 Ga0307415_100009989 3300032126 Bacteria 5354
236 Ga0307415_100209307 3300032126 Bacteria 1554
237 Ga0316583_10085986 3300032133 Bacteria 1098
238 Ga0316580_10098503 3300032139 Bacteria 895
239 Ga0373952_0081373 3300035092 Bacteria 827
240 Ga0316574_0067959 3300035398 Bacteria 2247
241 Ga0373931_0399619 3300035691 Bacteria 870
242 Ga0395905_1179932 3300037471 Unclassified 669
243 Ga0439465_0121298 3300041413 Bacteria 917
244 Ga0451845_0175417 3300041501 Bacteria 914
245 Ga0451853_2727328 3300041512 Unclassified 876
246 Ga0450917_002173 3300042120 Bacteria 1400
247 Ga0439458_0050129 3300042157 Unclassified 1029
248 Ga0451577_0042002 3300042876 Bacteria 4102
249 Ga0451577_0219637 3300042876 Bacteria 1718
250 Ga0453684_0183053 3300044712 Bacteria 2458
251 Ga0453684_1703493 3300044712 Bacteria 644
252 Ga0495584_0100259 3300046491 Unclassified 1464
253 Ga0495618_0494692 3300046514 Unclassified 738
254 Ga0495628_0663286 3300046516 Unclassified 740
255 Ga0495656_0039100 3300046615 Bacteria 1969
256 Ga0495669_0122509 3300046684 Bacteria 1220
257 Ga0495604_0527166 3300047317 Bacteria 764
258 Ga0495674_0618523 3300047319 Bacteria 857
259 Ga0495676_0474259 3300047321 Bacteria 824
260 Ga0496101_0137423 3300048904 Bacteria 1861
261 Ga0496102_0079426 3300048905 Bacteria 3021
262 Ga0496102_0281654 3300048905 Bacteria 1567
263 Ga0496102_0354179 3300048905 Bacteria 1382
264 Ga0496102_0367810 3300048905 Bacteria 1353
265 Ga0496103_0024775 3300048906 Bacteria 3621
266 Ga0496104_0018099 3300048907 Bacteria 6424
267 Ga0496104_0033076 3300048907 Bacteria 4813
268 Ga0496105_0005647 3300048908 Bacteria 9521
269 Ga0496105_0224733 3300048908 Unclassified 1527
270 Ga0496106_0061297 3300048909 Unclassified 2853
271 Ga0496106_0199865 3300048909 Bacteria 1591
272 Ga0496106_0354744 3300048909 Bacteria 1178
273 Ga0496106_0533328 3300048909 Bacteria 942
274 Ga0496107_0031585 3300048910 Bacteria 3781
275 Ga0496107_0183431 3300048910 Bacteria 1554
276 Ga0496107_0595124 3300048910 Bacteria 818
277 Ga0496108_0017953 3300048911 Bacteria 5788
278 Ga0496108_0170200 3300048911 Bacteria 1885
279 Ga0496108_0842749 3300048911 Unclassified 789
280 Ga0496109_0001700 3300048912 Bacteria 18346
281 Ga0496110_0010075 3300048913 Bacteria 7674
282 Ga0496110_0236124 3300048913 Bacteria 1663
283 Ga0496111_0217349 3300048914 Unclassified 1420
284 Ga0496112_0150380 3300048915 Bacteria 2295
285 Ga0496112_0190765 3300048915 Bacteria 2011
286 Ga0496113_0115329 3300048916 Bacteria 2095
287 Ga0496114_0164779 3300048917 Bacteria 1929
288 Ga0496114_0275874 3300048917 Unclassified 1482
289 Ga0501031_0064872 3300049568 Bacteria 2379
290 Ga0501031_0175881 3300049568 Bacteria 1398
291 Ga0501032_0222242 3300049569 Bacteria 1229
292 Ga0501033_0116120 3300049570 Bacteria 1945
293 Ga0501033_0717187 3300049570 Bacteria 680
294 Ga0501036_0059905 3300049572 Bacteria 3226
295 Ga0501036_0759602 3300049572 Bacteria 799
296 Ga0501037_0444945 3300049573 Bacteria 884
297 Ga0501038_0056257 3300049574 Bacteria 3378
298 Ga0501038_0142860 3300049574 Bacteria 1957
299 Ga0501039_0133041 3300049575 Unclassified 1952
300 Ga0501040_0050530 3300049576 Bacteria 2844
301 Ga0501040_0119174 3300049576 Bacteria 1851
302 Ga0501040_0256257 3300049576 Bacteria 1248
303 Ga0501041_0032667 3300049577 Bacteria 3146
304 Ga0501041_0042570 3300049577 Bacteria 2760
305 Ga0501041_0223165 3300049577 Bacteria 1182
306 Ga0501042_0007255 3300049578 Bacteria 7251
307 Ga0501042_0049337 3300049578 Bacteria 3003
308 Ga0501042_0171900 3300049578 Bacteria 1563
309 Ga0501042_0614465 3300049578 Unclassified 790
310 Ga0501043_0405100 3300049579 Bacteria 1030
311 Ga0501046_0305388 3300049580 Bacteria 1161
312 Ga0501046_0324684 3300049580 Bacteria 1121
313 Ga0501048_0010191 3300049582 Bacteria 7030
314 Ga0501048_0020323 3300049582 Bacteria 4867
315 Ga0501048_0233419 3300049582 Bacteria 1305
316 Ga0501048_0580057 3300049582 Bacteria 805
317 Ga0501067_0104965 3300049583 Unclassified 1570
318 Ga0501067_0410676 3300049583 Unclassified 755
319 Ga0501068_0096363 3300049584 Unclassified 1830
320 Ga0501068_0261494 3300049584 Bacteria 1104
321 Ga0501069_0209610 3300049585 Bacteria 1131
322 Ga0501070_0283923 3300049586 Bacteria 1350
323 Ga0501070_0511435 3300049586 Bacteria 964
324 Ga0501070_0772996 3300049586 Bacteria 756
325 Ga0501071_0011111 3300049587 Bacteria 6053
326 Ga0501071_0076419 3300049587 Unclassified 2446
327 Ga0501071_0167350 3300049587 Bacteria 1645
328 Ga0501071_0438224 3300049587 Bacteria 1000
329 Ga0501072_0054346 3300049588 Bacteria 3155
330 Ga0501072_0083336 3300049588 Bacteria 2535
331 Ga0501073_0357983 3300049589 Bacteria 1008
332 Ga0501074_0035378 3300049590 Bacteria 3619
333 Ga0501074_0059994 3300049590 Bacteria 2740
334 Ga0501074_0272903 3300049590 Bacteria 1202
335 Ga0501075_0046531 3300049591 Unclassified 3259
336 Ga0501075_0112539 3300049591 Bacteria 2070
337 Ga0501075_0119959 3300049591 Bacteria 2001
338 Ga0501075_0148600 3300049591 Unclassified 1786
339 Ga0501075_0701979 3300049591 Unclassified 771
340 Ga0501076_0024711 3300049592 Bacteria 4645
341 Ga0501076_0068020 3300049592 Bacteria 2845
342 Ga0501076_0078647 3300049592 Bacteria 2647
343 Ga0501076_0169266 3300049592 Unclassified 1781
344 Ga0501076_0201136 3300049592 Bacteria 1627
345 Ga0501076_0301727 3300049592 Bacteria 1313
346 Ga0501077_0028370 3300049593 Bacteria 3558
347 Ga0501077_0198031 3300049593 Bacteria 1276
348 Ga0501077_0199029 3300049593 Bacteria 1272
349 Ga0501077_0199456 3300049593 Unclassified 1271
350 Ga0501079_0019303 3300049741 Bacteria 5207
351 Ga0501079_0029450 3300049741 Bacteria 4215
352 Ga0501080_0019397 3300049742 Bacteria 6301
353 Ga0501080_0356093 3300049742 Bacteria 1321
354 Ga0501080_0447849 3300049742 Bacteria 1158
355 Ga0501081_0020212 3300049743 Bacteria 4437
356 Ga0501081_0056643 3300049743 Bacteria 2709
357 Ga0501081_0059793 3300049743 Bacteria 2639
358 Ga0501081_0060819 3300049743 Unclassified 2618
359 Ga0501081_0192439 3300049743 Unclassified 1477
360 Ga0501083_0105573 3300049744 Bacteria 1855
361 Ga0501035_0180835 3300049822 Bacteria 1817
362 Ga0501044_0868982 3300049823 Bacteria 778
363 Ga0501045_0007568 3300049824 Bacteria 7550
364 Ga0501045_0026593 3300049824 Bacteria 4164
365 nmdc:mga05p37_308879_c1 3300050507 Unclassified 1875
366 nmdc:mga06r32_118352_c1 3300050510 Bacteria 2611
367 nmdc:mga08y16_249491_c1 3300050511 Bacteria 1834
368 nmdc:mga0n895_139545_c1 3300050512 Unclassified 2451
369 nmdc:mga0a205_1072180_c1 3300050515 Bacteria 653
370 Ga0495612_0000972 3300053078 Bacteria 11788
371 Ga0495619_0568535 3300053085 Bacteria 777
372 Ga0501084_0025281 3300054114 Bacteria 4953
373 Ga0501084_0049555 3300054114 Bacteria 3516
374 Ga0501084_0100599 3300054114 Bacteria 2427
375 Ga0501084_0234125 3300054114 Unclassified 1550
376 Ga0501084_0287303 3300054114 Bacteria 1389
377 Ga0590075_011862 3300059424 Bacteria 2111
378 Ga0590077_024256 3300059426 Bacteria 1302
379 Ga0501082_0084912 3300060353 Bacteria 2730
380 Ga0501082_0103571 3300060353 Bacteria 2462
381 Ga0501082_0538118 3300060353 Bacteria 1021
382 Ga0501082_0780377 3300060353 Archaea 836
383 Ga0530510_0016784 3300061734 Bacteria 5185
384 Ga0530510_0259318 3300061734 Bacteria 1296
385 Ga0530510_0279917 3300061734 Bacteria 1246
386 Ga0530510_0360337 3300061734 Bacteria 1093
387 Ga0530510_0546547 3300061734 Bacteria 879
388 Ga0530510_0552853 3300061734 Unclassified 874
389 Ga0070695_100396175
390 Ga0070676_10051723
391 Ga0070683_100103723
392 Ga0070683_100327896
393 Ga0070690_100075611
394 Ga0070690_100392115
395 Ga0070670_100234108
396 Ga0068869_100218354
397 Ga0068869_100353139
398 Ga0070680_100253747
399 Ga0070680_100284616
400 Ga0070682_100164777
401 Ga0068868_100052418
402 Ga0068868_100443693
403 Ga0070689_100041016
404 Ga0070687_100020822
405 Ga0070687_100049147
406 Ga0070687_100295081
407 Ga0070661_100053641
408 Ga0070692_10297707
409 Ga0070692_10313472
410 Ga0070668_100093434
411 Ga0070669_100086278
412 Ga0070675_100022470
413 Ga0070674_100247539
414 Ga0070673_100022750
415 Ga0070688_100020391
416 Ga0070659_100157534
417 Ga0070667_100252197
418 Ga0070667_100493461
419 Ga0070703_10034207
420 Ga0070701_10362451
421 Ga0070705_100226179
422 Ga0070705_100317933
423 Ga0070700_100172926
424 Ga0070694_100007237
425 Ga0070694_100039784
426 Ga0070694_100074219
427 Ga0070694_100304751
428 Ga0070708_100013321
429 Ga0070708_100121437
430 Ga0070708_100966748
431 Ga0070663_100120174
432 Ga0070663_100377898
433 Ga0070678_100113280
434 Ga0070662_100898218
435 Ga0068867_100003110
436 Ga0070685_10063592
437 Ga0070706_100000164
438 Ga0070706_100075298
439 Ga0070706_100683960
440 Ga0070707_100000583
441 Ga0070707_100003168
442 Ga0070707_100089442
443 Ga0070707_100218106
444 Ga0070698_100052298
445 Ga0070698_100118800
446 Ga0070698_100293181
447 Ga0070698_100304137
448 Ga0070699_100000536
449 Ga0070699_100075930
450 Ga0070699_100214363
451 Ga0070679_100125467
452 Ga0070679_100524848
453 Ga0070684_100274649
454 Ga0070697_100002368
455 Ga0070697_100110861
456 Ga0070697_100322402
457 Ga0070697_100615057
458 Ga0068853_100196236
459 Ga0070686_100017953
460 Ga0070686_100019577
461 Ga0070686_100089225
462 Ga0070695_100017071
463 Ga0070695_100069524
464 Ga0070696_100010379
465 Ga0070696_100132988
466 Ga0070696_100154374
467 Ga0070693_100047741
468 Ga0070693_100065772
469 Ga0070693_100309351
470 Ga0070665_100357139
471 Ga0070704_100062038
472 Ga0070704_100125759
473 Ga0070704_100632123
474 Ga0068857_100488471
475 Ga0068856_100865798
476 Ga0068856_100965699
477 Ga0070702_100084128
478 Ga0068852_100309445
479 Ga0068859_100048900
480 Ga0068864_100007479
481 Ga0068866_10011642
482 Ga0068861_100159994
483 Ga0068861_100723960
484 Ga0068870_10035689
485 Ga0068860_100046585
486 Ga0068860_100067450
487 Ga0068860_100365386
488 Ga0068862_100613440
489 Ga0081455_10124828
490 Ga0081539_10007283
491 Ga0081539_10023265
492 Ga0075365_10317202
493 Ga0097621_100277727
494 Ga0097621_100627998
495 Ga0075428_100042054
496 Ga0075431_100214541
497 Ga0075434_100945935
498 Ga0068865_100120806
499 Ga0097620_100048901
500 Ga0097620_101283210
501 Ga0105251_10114358
502 Ga0105240_10838800
503 Ga0111539_10016989
504 Ga0105245_10105353
505 Ga0105245_10614897
506 Ga0105245_10918095
507 Ga0105247_10068253
508 Ga0114129_10012756
509 Ga0114129_10050093
510 Ga0114129_10170188
511 Ga0105243_10024359
512 Ga0105243_10068104
513 Ga0105243_10522119
514 Ga0105243_11092067
515 Ga0105241_10494435
516 Ga0105241_10994647
517 Ga0105242_10066868
518 Ga0105242_10214989
519 Ga0105242_10278813
520 Ga0105249_10037603
521 Ga0105249_10059613
522 Ga0105246_10311624
523 Ga0105246_10459561
524 Ga0105246_10564420
525 Ga0157371_10304258
526 Ga0157374_11334967
527 Ga0157378_10031357
528 Ga0157378_10170012
529 Ga0157378_10392506
530 Ga0163162_10167910
531 Ga0163162_11146666
532 Ga0163162_11200494
533 Ga0157375_10138372
534 Ga0157375_10407303
535 Ga0157375_10570322
536 Ga0163163_10023674
537 Ga0163163_10118545
538 Ga0163163_10122090
539 Ga0163163_10216077
540 Ga0163163_10717289
541 Ga0157380_10015756
542 Ga0157380_10921590
543 Ga0182008_10085977
544 Ga0157377_10038164
545 Ga0157377_10043771
546 Ga0157379_10143838
547 Ga0157379_10355705
548 Ga0157379_10536535
549 Ga0163161_10039637
550 Ga0207642_10135182
551 Ga0207688_10012387
552 Ga0207645_10299767
553 Ga0207643_10084559
554 Ga0207684_10000452
555 Ga0207684_10146657
556 Ga0207684_10292082
557 Ga0207707_10810169
558 Ga0207663_10697683
559 Ga0207660_10409969
560 Ga0207662_10012565
561 Ga0207662_10273439
562 Ga0207662_10442139
563 Ga0207657_10119187
564 Ga0207649_10174874
565 Ga0207646_10003632
566 Ga0207646_10023209
567 Ga0207646_10049195
568 Ga0207646_10228723
569 Ga0207681_10125699
570 Ga0207650_10138687
571 Ga0207659_10141335
572 Ga0207659_10384252
573 Ga0207687_10144541
574 Ga0207687_10282671
575 Ga0207706_10130617
576 Ga0207706_10149122
577 Ga0207706_10290769
578 Ga0207706_10532662
579 Ga0207686_10092482
580 Ga0207686_10681702
581 Ga0207709_10264577
582 Ga0207709_10302441
583 Ga0207670_10096115
584 Ga0207665_10186471
585 Ga0207691_10015057
586 Ga0207689_10173386
587 Ga0207689_10482091
588 Ga0207661_10070121
589 Ga0207661_10725425
590 Ga0207679_11011048
591 Ga0207679_11262290
592 Ga0207651_10057501
593 Ga0207651_10128077
594 Ga0207712_10103169
595 Ga0207712_10192450
596 Ga0207640_10465495
597 Ga0207677_10189160
598 Ga0207678_10012791
599 Ga0207678_10330175
600 Ga0207708_10002055
601 Ga0207708_10332687
602 Ga0207702_10454236
603 Ga0207641_10132879
604 Ga0207648_10019729
605 Ga0207676_10076470
606 Ga0207674_10010314
607 Ga0207675_100170076
608 Ga0207683_10088400
609 Ga0207683_10221556
610 Ga0207698_10212191
611 Ga0207698_10252806
612 Ga0268266_10632754
613 Ga0268264_10027896
614 Ga0316578_10070323
615 Ga0307406_10145018
616 Ga0307406_10640701
617 Ga0307407_10327173
618 Ga0307409_100083757
619 Ga0307409_100565087
620 Ga0307416_100093497
621 Ga0307416_100780073
622 Ga0307411_10102529
623 Ga0307415_100009989
624 Ga0307415_100209307
625 Ga0316583_10085986
626 Ga0316580_10098503
627 Ga0373952_0081373
628 Ga0316574_0067959
629 Ga0373931_0399619
630 Ga0395905_1179932
631 Ga0439465_0121298
632 Ga0451845_0175417
633 Ga0451853_2727328
634 Ga0450917_002173
635 Ga0439458_0050129
636 Ga0451577_0042002
637 Ga0451577_0219637
638 Ga0453684_0183053
639 Ga0453684_1703493
640 Ga0495584_0100259
641 Ga0495618_0494692
642 Ga0495628_0663286
643 Ga0495656_0039100
644 Ga0495669_0122509
645 Ga0495604_0527166
646 Ga0495674_0618523
647 Ga0495676_0474259
648 Ga0496101_0137423
649 Ga0496102_0079426
650 Ga0496102_0281654
651 Ga0496102_0354179
652 Ga0496102_0367810
653 Ga0496103_0024775
654 Ga0496104_0018099
655 Ga0496104_0033076
656 Ga0496105_0005647
657 Ga0496105_0224733
658 Ga0496106_0061297
659 Ga0496106_0199865
660 Ga0496106_0354744
661 Ga0496106_0533328
662 Ga0496107_0031585
663 Ga0496107_0183431
664 Ga0496107_0595124
665 Ga0496108_0017953
666 Ga0496108_0170200
667 Ga0496108_0842749
668 Ga0496109_0001700
669 Ga0496110_0010075
670 Ga0496110_0236124
671 Ga0496111_0217349
672 Ga0496112_0150380
673 Ga0496112_0190765
674 Ga0496113_0115329
675 Ga0496114_0164779
676 Ga0496114_0275874
677 Ga0501031_0064872
678 Ga0501031_0175881
679 Ga0501032_0222242
680 Ga0501033_0116120
681 Ga0501033_0717187
682 Ga0501036_0059905
683 Ga0501036_0759602
684 Ga0501037_0444945
685 Ga0501038_0056257
686 Ga0501038_0142860
687 Ga0501039_0133041
688 Ga0501040_0050530
689 Ga0501040_0119174
690 Ga0501040_0256257
691 Ga0501041_0032667
692 Ga0501041_0042570
693 Ga0501041_0223165
694 Ga0501042_0007255
695 Ga0501042_0049337
696 Ga0501042_0171900
697 Ga0501042_0614465
698 Ga0501043_0405100
699 Ga0501046_0305388
700 Ga0501046_0324684
701 Ga0501048_0010191
702 Ga0501048_0020323
703 Ga0501048_0233419
704 Ga0501048_0580057
705 Ga0501067_0104965
706 Ga0501067_0410676
707 Ga0501068_0096363
708 Ga0501068_0261494
709 Ga0501069_0209610
710 Ga0501070_0283923
711 Ga0501070_0511435
712 Ga0501070_0772996
713 Ga0501071_0011111
714 Ga0501071_0076419
715 Ga0501071_0167350
716 Ga0501071_0438224
717 Ga0501072_0054346
718 Ga0501072_0083336
719 Ga0501073_0357983
720 Ga0501074_0035378
721 Ga0501074_0059994
722 Ga0501074_0272903
723 Ga0501075_0046531
724 Ga0501075_0112539
725 Ga0501075_0119959
726 Ga0501075_0148600
727 Ga0501075_0701979
728 Ga0501076_0024711
729 Ga0501076_0068020
730 Ga0501076_0078647
731 Ga0501076_0169266
732 Ga0501076_0201136
733 Ga0501076_0301727
734 Ga0501077_0028370
735 Ga0501077_0198031
736 Ga0501077_0199029
737 Ga0501077_0199456
738 Ga0501079_0019303
739 Ga0501079_0029450
740 Ga0501080_0019397
741 Ga0501080_0356093
742 Ga0501080_0447849
743 Ga0501081_0020212
744 Ga0501081_0056643
745 Ga0501081_0059793
746 Ga0501081_0060819
747 Ga0501081_0192439
748 Ga0501083_0105573
749 Ga0501035_0180835
750 Ga0501044_0868982
751 Ga0501045_0007568
752 Ga0501045_0026593
753 nmdc:mga05p37_308879_c1
754 nmdc:mga06r32_118352_c1
755 nmdc:mga08y16_249491_c1
756 nmdc:mga0n895_139545_c1
757 nmdc:mga0a205_1072180_c1
758 Ga0495612_0000972
759 Ga0495619_0568535
760 Ga0501084_0025281
761 Ga0501084_0049555
762 Ga0501084_0100599
763 Ga0501084_0234125
764 Ga0501084_0287303
765 Ga0590075_011862
766 Ga0590077_024256
767 Ga0501082_0084912
768 Ga0501082_0103571
769 Ga0501082_0538118
770 Ga0501082_0780377
771 Ga0530510_0016784
772 Ga0530510_0259318
773 Ga0530510_0279917
774 Ga0530510_0360337
775 Ga0530510_0546547
776 Ga0530510_0552853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16321

Ribosom_S30AE_C

Sigma 54 modulation/S30EA ribosomal protein C terminus

112

168

0.97

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

3

98

0.89

Map