F431045

General Info

Members Datasets Scaffolds Average Seq Length
388 143 776 191

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100392119|Ga0070711_1003921192
Length 211
Sequence MSNDNTISRRGLFMKMGILFNGLVATALAVPIVGFVLSSVTRGRANAYLSWVPLGSVGDFPEGETRLATFRNPYVTPTDGKTVDTACWVRRVAGEEFQVFAVNCAHLGCPVRWFPQSGLFMCPCHGGAYYRDGSRASGPPERGLFEYPYKVKDGVVTIQAGELPTPGSPTASLLGQKSPCSSANDLVSIQVGNLRASSETKSLVGKKKTWA

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 3.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.61
Rhizosphere 94.33
Stem 0
Stem Tuber 0
Unclassified 31.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100392119 3300005439 Bacteria 1125
2 Ga0070690_100279309 3300005330 Bacteria 1191
3 Ga0068868_100189017 3300005338 Bacteria 1712
4 Ga0070689_100411172 3300005340 Unclassified 1145
5 Ga0070687_100211083 3300005343 Bacteria 1183
6 Ga0070671_100000183 3300005355 Bacteria 41872
7 Ga0070688_100202953 3300005365 Bacteria 1388
8 Ga0070667_100370481 3300005367 Bacteria 1299
9 Ga0070709_10027671 3300005434 Bacteria 3373
10 Ga0070709_10030143 3300005434 Unclassified 3253
11 Ga0070709_10080322 3300005434 Unclassified 2126
12 Ga0070709_10116188 3300005434 Unclassified 1806
13 Ga0070709_10153968 3300005434 Bacteria 1591
14 Ga0070709_10286607 3300005434 Unclassified 1199
15 Ga0070709_10324157 3300005434 Bacteria 1131
16 Ga0070709_10439456 3300005434 Unclassified 981
17 Ga0070709_10721087 3300005434 Bacteria 777
18 Ga0070709_10767245 3300005434 Unclassified 755
19 Ga0070714_100264883 3300005435 Bacteria 1592
20 Ga0070713_100046535 3300005436 Bacteria 3560
21 Ga0070713_100289490 3300005436 Bacteria 1505
22 Ga0070713_100293980 3300005436 Bacteria 1494
23 Ga0070710_10022958 3300005437 Unclassified 3272
24 Ga0070710_10131733 3300005437 Bacteria 1525
25 Ga0070710_10269405 3300005437 Bacteria 1101
26 Ga0070710_10321062 3300005437 Bacteria 1016
27 Ga0070710_10413759 3300005437 Unclassified 906
28 Ga0070711_100001028 3300005439 Bacteria 14831
29 Ga0070711_100010478 3300005439 Bacteria 5740
30 Ga0070711_100021963 3300005439 Unclassified 4131
31 Ga0070711_100102664 3300005439 Unclassified 2083
32 Ga0070711_100197149 3300005439 Bacteria 1551
33 Ga0070711_100329126 3300005439 Bacteria 1223
34 Ga0070711_100786761 3300005439 Unclassified 806
35 Ga0070705_100424637 3300005440 Bacteria 991
36 Ga0070694_100125693 3300005444 Bacteria 1846
37 Ga0070694_100186086 3300005444 Bacteria 1539
38 Ga0070694_100716770 3300005444 Bacteria 815
39 Ga0070708_100000687 3300005445 Bacteria 25740
40 Ga0070708_100010977 3300005445 Bacteria 7360
41 Ga0070708_100157238 3300005445 Bacteria 2117
42 Ga0070708_100503295 3300005445 Bacteria 1143
43 Ga0070708_100615453 3300005445 Unclassified 1024
44 Ga0070662_100078082 3300005457 Bacteria 2458
45 Ga0070662_100260400 3300005457 Bacteria 1397
46 Ga0068867_100412156 3300005459 Unclassified 1142
47 Ga0068867_100541544 3300005459 Unclassified 1007
48 Ga0070706_100001262 3300005467 Bacteria 27056
49 Ga0070706_100001508 3300005467 Bacteria 24433
50 Ga0070706_100011943 3300005467 Bacteria 8062
51 Ga0070706_100101482 3300005467 Unclassified 2674
52 Ga0070706_100113424 3300005467 Bacteria 2524
53 Ga0070706_100142177 3300005467 Bacteria 2240
54 Ga0070706_100449043 3300005467 Unclassified 1200
55 Ga0070706_100450658 3300005467 Unclassified 1197
56 Ga0070706_100605885 3300005467 Bacteria 1018
57 Ga0070707_100008020 3300005468 Bacteria 9811
58 Ga0070707_100012351 3300005468 Bacteria 7974
59 Ga0070707_100041766 3300005468 Bacteria 4390
60 Ga0070707_100103552 3300005468 Unclassified 2758
61 Ga0070707_100134848 3300005468 Unclassified 2402
62 Ga0070707_100170715 3300005468 Bacteria 2120
63 Ga0070707_100605759 3300005468 Unclassified 1058
64 Ga0070698_100015094 3300005471 Bacteria 8166
65 Ga0070698_100033661 3300005471 Bacteria 5308
66 Ga0070698_100072604 3300005471 Bacteria 3449
67 Ga0070698_100195108 3300005471 Bacteria 1962
68 Ga0070698_100278451 3300005471 Unclassified 1604
69 Ga0070698_100312441 3300005471 Unclassified 1502
70 Ga0070699_100001205 3300005518 Bacteria 23901
71 Ga0070699_100045578 3300005518 Unclassified 3794
72 Ga0070699_100184498 3300005518 Bacteria 1852
73 Ga0070699_100250569 3300005518 Unclassified 1582
74 Ga0070699_100962183 3300005518 Unclassified 782
75 Ga0070697_100000830 3300005536 Bacteria 23180
76 Ga0070697_100009074 3300005536 Bacteria 7770
77 Ga0070697_100024322 3300005536 Bacteria 4821
78 Ga0070697_100044071 3300005536 Bacteria 3613
79 Ga0070697_100052904 3300005536 Unclassified 3300
80 Ga0070697_100081898 3300005536 Unclassified 2660
81 Ga0070697_100296977 3300005536 Unclassified 1388
82 Ga0070697_100452437 3300005536 Bacteria 1119
83 Ga0070697_100685619 3300005536 Bacteria 903
84 Ga0070697_100739373 3300005536 Unclassified 869
85 Ga0070697_101004893 3300005536 Unclassified 741
86 Ga0070686_100018073 3300005544 Bacteria 4132
87 Ga0070695_100021140 3300005545 Bacteria 3979
88 Ga0070695_100066187 3300005545 Bacteria 2355
89 Ga0070695_100091022 3300005545 Bacteria 2037
90 Ga0070695_100100760 3300005545 Unclassified 1945
91 Ga0070695_100142233 3300005545 Bacteria 1665
92 Ga0070695_100291029 3300005545 Unclassified 1204
93 Ga0070696_100023179 3300005546 Bacteria 4219
94 Ga0070696_100112241 3300005546 Bacteria 1964
95 Ga0070696_100218020 3300005546 Bacteria 1431
96 Ga0070665_100660844 3300005548 Unclassified 1058
97 Ga0070665_100836617 3300005548 Unclassified 933
98 Ga0070704_100046729 3300005549 Bacteria 3022
99 Ga0070704_100103044 3300005549 Bacteria 2155
100 Ga0070704_100185989 3300005549 Bacteria 1666
101 Ga0068855_101099249 3300005563 Unclassified 831
102 Ga0070664_100044936 3300005564 Bacteria 3730
103 Ga0070702_100200390 3300005615 Bacteria 1321
104 Ga0068852_100903443 3300005616 Bacteria 900
105 Ga0068859_100186576 3300005617 Bacteria 2157
106 Ga0068859_100241899 3300005617 Bacteria 1894
107 Ga0068864_100157082 3300005618 Bacteria 2065
108 Ga0068863_100002174 3300005841 Bacteria 19429
109 Ga0068863_100082288 3300005841 Bacteria 3050
110 Ga0068863_100194980 3300005841 Unclassified 1947
111 Ga0068858_100071777 3300005842 Bacteria 3211
112 Ga0068860_100010805 3300005843 Bacteria 9012
113 Ga0068860_100086528 3300005843 Unclassified 2983
114 Ga0068860_100282827 3300005843 Bacteria 1621
115 Ga0068860_100287715 3300005843 Bacteria 1607
116 Ga0068860_100519915 3300005843 Unclassified 1190
117 Ga0068860_100966221 3300005843 Unclassified 869
118 Ga0068860_101157169 3300005843 Unclassified 793
119 Ga0068862_100023627 3300005844 Bacteria 5153
120 Ga0068862_100120943 3300005844 Bacteria 2308
121 Ga0081540_1068366 3300005983 Bacteria 1655
122 Ga0070717_10012336 3300006028 Bacteria 6513
123 Ga0070717_10070252 3300006028 Bacteria 2918
124 Ga0070717_10085343 3300006028 Unclassified 2657
125 Ga0070717_10121186 3300006028 Unclassified 2241
126 Ga0070715_10023239 3300006163 Bacteria 2427
127 Ga0070715_10031687 3300006163 Unclassified 2148
128 Ga0070715_10049765 3300006163 Unclassified 1797
129 Ga0070716_100000727 3300006173 Bacteria 14036
130 Ga0070716_100061997 3300006173 Bacteria 2166
131 Ga0070716_100101042 3300006173 Bacteria 1768
132 Ga0070716_100209014 3300006173 Bacteria 1303
133 Ga0070716_100471066 3300006173 Unclassified 920
134 Ga0070716_100806543 3300006173 Bacteria 727
135 Ga0070712_100001116 3300006175 Bacteria 16167
136 Ga0070712_100017272 3300006175 Bacteria 4669
137 Ga0070712_100088432 3300006175 Bacteria 2263
138 Ga0070712_100242100 3300006175 Bacteria 1437
139 Ga0070712_100657674 3300006175 Bacteria 891
140 Ga0070712_100952050 3300006175 Unclassified 742
141 Ga0068871_100286698 3300006358 Bacteria 1442
142 Ga0068871_100436131 3300006358 Bacteria 1172
143 Ga0075428_100359017 3300006844 Unclassified 1563
144 Ga0075433_10038060 3300006852 Unclassified 4153
145 Ga0075433_10173525 3300006852 Unclassified 1918
146 Ga0075433_11131034 3300006852 Bacteria 681
147 Ga0075434_100062398 3300006871 Bacteria 3710
148 Ga0075434_100098203 3300006871 Bacteria 2934
149 Ga0075434_100237716 3300006871 Bacteria 1841
150 Ga0075434_100272312 3300006871 Bacteria 1712
151 Ga0075434_100646981 3300006871 Bacteria 1075
152 Ga0075434_100997329 3300006871 Unclassified 851
153 Ga0075434_101163620 3300006871 Unclassified 784
154 Ga0068865_100072511 3300006881 Unclassified 2446
155 Ga0068865_100255638 3300006881 Bacteria 1385
156 Ga0075436_100012828 3300006914 Bacteria 5744
157 Ga0075436_100234780 3300006914 Bacteria 1303
158 Ga0075436_100354365 3300006914 Bacteria 1058
159 Ga0097620_100186560 3300006931 Bacteria 2157
160 Ga0097620_100241893 3300006931 Bacteria 1894
161 Ga0075435_100042224 3300007076 Bacteria 3648
162 Ga0075435_100300893 3300007076 Bacteria 1372
163 Ga0075435_100541457 3300007076 Bacteria 1008
164 Ga0075435_100895265 3300007076 Unclassified 774
165 Ga0099794_10001510 3300007265 Bacteria 8162
166 Ga0099794_10007548 3300007265 Bacteria 4473
167 Ga0099794_10010131 3300007265 Unclassified 3994
168 Ga0099794_10013121 3300007265 Unclassified 3598
169 Ga0099794_10021612 3300007265 Unclassified 2925
170 Ga0099794_10029781 3300007265 Bacteria 2545
171 Ga0099794_10050807 3300007265 Bacteria 1995
172 Ga0099794_10055974 3300007265 Unclassified 1907
173 Ga0099794_10069781 3300007265 Bacteria 1720
174 Ga0099794_10177748 3300007265 Bacteria 1086
175 Ga0099794_10478839 3300007265 Bacteria 654
176 Ga0099795_10221906 3300007788 Bacteria 805
177 Ga0099795_10260727 3300007788 Unclassified 750
178 Ga0099795_10345945 3300007788 Unclassified 664
179 Ga0105245_10087719 3300009098 Bacteria 2856
180 Ga0105245_10226057 3300009098 Bacteria 1808
181 Ga0105245_10290665 3300009098 Unclassified 1601
182 Ga0105247_10064977 3300009101 Bacteria 2268
183 Ga0114129_10018197 3300009147 Bacteria 10003
184 Ga0114129_10429309 3300009147 Bacteria 1736
185 Ga0114129_10512119 3300009147 Unclassified 1566
186 Ga0105243_10053649 3300009148 Bacteria 3199
187 Ga0105243_10104539 3300009148 Bacteria 2357
188 Ga0105241_10043904 3300009174 Bacteria 3386
189 Ga0105242_10007086 3300009176 Bacteria 8660
190 Ga0105242_10093618 3300009176 Bacteria 2533
191 Ga0105242_10374351 3300009176 Bacteria 1322
192 Ga0105248_10023699 3300009177 Bacteria 6821
193 Ga0105248_10070433 3300009177 Unclassified 3927
194 Ga0105248_10105011 3300009177 Unclassified 3185
195 Ga0105248_10247849 3300009177 Bacteria 2005
196 Ga0105237_10176511 3300009545 Bacteria 2136
197 Ga0105237_10188933 3300009545 Bacteria 2060
198 Ga0105237_11496163 3300009545 Bacteria 682
199 Ga0105249_10171864 3300009553 Bacteria 2102
200 Ga0099796_10000889 3300010159 Bacteria 5538
201 Ga0099796_10007093 3300010159 Bacteria 2912
202 Ga0099796_10041898 3300010159 Bacteria 1552
203 Ga0105239_10057114 3300010375 Unclassified 4281
204 Ga0105239_10301440 3300010375 Bacteria 1805
205 Ga0157374_10000377 3300013296 Bacteria 41023
206 Ga0157374_10076384 3300013296 Bacteria 3167
207 Ga0157374_10487887 3300013296 Bacteria 1236
208 Ga0157378_10008103 3300013297 Bacteria 9169
209 Ga0157378_10013122 3300013297 Bacteria 7250
210 Ga0157378_10036636 3300013297 Bacteria 4341
211 Ga0157378_10070438 3300013297 Unclassified 3140
212 Ga0157378_10676952 3300013297 Bacteria 1049
213 Ga0157378_10977180 3300013297 Unclassified 880
214 Ga0163162_10012034 3300013306 Bacteria 8437
215 Ga0163162_10471802 3300013306 Bacteria 1386
216 Ga0157375_10007399 3300013308 Bacteria 9612
217 Ga0157375_10110805 3300013308 Bacteria 2843
218 Ga0157375_10144900 3300013308 Bacteria 2505
219 Ga0157375_10176503 3300013308 Bacteria 2286
220 Ga0163163_10165011 3300014325 Bacteria 2261
221 Ga0163163_10705245 3300014325 Bacteria 1073
222 Ga0157379_10069620 3300014968 Bacteria 3147
223 Ga0157379_10182619 3300014968 Bacteria 1895
224 Ga0157379_10301170 3300014968 Bacteria 1461
225 Ga0157376_10036119 3300014969 Bacteria 4001
226 Ga0157376_10160998 3300014969 Bacteria 2034
227 Ga0213876_10111220 3300021384 Bacteria 1454
228 Ga0213875_10006657 3300021388 Bacteria 6036
229 Ga0213875_10044131 3300021388 Bacteria 2094
230 Ga0224572_1030677 3300024225 Bacteria 1026
231 Ga0224572_1042011 3300024225 Unclassified 860
232 Ga0207653_10011129 3300025885 Bacteria 2808
233 Ga0207692_10069016 3300025898 Bacteria 1856
234 Ga0207692_10139000 3300025898 Unclassified 1380
235 Ga0207692_10275857 3300025898 Bacteria 1015
236 Ga0207692_10290569 3300025898 Unclassified 992
237 Ga0207710_10044302 3300025900 Bacteria 1981
238 Ga0207680_10584965 3300025903 Unclassified 798
239 Ga0207647_10063841 3300025904 Bacteria 2239
240 Ga0207685_10092503 3300025905 Bacteria 1276
241 Ga0207685_10132255 3300025905 Bacteria 1109
242 Ga0207699_10008929 3300025906 Bacteria 4969
243 Ga0207699_10028118 3300025906 Unclassified 3121
244 Ga0207699_10156294 3300025906 Bacteria 1514
245 Ga0207699_10178141 3300025906 Unclassified 1427
246 Ga0207699_10318776 3300025906 Unclassified 1090
247 Ga0207699_10600129 3300025906 Unclassified 802
248 Ga0207684_10001438 3300025910 Bacteria 25754
249 Ga0207684_10002037 3300025910 Bacteria 20810
250 Ga0207684_10072431 3300025910 Bacteria 2927
251 Ga0207684_10098913 3300025910 Bacteria 2491
252 Ga0207684_10134190 3300025910 Unclassified 2125
253 Ga0207684_10209208 3300025910 Bacteria 1683
254 Ga0207684_10393746 3300025910 Unclassified 1191
255 Ga0207684_10445643 3300025910 Bacteria 1112
256 Ga0207684_10565145 3300025910 Unclassified 973
257 Ga0207684_10588149 3300025910 Unclassified 951
258 Ga0207654_10088252 3300025911 Bacteria 1884
259 Ga0207671_10263969 3300025914 Bacteria 1355
260 Ga0207671_10682901 3300025914 Bacteria 817
261 Ga0207693_10002995 3300025915 Bacteria 14613
262 Ga0207693_10021931 3300025915 Bacteria 5077
263 Ga0207693_10081839 3300025915 Unclassified 2528
264 Ga0207693_10124799 3300025915 Bacteria 2023
265 Ga0207693_10137630 3300025915 Unclassified 1920
266 Ga0207693_10224245 3300025915 Bacteria 1476
267 Ga0207663_10001549 3300025916 Bacteria 10764
268 Ga0207663_10007257 3300025916 Bacteria 5736
269 Ga0207663_10008568 3300025916 Bacteria 5358
270 Ga0207663_10020307 3300025916 Unclassified 3759
271 Ga0207663_10031446 3300025916 Bacteria 3142
272 Ga0207663_10617860 3300025916 Unclassified 853
273 Ga0207662_10297132 3300025918 Bacteria 1072
274 Ga0207646_10001135 3300025922 Bacteria 33987
275 Ga0207646_10001829 3300025922 Bacteria 25690
276 Ga0207646_10200930 3300025922 Bacteria 1800
277 Ga0207646_10522393 3300025922 Unclassified 1069
278 Ga0207646_10560809 3300025922 Bacteria 1026
279 Ga0207646_10725511 3300025922 Bacteria 888
280 Ga0207646_11392331 3300025922 Unclassified 610
281 Ga0207687_11077343 3300025927 Unclassified 690
282 Ga0207700_10077368 3300025928 Bacteria 2584
283 Ga0207700_10143846 3300025928 Bacteria 1963
284 Ga0207644_10000120 3300025931 Bacteria 57828
285 Ga0207690_10420356 3300025932 Unclassified 1069
286 Ga0207686_10059202 3300025934 Unclassified 2419
287 Ga0207686_10183120 3300025934 Unclassified 1487
288 Ga0207686_10204650 3300025934 Bacteria 1416
289 Ga0207709_10085116 3300025935 Bacteria 2049
290 Ga0207709_10087395 3300025935 Bacteria 2026
291 Ga0207670_10059461 3300025936 Bacteria 2600
292 Ga0207704_10096999 3300025938 Unclassified 1954
293 Ga0207665_10003745 3300025939 Bacteria 10157
294 Ga0207665_10061601 3300025939 Bacteria 2544
295 Ga0207665_10065803 3300025939 Bacteria 2465
296 Ga0207711_10065783 3300025941 Bacteria 3134
297 Ga0207711_10182152 3300025941 Unclassified 1911
298 Ga0207711_10448430 3300025941 Bacteria 1201
299 Ga0207689_10040085 3300025942 Bacteria 3877
300 Ga0207689_10213858 3300025942 Bacteria 1593
301 Ga0207679_10154522 3300025945 Bacteria 1872
302 Ga0207712_10397311 3300025961 Bacteria 1158
303 Ga0207658_10086817 3300025986 Bacteria 2414
304 Ga0207677_10112152 3300026023 Bacteria 2033
305 Ga0207703_10007820 3300026035 Bacteria 8456
306 Ga0207708_10145776 3300026075 Bacteria 1860
307 Ga0207641_10001341 3300026088 Bacteria 24380
308 Ga0207641_10102426 3300026088 Unclassified 2524
309 Ga0207641_10166692 3300026088 Unclassified 2007
310 Ga0207648_10229997 3300026089 Bacteria 1649
311 Ga0207648_10453374 3300026089 Bacteria 1168
312 Ga0209179_1020043 3300027512 Unclassified 1294
313 Ga0209179_1053912 3300027512 Bacteria 866
314 Ga0209588_1001170 3300027671 Bacteria 6763
315 Ga0209588_1002429 3300027671 Bacteria 5049
316 Ga0209588_1008017 3300027671 Bacteria 3125
317 Ga0209588_1009609 3300027671 Unclassified 2893
318 Ga0268266_10162466 3300028379 Bacteria 2022
319 Ga0268265_10015657 3300028380 Bacteria 5193
320 Ga0268265_10131732 3300028380 Bacteria 2079
321 Ga0268264_10038480 3300028381 Bacteria 3949
322 Ga0268264_10041270 3300028381 Bacteria 3816
323 Ga0268264_10066343 3300028381 Bacteria 3043
324 Ga0268264_10538599 3300028381 Unclassified 1144
325 Ga0268264_10696578 3300028381 Unclassified 1009
326 Ga0265762_1000686 3300030760 Bacteria 5973
327 Ga0265762_1011612 3300030760 Unclassified 1574
328 Ga0265762_1013353 3300030760 Bacteria 1478
329 Ga0265762_1028818 3300030760 Bacteria 1047
330 Ga0265773_1001906 3300031018 Bacteria 1198
331 Ga0265760_10005018 3300031090 Bacteria 3789
332 Ga0265760_10008430 3300031090 Unclassified 2949
333 Ga0265760_10036758 3300031090 Bacteria 1453
334 Ga0265760_10060054 3300031090 Unclassified 1154
335 Ga0265760_10060874 3300031090 Unclassified 1147
336 Ga0265760_10063957 3300031090 Bacteria 1121
337 Ga0265760_10086401 3300031090 Bacteria 977
338 Ga0265340_10068871 3300031247 Bacteria 1680
339 Ga0265339_10160792 3300031249 Bacteria 1130
340 Ga0265331_10097299 3300031250 Unclassified 1357
341 Ga0373931_0022922 3300035691 Unclassified 3147
342 Ga0373931_0085590 3300035691 Unclassified 1748
343 Ga0373931_0240443 3300035691 Unclassified 1097
344 Ga0373927_0269787 3300035695 Unclassified 1119
345 Ga0373937_0466789 3300036401 Bacteria 1199
346 Ga0395905_0066227 3300037471 Unclassified 3383
347 Ga0436364_1404171 3300037853 Unclassified 2667
348 Ga0436365_0197125 3300039437 Bacteria 1050
349 Ga0436365_0579512 3300039437 Bacteria 7765
350 Ga0436361_0066158 3300039447 Bacteria 938
351 Ga0436363_0150477 3300039450 Unclassified 1072
352 Ga0436363_0351942 3300039450 Unclassified 1418
353 Ga0436362_0368310 3300039453 Unclassified 948
354 Ga0436362_0685763 3300039453 Unclassified 660
355 Ga0436362_0822325 3300039453 Unclassified 704
356 Ga0453683_0423872 3300044673 Bacteria 859
357 Ga0495580_0074288 3300046472 Unclassified 2373
358 Ga0496100_0117729 3300048903 Bacteria 1855
359 Ga0496100_0293935 3300048903 Bacteria 1214
360 Ga0496101_0064487 3300048904 Bacteria 2669
361 Ga0496101_0432129 3300048904 Unclassified 1038
362 Ga0496102_0016122 3300048905 Bacteria 6525
363 Ga0496102_0069471 3300048905 Bacteria 3233
364 Ga0496103_0087035 3300048906 Unclassified 1969
365 Ga0496104_0040889 3300048907 Bacteria 4347
366 Ga0496105_0058040 3300048908 Bacteria 3195
367 Ga0496106_0046755 3300048909 Bacteria 3255
368 Ga0496107_0060977 3300048910 Unclassified 2731
369 Ga0496112_0045026 3300048915 Bacteria 4325
370 Ga0496115_0031425 3300048918 Bacteria 4185
371 Ga0496115_0614460 3300048918 Unclassified 863
372 nmdc:mga05p37_4285_c1 3300050507 Bacteria 16662
373 nmdc:mga05p37_53350_c1 3300050507 Bacteria 4972
374 nmdc:mga0n895_134604_c1 3300050512 Bacteria 2497
375 nmdc:mga0n895_1346135_c1 3300050512 Unclassified 684
376 nmdc:mga0n895_197539_c1 3300050512 Unclassified 2043
377 nmdc:mga0n895_295578_c1 3300050512 Bacteria 1642
378 nmdc:mga0n895_323565_c1 3300050512 Bacteria 1563
379 nmdc:mga0n895_5296_c1 3300050512 Bacteria 10744
380 nmdc:mga0rr50_1490247_c1 3300050513 Bacteria 572
381 nmdc:mga0rr50_67802_c1 3300050513 Unclassified 2711
382 nmdc:mga0rr50_78005_c1 3300050513 Unclassified 2547
383 nmdc:mga0rr50_940491_c1 3300050513 Unclassified 737
384 nmdc:mga08x19_108135_c1 3300050514 Bacteria 1852
385 nmdc:mga08x19_250270_c1 3300050514 Bacteria 1223
386 nmdc:mga08x19_28790_c1 3300050514 Bacteria 3482
387 nmdc:mga0a205_12643_c1 3300050515 Bacteria 7817
388 nmdc:mga0a205_679494_c1 3300050515 Unclassified 880
389 Ga0070711_100392119
390 Ga0070690_100279309
391 Ga0068868_100189017
392 Ga0070689_100411172
393 Ga0070687_100211083
394 Ga0070671_100000183
395 Ga0070688_100202953
396 Ga0070667_100370481
397 Ga0070709_10027671
398 Ga0070709_10030143
399 Ga0070709_10080322
400 Ga0070709_10116188
401 Ga0070709_10153968
402 Ga0070709_10286607
403 Ga0070709_10324157
404 Ga0070709_10439456
405 Ga0070709_10721087
406 Ga0070709_10767245
407 Ga0070714_100264883
408 Ga0070713_100046535
409 Ga0070713_100289490
410 Ga0070713_100293980
411 Ga0070710_10022958
412 Ga0070710_10131733
413 Ga0070710_10269405
414 Ga0070710_10321062
415 Ga0070710_10413759
416 Ga0070711_100001028
417 Ga0070711_100010478
418 Ga0070711_100021963
419 Ga0070711_100102664
420 Ga0070711_100197149
421 Ga0070711_100329126
422 Ga0070711_100786761
423 Ga0070705_100424637
424 Ga0070694_100125693
425 Ga0070694_100186086
426 Ga0070694_100716770
427 Ga0070708_100000687
428 Ga0070708_100010977
429 Ga0070708_100157238
430 Ga0070708_100503295
431 Ga0070708_100615453
432 Ga0070662_100078082
433 Ga0070662_100260400
434 Ga0068867_100412156
435 Ga0068867_100541544
436 Ga0070706_100001262
437 Ga0070706_100001508
438 Ga0070706_100011943
439 Ga0070706_100101482
440 Ga0070706_100113424
441 Ga0070706_100142177
442 Ga0070706_100449043
443 Ga0070706_100450658
444 Ga0070706_100605885
445 Ga0070707_100008020
446 Ga0070707_100012351
447 Ga0070707_100041766
448 Ga0070707_100103552
449 Ga0070707_100134848
450 Ga0070707_100170715
451 Ga0070707_100605759
452 Ga0070698_100015094
453 Ga0070698_100033661
454 Ga0070698_100072604
455 Ga0070698_100195108
456 Ga0070698_100278451
457 Ga0070698_100312441
458 Ga0070699_100001205
459 Ga0070699_100045578
460 Ga0070699_100184498
461 Ga0070699_100250569
462 Ga0070699_100962183
463 Ga0070697_100000830
464 Ga0070697_100009074
465 Ga0070697_100024322
466 Ga0070697_100044071
467 Ga0070697_100052904
468 Ga0070697_100081898
469 Ga0070697_100296977
470 Ga0070697_100452437
471 Ga0070697_100685619
472 Ga0070697_100739373
473 Ga0070697_101004893
474 Ga0070686_100018073
475 Ga0070695_100021140
476 Ga0070695_100066187
477 Ga0070695_100091022
478 Ga0070695_100100760
479 Ga0070695_100142233
480 Ga0070695_100291029
481 Ga0070696_100023179
482 Ga0070696_100112241
483 Ga0070696_100218020
484 Ga0070665_100660844
485 Ga0070665_100836617
486 Ga0070704_100046729
487 Ga0070704_100103044
488 Ga0070704_100185989
489 Ga0068855_101099249
490 Ga0070664_100044936
491 Ga0070702_100200390
492 Ga0068852_100903443
493 Ga0068859_100186576
494 Ga0068859_100241899
495 Ga0068864_100157082
496 Ga0068863_100002174
497 Ga0068863_100082288
498 Ga0068863_100194980
499 Ga0068858_100071777
500 Ga0068860_100010805
501 Ga0068860_100086528
502 Ga0068860_100282827
503 Ga0068860_100287715
504 Ga0068860_100519915
505 Ga0068860_100966221
506 Ga0068860_101157169
507 Ga0068862_100023627
508 Ga0068862_100120943
509 Ga0081540_1068366
510 Ga0070717_10012336
511 Ga0070717_10070252
512 Ga0070717_10085343
513 Ga0070717_10121186
514 Ga0070715_10023239
515 Ga0070715_10031687
516 Ga0070715_10049765
517 Ga0070716_100000727
518 Ga0070716_100061997
519 Ga0070716_100101042
520 Ga0070716_100209014
521 Ga0070716_100471066
522 Ga0070716_100806543
523 Ga0070712_100001116
524 Ga0070712_100017272
525 Ga0070712_100088432
526 Ga0070712_100242100
527 Ga0070712_100657674
528 Ga0070712_100952050
529 Ga0068871_100286698
530 Ga0068871_100436131
531 Ga0075428_100359017
532 Ga0075433_10038060
533 Ga0075433_10173525
534 Ga0075433_11131034
535 Ga0075434_100062398
536 Ga0075434_100098203
537 Ga0075434_100237716
538 Ga0075434_100272312
539 Ga0075434_100646981
540 Ga0075434_100997329
541 Ga0075434_101163620
542 Ga0068865_100072511
543 Ga0068865_100255638
544 Ga0075436_100012828
545 Ga0075436_100234780
546 Ga0075436_100354365
547 Ga0097620_100186560
548 Ga0097620_100241893
549 Ga0075435_100042224
550 Ga0075435_100300893
551 Ga0075435_100541457
552 Ga0075435_100895265
553 Ga0099794_10001510
554 Ga0099794_10007548
555 Ga0099794_10010131
556 Ga0099794_10013121
557 Ga0099794_10021612
558 Ga0099794_10029781
559 Ga0099794_10050807
560 Ga0099794_10055974
561 Ga0099794_10069781
562 Ga0099794_10177748
563 Ga0099794_10478839
564 Ga0099795_10221906
565 Ga0099795_10260727
566 Ga0099795_10345945
567 Ga0105245_10087719
568 Ga0105245_10226057
569 Ga0105245_10290665
570 Ga0105247_10064977
571 Ga0114129_10018197
572 Ga0114129_10429309
573 Ga0114129_10512119
574 Ga0105243_10053649
575 Ga0105243_10104539
576 Ga0105241_10043904
577 Ga0105242_10007086
578 Ga0105242_10093618
579 Ga0105242_10374351
580 Ga0105248_10023699
581 Ga0105248_10070433
582 Ga0105248_10105011
583 Ga0105248_10247849
584 Ga0105237_10176511
585 Ga0105237_10188933
586 Ga0105237_11496163
587 Ga0105249_10171864
588 Ga0099796_10000889
589 Ga0099796_10007093
590 Ga0099796_10041898
591 Ga0105239_10057114
592 Ga0105239_10301440
593 Ga0157374_10000377
594 Ga0157374_10076384
595 Ga0157374_10487887
596 Ga0157378_10008103
597 Ga0157378_10013122
598 Ga0157378_10036636
599 Ga0157378_10070438
600 Ga0157378_10676952
601 Ga0157378_10977180
602 Ga0163162_10012034
603 Ga0163162_10471802
604 Ga0157375_10007399
605 Ga0157375_10110805
606 Ga0157375_10144900
607 Ga0157375_10176503
608 Ga0163163_10165011
609 Ga0163163_10705245
610 Ga0157379_10069620
611 Ga0157379_10182619
612 Ga0157379_10301170
613 Ga0157376_10036119
614 Ga0157376_10160998
615 Ga0213876_10111220
616 Ga0213875_10006657
617 Ga0213875_10044131
618 Ga0224572_1030677
619 Ga0224572_1042011
620 Ga0207653_10011129
621 Ga0207692_10069016
622 Ga0207692_10139000
623 Ga0207692_10275857
624 Ga0207692_10290569
625 Ga0207710_10044302
626 Ga0207680_10584965
627 Ga0207647_10063841
628 Ga0207685_10092503
629 Ga0207685_10132255
630 Ga0207699_10008929
631 Ga0207699_10028118
632 Ga0207699_10156294
633 Ga0207699_10178141
634 Ga0207699_10318776
635 Ga0207699_10600129
636 Ga0207684_10001438
637 Ga0207684_10002037
638 Ga0207684_10072431
639 Ga0207684_10098913
640 Ga0207684_10134190
641 Ga0207684_10209208
642 Ga0207684_10393746
643 Ga0207684_10445643
644 Ga0207684_10565145
645 Ga0207684_10588149
646 Ga0207654_10088252
647 Ga0207671_10263969
648 Ga0207671_10682901
649 Ga0207693_10002995
650 Ga0207693_10021931
651 Ga0207693_10081839
652 Ga0207693_10124799
653 Ga0207693_10137630
654 Ga0207693_10224245
655 Ga0207663_10001549
656 Ga0207663_10007257
657 Ga0207663_10008568
658 Ga0207663_10020307
659 Ga0207663_10031446
660 Ga0207663_10617860
661 Ga0207662_10297132
662 Ga0207646_10001135
663 Ga0207646_10001829
664 Ga0207646_10200930
665 Ga0207646_10522393
666 Ga0207646_10560809
667 Ga0207646_10725511
668 Ga0207646_11392331
669 Ga0207687_11077343
670 Ga0207700_10077368
671 Ga0207700_10143846
672 Ga0207644_10000120
673 Ga0207690_10420356
674 Ga0207686_10059202
675 Ga0207686_10183120
676 Ga0207686_10204650
677 Ga0207709_10085116
678 Ga0207709_10087395
679 Ga0207670_10059461
680 Ga0207704_10096999
681 Ga0207665_10003745
682 Ga0207665_10061601
683 Ga0207665_10065803
684 Ga0207711_10065783
685 Ga0207711_10182152
686 Ga0207711_10448430
687 Ga0207689_10040085
688 Ga0207689_10213858
689 Ga0207679_10154522
690 Ga0207712_10397311
691 Ga0207658_10086817
692 Ga0207677_10112152
693 Ga0207703_10007820
694 Ga0207708_10145776
695 Ga0207641_10001341
696 Ga0207641_10102426
697 Ga0207641_10166692
698 Ga0207648_10229997
699 Ga0207648_10453374
700 Ga0209179_1020043
701 Ga0209179_1053912
702 Ga0209588_1001170
703 Ga0209588_1002429
704 Ga0209588_1008017
705 Ga0209588_1009609
706 Ga0268266_10162466
707 Ga0268265_10015657
708 Ga0268265_10131732
709 Ga0268264_10038480
710 Ga0268264_10041270
711 Ga0268264_10066343
712 Ga0268264_10538599
713 Ga0268264_10696578
714 Ga0265762_1000686
715 Ga0265762_1011612
716 Ga0265762_1013353
717 Ga0265762_1028818
718 Ga0265773_1001906
719 Ga0265760_10005018
720 Ga0265760_10008430
721 Ga0265760_10036758
722 Ga0265760_10060054
723 Ga0265760_10060874
724 Ga0265760_10063957
725 Ga0265760_10086401
726 Ga0265340_10068871
727 Ga0265339_10160792
728 Ga0265331_10097299
729 Ga0373931_0022922
730 Ga0373931_0085590
731 Ga0373931_0240443
732 Ga0373927_0269787
733 Ga0373937_0466789
734 Ga0395905_0066227
735 Ga0436364_1404171
736 Ga0436365_0197125
737 Ga0436365_0579512
738 Ga0436361_0066158
739 Ga0436363_0150477
740 Ga0436363_0351942
741 Ga0436362_0368310
742 Ga0436362_0685763
743 Ga0436362_0822325
744 Ga0453683_0423872
745 Ga0495580_0074288
746 Ga0496100_0117729
747 Ga0496100_0293935
748 Ga0496101_0064487
749 Ga0496101_0432129
750 Ga0496102_0016122
751 Ga0496102_0069471
752 Ga0496103_0087035
753 Ga0496104_0040889
754 Ga0496105_0058040
755 Ga0496106_0046755
756 Ga0496107_0060977
757 Ga0496112_0045026
758 Ga0496115_0031425
759 Ga0496115_0614460
760 nmdc:mga05p37_4285_c1
761 nmdc:mga05p37_53350_c1
762 nmdc:mga0n895_134604_c1
763 nmdc:mga0n895_1346135_c1
764 nmdc:mga0n895_197539_c1
765 nmdc:mga0n895_295578_c1
766 nmdc:mga0n895_323565_c1
767 nmdc:mga0n895_5296_c1
768 nmdc:mga0rr50_1490247_c1
769 nmdc:mga0rr50_67802_c1
770 nmdc:mga0rr50_78005_c1
771 nmdc:mga0rr50_940491_c1
772 nmdc:mga08x19_108135_c1
773 nmdc:mga08x19_250270_c1
774 nmdc:mga08x19_28790_c1
775 nmdc:mga0a205_12643_c1
776 nmdc:mga0a205_679494_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

50

148

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q34-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6295 44 91
2x34-assembly2.cif.gz_B structure of a polyisoprenoid binding domain from saccharophagus degradans implicated in plant cell wall breakdown 0.6155 44 88
3q34-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6067 44 91
2x32-assembly1.cif.gz_A structure of a polyisoprenoid binding domain from saccharophagus degradans implicated in plant cell wall breakdown 0.5877 44 88
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.5309 36 146
ID Description Score Start End Superfamily
3l2nB01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6119 125 150 2.60.40.3120
af_Q5U1Z8_55_112_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.5932 90 130 2.20.25.10
af_A1A5V9_1_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5927 50 86 3.40.50.300
5darE02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Ribosomal protein L10, N-terminal fragment, domain II 0.5644 134 148 3.90.105.20
1vf5D02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.5586 72 145 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A0D9X095-F1-model_v4 Rieske domain-containing protein 0.6678 87 147 GO:0009535
GO:0046872
GO:0051537
AF-A0A2V8TL70-F1-model_v4 Cytochrome B6 0.6491 90 148 GO:0016020
GO:0046872
GO:0051537
AF-A0A829ZBW9-F1-model_v4 Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.9.1) 0.6436 73 134 GO:0016020
GO:0016491
GO:0046872
GO:0051537
AF-A0A7C6WHU2-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.6435 72 133 GO:0046872
GO:0051537
AF-A0A535SD21-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit 0.6317 84 146 GO:0016020
GO:0046872
GO:0051537

Map