F431020

General Info

Members Datasets Scaffolds Average Seq Length
388 164 776 167

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101247792|Ga0070670_1012477921
Length 179
Sequence MSVGFTAVGCRGFVLSVKAGLPPIARPDAQLFVLGSLPGDASLAAQRYYAHPTNQFWRLLGTAIGDDLQSMDYADRLLRLADRRIGLWDVIASATRPGSLDQAIRLAEHNRIQHLLHDYPDLSAIAFNGGTAASIGRRLIGDPPLHVTLIDLPSSSAANTRALEDKAAVWSRLRQYIEP

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
160 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
161 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
162 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
163 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.22
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_101247792 3300005331 Bacteria 680
2 JGI24752J21851_1004091 3300001976 Bacteria 1914
3 JGI24740J21852_10014682 3300001979 Bacteria 2881
4 JGI24740J21852_10017242 3300001979 Bacteria 2587
5 JGI24740J21852_10033202 3300001979 Bacteria 1641
6 Ga0070658_10009588 3300005327 Bacteria 7771
7 Ga0070658_10041081 3300005327 Bacteria 3731
8 Ga0070658_10075643 3300005327 Bacteria 2762
9 Ga0070658_10193358 3300005327 Bacteria 1715
10 Ga0070658_10897731 3300005327 Bacteria 770
11 Ga0070658_11154748 3300005327 Bacteria 673
12 Ga0070676_10050274 3300005328 Bacteria 2443
13 Ga0070676_10362841 3300005328 Bacteria 999
14 Ga0070683_100025822 3300005329 Bacteria 5283
15 Ga0070683_100073330 3300005329 Bacteria 3196
16 Ga0070683_100181772 3300005329 Bacteria 1996
17 Ga0070670_100121254 3300005331 Bacteria 2256
18 Ga0068869_100032116 3300005334 Bacteria 3698
19 Ga0070666_10176983 3300005335 Bacteria 1496
20 Ga0070680_100025414 3300005336 Bacteria 4733
21 Ga0070680_100187514 3300005336 Bacteria 1743
22 Ga0070680_100775569 3300005336 Bacteria 826
23 Ga0070682_100196952 3300005337 Bacteria 1419
24 Ga0070682_100349746 3300005337 Bacteria 1101
25 Ga0068868_100120583 3300005338 Bacteria 2139
26 Ga0070660_100002011 3300005339 Bacteria 14014
27 Ga0070660_100028425 3300005339 Bacteria 4184
28 Ga0070660_100049841 3300005339 Bacteria 3220
29 Ga0070660_100113277 3300005339 Bacteria 2160
30 Ga0070660_100115491 3300005339 Bacteria 2139
31 Ga0070660_100359954 3300005339 Bacteria 1199
32 Ga0070660_100622181 3300005339 Bacteria 903
33 Ga0070689_100928911 3300005340 Bacteria 771
34 Ga0070687_100558934 3300005343 Bacteria 780
35 Ga0070661_100056844 3300005344 Bacteria 2867
36 Ga0070661_100157748 3300005344 Bacteria 1717
37 Ga0070661_100187641 3300005344 Bacteria 1576
38 Ga0070668_100750606 3300005347 Bacteria 864
39 Ga0070669_100040118 3300005353 Bacteria 3402
40 Ga0070675_100030276 3300005354 Bacteria 4369
41 Ga0070671_100013784 3300005355 Bacteria 6522
42 Ga0070671_100078302 3300005355 Bacteria 2763
43 Ga0070671_100117982 3300005355 Bacteria 2232
44 Ga0070671_100198060 3300005355 Bacteria 1703
45 Ga0070673_100908420 3300005364 Bacteria 817
46 Ga0070659_100011001 3300005366 Bacteria 6681
47 Ga0070659_100014676 3300005366 Bacteria 5857
48 Ga0070659_100090760 3300005366 Bacteria 2448
49 Ga0070659_100299494 3300005366 Bacteria 1341
50 Ga0070659_100411086 3300005366 Bacteria 1143
51 Ga0070659_100921493 3300005366 Bacteria 764
52 Ga0070667_100244091 3300005367 Bacteria 1604
53 Ga0070667_100658472 3300005367 Bacteria 967
54 Ga0070713_100056673 3300005436 Bacteria 3259
55 Ga0070663_100011043 3300005455 Bacteria 5653
56 Ga0070663_100045341 3300005455 Bacteria 3106
57 Ga0070663_100056487 3300005455 Bacteria 2812
58 Ga0070663_100056664 3300005455 Bacteria 2808
59 Ga0070663_100340186 3300005455 Bacteria 1212
60 Ga0070663_100459802 3300005455 Bacteria 1050
61 Ga0070662_100021945 3300005457 Bacteria 4364
62 Ga0070662_100022940 3300005457 Bacteria 4282
63 Ga0070662_100029277 3300005457 Bacteria 3842
64 Ga0070681_10010885 3300005458 Bacteria 8992
65 Ga0070681_10127610 3300005458 Bacteria 2476
66 Ga0068867_100107746 3300005459 Bacteria 2136
67 Ga0068867_100150279 3300005459 Bacteria 1829
68 Ga0070679_100108267 3300005530 Bacteria 2765
69 Ga0070684_101697256 3300005535 Bacteria 596
70 Ga0068853_100013162 3300005539 Bacteria 6752
71 Ga0068853_100332854 3300005539 Bacteria 1409
72 Ga0068853_101168819 3300005539 Bacteria 743
73 Ga0068853_101653277 3300005539 Bacteria 621
74 Ga0070696_100023005 3300005546 Bacteria 4238
75 Ga0070693_100022668 3300005547 Bacteria 3343
76 Ga0070693_100023308 3300005547 Bacteria 3307
77 Ga0070693_100267283 3300005547 Bacteria 1140
78 Ga0068855_100259278 3300005563 Bacteria 1937
79 Ga0068855_100487959 3300005563 Bacteria 1340
80 Ga0068855_100528955 3300005563 Bacteria 1278
81 Ga0068855_101134515 3300005563 Bacteria 816
82 Ga0070664_100004846 3300005564 Bacteria 10782
83 Ga0070664_100020370 3300005564 Bacteria 5462
84 Ga0070664_100032816 3300005564 Bacteria 4344
85 Ga0070664_100045766 3300005564 Bacteria 3695
86 Ga0070664_100049632 3300005564 Bacteria 3549
87 Ga0070664_100612056 3300005564 Bacteria 1011
88 Ga0070664_100822894 3300005564 Bacteria 869
89 Ga0068857_100011616 3300005577 Bacteria 7661
90 Ga0068857_100024089 3300005577 Bacteria 5358
91 Ga0068857_100107458 3300005577 Bacteria 2506
92 Ga0068854_100009345 3300005578 Bacteria 6329
93 Ga0068854_100038416 3300005578 Bacteria 3367
94 Ga0068854_100287572 3300005578 Bacteria 1326
95 Ga0068856_100343654 3300005614 Bacteria 1511
96 Ga0068856_100478136 3300005614 Bacteria 1267
97 Ga0068856_100500265 3300005614 Bacteria 1236
98 Ga0068856_100700133 3300005614 Bacteria 1033
99 Ga0068856_100885807 3300005614 Bacteria 911
100 Ga0068856_101137615 3300005614 Bacteria 798
101 Ga0068852_100003901 3300005616 Bacteria 10479
102 Ga0068852_100005430 3300005616 Bacteria 9112
103 Ga0068852_100021765 3300005616 Bacteria 5128
104 Ga0068852_100131897 3300005616 Bacteria 2302
105 Ga0068852_100261576 3300005616 Bacteria 1661
106 Ga0068852_101111764 3300005616 Bacteria 810
107 Ga0068859_100032584 3300005617 Bacteria 5234
108 Ga0068859_100286019 3300005617 Bacteria 1742
109 Ga0068864_100005826 3300005618 Bacteria 10102
110 Ga0068864_100040415 3300005618 Bacteria 3990
111 Ga0068864_100180572 3300005618 Bacteria 1929
112 Ga0068861_100491477 3300005719 Bacteria 1107
113 Ga0068851_10125308 3300005834 Bacteria 1384
114 Ga0068863_100017148 3300005841 Bacteria 6946
115 Ga0068863_100038008 3300005841 Bacteria 4581
116 Ga0068863_100043768 3300005841 Bacteria 4250
117 Ga0068858_100043103 3300005842 Bacteria 4184
118 Ga0068858_100051465 3300005842 Bacteria 3810
119 Ga0068860_100022272 3300005843 Bacteria 6132
120 Ga0068862_100117510 3300005844 Bacteria 2340
121 Ga0097621_100104057 3300006237 Bacteria 2392
122 Ga0097621_100153633 3300006237 Bacteria 1975
123 Ga0068871_100009426 3300006358 Bacteria 7074
124 Ga0097620_100032581 3300006931 Bacteria 5234
125 Ga0097620_100286024 3300006931 Bacteria 1742
126 Ga0105251_10048671 3300009011 Bacteria 2031
127 Ga0105245_10293977 3300009098 Bacteria 1592
128 Ga0105243_10716111 3300009148 Bacteria 977
129 Ga0105248_10009578 3300009177 Bacteria 10663
130 Ga0105248_10057798 3300009177 Bacteria 4355
131 Ga0105248_10260272 3300009177 Bacteria 1953
132 Ga0105237_11189137 3300009545 Bacteria 769
133 Ga0105238_10009557 3300009551 Bacteria 9702
134 Ga0105238_10426472 3300009551 Bacteria 1321
135 Ga0105238_10851117 3300009551 Bacteria 929
136 Ga0105249_10045731 3300009553 Bacteria 3982
137 Ga0105246_10208035 3300011119 Bacteria 1525
138 Ga0157373_10003709 3300013100 Bacteria 11558
139 Ga0157373_10015946 3300013100 Bacteria 5486
140 Ga0157373_10023220 3300013100 Bacteria 4498
141 Ga0157373_10133881 3300013100 Bacteria 1742
142 Ga0157373_10207157 3300013100 Bacteria 1383
143 Ga0157373_10304197 3300013100 Bacteria 1132
144 Ga0157373_10460452 3300013100 Bacteria 916
145 Ga0157373_10563110 3300013100 Bacteria 827
146 Ga0157373_10763667 3300013100 Unclassified 711
147 Ga0157373_10775966 3300013100 Unclassified 706
148 Ga0157371_10107912 3300013102 Bacteria 1976
149 Ga0157371_10170408 3300013102 Bacteria 1556
150 Ga0157370_10069830 3300013104 Bacteria 3317
151 Ga0157369_10002992 3300013105 Bacteria 20229
152 Ga0157369_10163582 3300013105 Bacteria 2347
153 Ga0157369_11151818 3300013105 Bacteria 792
154 Ga0157369_11481120 3300013105 Bacteria 691
155 Ga0157378_10107117 3300013297 Bacteria 2557
156 Ga0163162_10173835 3300013306 Bacteria 2279
157 Ga0163162_12249552 3300013306 Bacteria 626
158 Ga0157372_10109480 3300013307 Bacteria 3164
159 Ga0157372_10451945 3300013307 Bacteria 1497
160 Ga0157372_10507326 3300013307 Bacteria 1406
161 Ga0157372_10603578 3300013307 Bacteria 1279
162 Ga0157372_10792434 3300013307 Bacteria 1101
163 Ga0157372_12748728 3300013307 Bacteria 564
164 Ga0163163_10044231 3300014325 Bacteria 4368
165 Ga0157379_10044064 3300014968 Bacteria 3984
166 Ga0206353_11002135 3300020082 Bacteria 1321
167 Ga0206353_11075358 3300020082 Bacteria 2275
168 Ga0213876_10010729 3300021384 Bacteria 4909
169 Ga0207656_10064713 3300025321 Bacteria 1612
170 Ga0207680_10162593 3300025903 Bacteria 1498
171 Ga0207680_10279408 3300025903 Bacteria 1160
172 Ga0207647_10024917 3300025904 Bacteria 3939
173 Ga0207647_10026686 3300025904 Bacteria 3775
174 Ga0207647_10206271 3300025904 Bacteria 1136
175 Ga0207645_10031077 3300025907 Bacteria 3438
176 Ga0207705_10006488 3300025909 Bacteria 8667
177 Ga0207705_10015208 3300025909 Bacteria 5528
178 Ga0207705_10053580 3300025909 Bacteria 2906
179 Ga0207705_10089290 3300025909 Bacteria 2255
180 Ga0207705_10266821 3300025909 Bacteria 1308
181 Ga0207707_10009893 3300025912 Bacteria 8269
182 Ga0207707_10121095 3300025912 Bacteria 2288
183 Ga0207707_10373189 3300025912 Bacteria 1227
184 Ga0207660_10006609 3300025917 Bacteria 7525
185 Ga0207660_10057484 3300025917 Bacteria 2786
186 Ga0207657_10002445 3300025919 Bacteria 20068
187 Ga0207657_10011903 3300025919 Bacteria 8609
188 Ga0207657_10040264 3300025919 Bacteria 4142
189 Ga0207657_10078797 3300025919 Bacteria 2773
190 Ga0207657_10151469 3300025919 Bacteria 1889
191 Ga0207657_10447732 3300025919 Bacteria 1013
192 Ga0207649_10074830 3300025920 Bacteria 2174
193 Ga0207649_10120093 3300025920 Bacteria 1771
194 Ga0207649_10147035 3300025920 Bacteria 1619
195 Ga0207649_10197644 3300025920 Bacteria 1418
196 Ga0207649_10378614 3300025920 Bacteria 1054
197 Ga0207652_10001757 3300025921 Bacteria 18926
198 Ga0207652_10027767 3300025921 Bacteria 4719
199 Ga0207652_10192175 3300025921 Bacteria 1836
200 Ga0207652_11365500 3300025921 Unclassified 612
201 Ga0207681_10222139 3300025923 Bacteria 1462
202 Ga0207694_10160739 3300025924 Bacteria 1814
203 Ga0207694_10521635 3300025924 Bacteria 996
204 Ga0207650_10941351 3300025925 Bacteria 734
205 Ga0207650_11089564 3300025925 Bacteria 680
206 Ga0207659_10039526 3300025926 Bacteria 3291
207 Ga0207659_10076397 3300025926 Bacteria 2462
208 Ga0207664_11028079 3300025929 Bacteria 738
209 Ga0207644_10085784 3300025931 Bacteria 2336
210 Ga0207644_10157683 3300025931 Bacteria 1761
211 Ga0207690_10014773 3300025932 Bacteria 4723
212 Ga0207690_10039902 3300025932 Bacteria 3066
213 Ga0207690_10071071 3300025932 Bacteria 2399
214 Ga0207690_10133342 3300025932 Bacteria 1821
215 Ga0207706_10021992 3300025933 Bacteria 5725
216 Ga0207706_10025577 3300025933 Bacteria 5288
217 Ga0207706_10030542 3300025933 Bacteria 4806
218 Ga0207706_10036072 3300025933 Bacteria 4393
219 Ga0207670_10793253 3300025936 Bacteria 789
220 Ga0207711_10008183 3300025941 Bacteria 8754
221 Ga0207711_10011968 3300025941 Bacteria 7212
222 Ga0207689_10514738 3300025942 Bacteria 1003
223 Ga0207661_10187934 3300025944 Bacteria 1809
224 Ga0207679_10037701 3300025945 Bacteria 3438
225 Ga0207679_10099941 3300025945 Bacteria 2266
226 Ga0207679_10206898 3300025945 Bacteria 1643
227 Ga0207679_10214430 3300025945 Bacteria 1616
228 Ga0207679_10459824 3300025945 Bacteria 1130
229 Ga0207667_10102382 3300025949 Bacteria 2954
230 Ga0207667_10109708 3300025949 Bacteria 2846
231 Ga0207667_11382112 3300025949 Bacteria 678
232 Ga0207651_10847735 3300025960 Bacteria 812
233 Ga0207651_10906165 3300025960 Bacteria 785
234 Ga0207712_10131480 3300025961 Bacteria 1908
235 Ga0207668_10186083 3300025972 Bacteria 1642
236 Ga0207640_10160821 3300025981 Bacteria 1661
237 Ga0207640_10842254 3300025981 Bacteria 797
238 Ga0207658_10159337 3300025986 Bacteria 1848
239 Ga0207658_10435086 3300025986 Bacteria 1159
240 Ga0207677_10357754 3300026023 Bacteria 1225
241 Ga0207703_10130907 3300026035 Bacteria 2166
242 Ga0207639_11552544 3300026041 Bacteria 621
243 Ga0207678_10011145 3300026067 Bacteria 7897
244 Ga0207678_10015611 3300026067 Bacteria 6677
245 Ga0207678_10018879 3300026067 Bacteria 6057
246 Ga0207678_10026687 3300026067 Bacteria 5039
247 Ga0207678_10269767 3300026067 Bacteria 1459
248 Ga0207678_10916925 3300026067 Bacteria 775
249 Ga0207702_10017222 3300026078 Bacteria 5979
250 Ga0207702_10048061 3300026078 Bacteria 3598
251 Ga0207702_11026315 3300026078 Bacteria 818
252 Ga0207702_11135405 3300026078 Bacteria 775
253 Ga0207641_10042942 3300026088 Bacteria 3794
254 Ga0207641_10115117 3300026088 Bacteria 2390
255 Ga0207648_10174992 3300026089 Bacteria 1898
256 Ga0207676_10057576 3300026095 Bacteria 3061
257 Ga0207676_10233268 3300026095 Bacteria 1646
258 Ga0207676_10764772 3300026095 Bacteria 940
259 Ga0207674_10000060 3300026116 Bacteria 112806
260 Ga0207674_10004870 3300026116 Bacteria 16075
261 Ga0207674_10011365 3300026116 Bacteria 10005
262 Ga0207674_10014591 3300026116 Bacteria 8671
263 Ga0207674_10490362 3300026116 Bacteria 1187
264 Ga0207698_10001460 3300026142 Bacteria 13749
265 Ga0207698_10024423 3300026142 Bacteria 4242
266 Ga0207698_10071320 3300026142 Bacteria 2756
267 Ga0207698_10102362 3300026142 Bacteria 2377
268 Ga0207698_10330808 3300026142 Bacteria 1431
269 Ga0207698_11496161 3300026142 Bacteria 690
270 Ga0268265_10034194 3300028380 Bacteria 3702
271 Ga0268264_10079172 3300028381 Bacteria 2803
272 Ga0307408_100279006 3300031548 Bacteria 1391
273 Ga0307410_10122008 3300031852 Bacteria 1902
274 Ga0307410_10164870 3300031852 Bacteria 1664
275 Ga0307407_10140280 3300031903 Bacteria 1558
276 Ga0307412_10173471 3300031911 Bacteria 1614
277 Ga0307409_100040946 3300031995 Bacteria 3455
278 Ga0307416_100054081 3300032002 Bacteria 3225
279 Ga0307416_100119705 3300032002 Bacteria 2343
280 Ga0307411_10052014 3300032005 Bacteria 2676
281 Ga0307415_100153869 3300032126 Bacteria 1773
282 Ga0373941_0114975 3300035115 Bacteria 953
283 Ga0373943_0017670 3300035170 Bacteria 3265
284 Ga0373946_0022991 3300035171 Bacteria 2432
285 Ga0373935_0134044 3300035692 Bacteria 1667
286 Ga0373935_0528650 3300035692 Bacteria 858
287 Ga0373947_0032824 3300035725 Bacteria 3062
288 Ga0395899_0015006 3300037312 Bacteria 5910
289 Ga0395899_0343360 3300037312 Bacteria 1000
290 Ga0395899_0470850 3300037312 Bacteria 819
291 Ga0395899_0566903 3300037312 Bacteria 727
292 Ga0395900_0000855 3300037418 Bacteria 40101
293 Ga0395900_0003422 3300037418 Bacteria 17151
294 Ga0395900_0007276 3300037418 Bacteria 11458
295 Ga0395900_0033072 3300037418 Bacteria 5322
296 Ga0395900_0089885 3300037418 Bacteria 3156
297 Ga0395900_0115130 3300037418 Bacteria 2759
298 Ga0395900_0345072 3300037418 Bacteria 1463
299 Ga0395900_0612389 3300037418 Bacteria 1028
300 Ga0395900_0893318 3300037418 Bacteria 812
301 Ga0395900_0937266 3300037418 Bacteria 788
302 Ga0395900_1005706 3300037418 Bacteria 753
303 Ga0395898_0014896 3300037466 Bacteria 7982
304 Ga0395898_0091397 3300037466 Bacteria 2928
305 Ga0395898_0312841 3300037466 Bacteria 1498
306 Ga0395905_0048281 3300037471 Bacteria 3990
307 Ga0395905_0054447 3300037471 Bacteria 3744
308 Ga0395905_0072192 3300037471 Bacteria 3236
309 Ga0395905_0078158 3300037471 Bacteria 3101
310 Ga0395905_0124059 3300037471 Bacteria 2428
311 Ga0395905_0412398 3300037471 Bacteria 1246
312 Ga0395905_0476408 3300037471 Bacteria 1147
313 Ga0395905_0480702 3300037471 Bacteria 1141
314 Ga0395905_0667739 3300037471 Bacteria 941
315 Ga0395905_1022643 3300037471 Bacteria 729
316 Ga0395905_1027188 3300037471 Bacteria 727
317 Ga0395905_1181612 3300037471 Bacteria 668
318 Ga0395905_1471548 3300037471 Bacteria 585
319 Ga0395901_0000310 3300038443 Bacteria 59928
320 Ga0395901_0096595 3300038443 Bacteria 3096
321 Ga0395901_0251996 3300038443 Bacteria 1839
322 Ga0395901_0366966 3300038443 Bacteria 1483
323 Ga0395901_0479686 3300038443 Bacteria 1268
324 Ga0395901_0856781 3300038443 Bacteria 893
325 Ga0395901_1763029 3300038443 Bacteria 569
326 Ga0436365_0493406 3300039437 Bacteria 1968
327 Ga0436365_1238093 3300039437 Bacteria 965
328 Ga0436363_0890308 3300039450 Bacteria 1443
329 Ga0439465_0055695 3300041413 Bacteria 1302
330 Ga0439432_059336 3300042006 Bacteria 1182
331 Ga0439449_0009417 3300042007 Bacteria 3703
332 Ga0466966_0039798 3300044684 Bacteria 3026
333 Ga0466961_0018579 3300044693 Bacteria 4475
334 Ga0466961_0326371 3300044693 Bacteria 936
335 Ga0466963_0012411 3300044694 Bacteria 5215
336 Ga0466963_0038088 3300044694 Bacteria 3143
337 Ga0466963_0086114 3300044694 Bacteria 2134
338 Ga0466963_0230884 3300044694 Bacteria 1296
339 Ga0466964_0090765 3300044706 Bacteria 1329
340 Ga0466971_0023230 3300044719 Bacteria 2763
341 Ga0466968_0022075 3300044735 Bacteria 2584
342 Ga0466970_0070350 3300044765 Bacteria 1881
343 Ga0466957_0073105 3300044842 Bacteria 2124
344 Ga0466957_0087650 3300044842 Bacteria 1946
345 Ga0466958_0039140 3300045836 Bacteria 2847
346 Ga0466958_0181090 3300045836 Bacteria 1337
347 Ga0466967_0003789 3300045976 Bacteria 9990
348 Ga0466967_0006341 3300045976 Bacteria 8356
349 Ga0466967_0043673 3300045976 Bacteria 3882
350 Ga0466967_0069529 3300045976 Bacteria 3147
351 Ga0466967_0082319 3300045976 Bacteria 2908
352 Ga0466967_0208452 3300045976 Bacteria 1853
353 Ga0466967_0612255 3300045976 Bacteria 1075
354 Ga0495669_0163540 3300046684 Bacteria 1057
355 Ga0496100_0027118 3300048903 Bacteria 3519
356 Ga0496100_0305809 3300048903 Bacteria 1191
357 Ga0496101_0040144 3300048904 Bacteria 3333
358 Ga0496101_0064807 3300048904 Bacteria 2662
359 Ga0496102_0025255 3300048905 Bacteria 5287
360 Ga0496103_0231174 3300048906 Bacteria 1189
361 Ga0496103_0648185 3300048906 Bacteria 671
362 Ga0496105_0200802 3300048908 Bacteria 1628
363 Ga0496106_0087658 3300048909 Bacteria 2398
364 Ga0496106_0637767 3300048909 Bacteria 852
365 Ga0496107_0005457 3300048910 Bacteria 8701
366 Ga0496107_0018513 3300048910 Bacteria 4905
367 Ga0496107_0042088 3300048910 Bacteria 3281
368 Ga0496108_0014672 3300048911 Bacteria 6396
369 Ga0496108_0274947 3300048911 Bacteria 1466
370 Ga0496109_0155425 3300048912 Bacteria 2142
371 Ga0496109_0557007 3300048912 Bacteria 1081
372 Ga0496109_0761061 3300048912 Bacteria 906
373 Ga0496109_1007898 3300048912 Bacteria 770
374 Ga0496110_0043768 3300048913 Bacteria 3909
375 Ga0496111_0072176 3300048914 Bacteria 2512
376 Ga0496111_0154574 3300048914 Bacteria 1702
377 Ga0496112_0070741 3300048915 Bacteria 3448
378 Ga0496112_0330354 3300048915 Bacteria 1468
379 Ga0496113_0028691 3300048916 Bacteria 4006
380 Ga0496113_0164223 3300048916 Bacteria 1756
381 Ga0496114_0348087 3300048917 Bacteria 1310
382 Ga0496115_0027802 3300048918 Bacteria 4428
383 Ga0501199_019995 3300049650 Bacteria 772
384 Ga0501259_023208 3300049688 Bacteria 1121
385 Ga0501262_001643 3300049759 Bacteria 2509
386 Ga0501268_003036 3300049765 Bacteria 2266
387 Ga0501272_023407 3300049769 Bacteria 753
388 Ga0466962_0501053 3300061719 Bacteria 614
389 Ga0070670_101247792
390 JGI24752J21851_1004091
391 JGI24740J21852_10014682
392 JGI24740J21852_10017242
393 JGI24740J21852_10033202
394 Ga0070658_10009588
395 Ga0070658_10041081
396 Ga0070658_10075643
397 Ga0070658_10193358
398 Ga0070658_10897731
399 Ga0070658_11154748
400 Ga0070676_10050274
401 Ga0070676_10362841
402 Ga0070683_100025822
403 Ga0070683_100073330
404 Ga0070683_100181772
405 Ga0070670_100121254
406 Ga0068869_100032116
407 Ga0070666_10176983
408 Ga0070680_100025414
409 Ga0070680_100187514
410 Ga0070680_100775569
411 Ga0070682_100196952
412 Ga0070682_100349746
413 Ga0068868_100120583
414 Ga0070660_100002011
415 Ga0070660_100028425
416 Ga0070660_100049841
417 Ga0070660_100113277
418 Ga0070660_100115491
419 Ga0070660_100359954
420 Ga0070660_100622181
421 Ga0070689_100928911
422 Ga0070687_100558934
423 Ga0070661_100056844
424 Ga0070661_100157748
425 Ga0070661_100187641
426 Ga0070668_100750606
427 Ga0070669_100040118
428 Ga0070675_100030276
429 Ga0070671_100013784
430 Ga0070671_100078302
431 Ga0070671_100117982
432 Ga0070671_100198060
433 Ga0070673_100908420
434 Ga0070659_100011001
435 Ga0070659_100014676
436 Ga0070659_100090760
437 Ga0070659_100299494
438 Ga0070659_100411086
439 Ga0070659_100921493
440 Ga0070667_100244091
441 Ga0070667_100658472
442 Ga0070713_100056673
443 Ga0070663_100011043
444 Ga0070663_100045341
445 Ga0070663_100056487
446 Ga0070663_100056664
447 Ga0070663_100340186
448 Ga0070663_100459802
449 Ga0070662_100021945
450 Ga0070662_100022940
451 Ga0070662_100029277
452 Ga0070681_10010885
453 Ga0070681_10127610
454 Ga0068867_100107746
455 Ga0068867_100150279
456 Ga0070679_100108267
457 Ga0070684_101697256
458 Ga0068853_100013162
459 Ga0068853_100332854
460 Ga0068853_101168819
461 Ga0068853_101653277
462 Ga0070696_100023005
463 Ga0070693_100022668
464 Ga0070693_100023308
465 Ga0070693_100267283
466 Ga0068855_100259278
467 Ga0068855_100487959
468 Ga0068855_100528955
469 Ga0068855_101134515
470 Ga0070664_100004846
471 Ga0070664_100020370
472 Ga0070664_100032816
473 Ga0070664_100045766
474 Ga0070664_100049632
475 Ga0070664_100612056
476 Ga0070664_100822894
477 Ga0068857_100011616
478 Ga0068857_100024089
479 Ga0068857_100107458
480 Ga0068854_100009345
481 Ga0068854_100038416
482 Ga0068854_100287572
483 Ga0068856_100343654
484 Ga0068856_100478136
485 Ga0068856_100500265
486 Ga0068856_100700133
487 Ga0068856_100885807
488 Ga0068856_101137615
489 Ga0068852_100003901
490 Ga0068852_100005430
491 Ga0068852_100021765
492 Ga0068852_100131897
493 Ga0068852_100261576
494 Ga0068852_101111764
495 Ga0068859_100032584
496 Ga0068859_100286019
497 Ga0068864_100005826
498 Ga0068864_100040415
499 Ga0068864_100180572
500 Ga0068861_100491477
501 Ga0068851_10125308
502 Ga0068863_100017148
503 Ga0068863_100038008
504 Ga0068863_100043768
505 Ga0068858_100043103
506 Ga0068858_100051465
507 Ga0068860_100022272
508 Ga0068862_100117510
509 Ga0097621_100104057
510 Ga0097621_100153633
511 Ga0068871_100009426
512 Ga0097620_100032581
513 Ga0097620_100286024
514 Ga0105251_10048671
515 Ga0105245_10293977
516 Ga0105243_10716111
517 Ga0105248_10009578
518 Ga0105248_10057798
519 Ga0105248_10260272
520 Ga0105237_11189137
521 Ga0105238_10009557
522 Ga0105238_10426472
523 Ga0105238_10851117
524 Ga0105249_10045731
525 Ga0105246_10208035
526 Ga0157373_10003709
527 Ga0157373_10015946
528 Ga0157373_10023220
529 Ga0157373_10133881
530 Ga0157373_10207157
531 Ga0157373_10304197
532 Ga0157373_10460452
533 Ga0157373_10563110
534 Ga0157373_10763667
535 Ga0157373_10775966
536 Ga0157371_10107912
537 Ga0157371_10170408
538 Ga0157370_10069830
539 Ga0157369_10002992
540 Ga0157369_10163582
541 Ga0157369_11151818
542 Ga0157369_11481120
543 Ga0157378_10107117
544 Ga0163162_10173835
545 Ga0163162_12249552
546 Ga0157372_10109480
547 Ga0157372_10451945
548 Ga0157372_10507326
549 Ga0157372_10603578
550 Ga0157372_10792434
551 Ga0157372_12748728
552 Ga0163163_10044231
553 Ga0157379_10044064
554 Ga0206353_11002135
555 Ga0206353_11075358
556 Ga0213876_10010729
557 Ga0207656_10064713
558 Ga0207680_10162593
559 Ga0207680_10279408
560 Ga0207647_10024917
561 Ga0207647_10026686
562 Ga0207647_10206271
563 Ga0207645_10031077
564 Ga0207705_10006488
565 Ga0207705_10015208
566 Ga0207705_10053580
567 Ga0207705_10089290
568 Ga0207705_10266821
569 Ga0207707_10009893
570 Ga0207707_10121095
571 Ga0207707_10373189
572 Ga0207660_10006609
573 Ga0207660_10057484
574 Ga0207657_10002445
575 Ga0207657_10011903
576 Ga0207657_10040264
577 Ga0207657_10078797
578 Ga0207657_10151469
579 Ga0207657_10447732
580 Ga0207649_10074830
581 Ga0207649_10120093
582 Ga0207649_10147035
583 Ga0207649_10197644
584 Ga0207649_10378614
585 Ga0207652_10001757
586 Ga0207652_10027767
587 Ga0207652_10192175
588 Ga0207652_11365500
589 Ga0207681_10222139
590 Ga0207694_10160739
591 Ga0207694_10521635
592 Ga0207650_10941351
593 Ga0207650_11089564
594 Ga0207659_10039526
595 Ga0207659_10076397
596 Ga0207664_11028079
597 Ga0207644_10085784
598 Ga0207644_10157683
599 Ga0207690_10014773
600 Ga0207690_10039902
601 Ga0207690_10071071
602 Ga0207690_10133342
603 Ga0207706_10021992
604 Ga0207706_10025577
605 Ga0207706_10030542
606 Ga0207706_10036072
607 Ga0207670_10793253
608 Ga0207711_10008183
609 Ga0207711_10011968
610 Ga0207689_10514738
611 Ga0207661_10187934
612 Ga0207679_10037701
613 Ga0207679_10099941
614 Ga0207679_10206898
615 Ga0207679_10214430
616 Ga0207679_10459824
617 Ga0207667_10102382
618 Ga0207667_10109708
619 Ga0207667_11382112
620 Ga0207651_10847735
621 Ga0207651_10906165
622 Ga0207712_10131480
623 Ga0207668_10186083
624 Ga0207640_10160821
625 Ga0207640_10842254
626 Ga0207658_10159337
627 Ga0207658_10435086
628 Ga0207677_10357754
629 Ga0207703_10130907
630 Ga0207639_11552544
631 Ga0207678_10011145
632 Ga0207678_10015611
633 Ga0207678_10018879
634 Ga0207678_10026687
635 Ga0207678_10269767
636 Ga0207678_10916925
637 Ga0207702_10017222
638 Ga0207702_10048061
639 Ga0207702_11026315
640 Ga0207702_11135405
641 Ga0207641_10042942
642 Ga0207641_10115117
643 Ga0207648_10174992
644 Ga0207676_10057576
645 Ga0207676_10233268
646 Ga0207676_10764772
647 Ga0207674_10000060
648 Ga0207674_10004870
649 Ga0207674_10011365
650 Ga0207674_10014591
651 Ga0207674_10490362
652 Ga0207698_10001460
653 Ga0207698_10024423
654 Ga0207698_10071320
655 Ga0207698_10102362
656 Ga0207698_10330808
657 Ga0207698_11496161
658 Ga0268265_10034194
659 Ga0268264_10079172
660 Ga0307408_100279006
661 Ga0307410_10122008
662 Ga0307410_10164870
663 Ga0307407_10140280
664 Ga0307412_10173471
665 Ga0307409_100040946
666 Ga0307416_100054081
667 Ga0307416_100119705
668 Ga0307411_10052014
669 Ga0307415_100153869
670 Ga0373941_0114975
671 Ga0373943_0017670
672 Ga0373946_0022991
673 Ga0373935_0134044
674 Ga0373935_0528650
675 Ga0373947_0032824
676 Ga0395899_0015006
677 Ga0395899_0343360
678 Ga0395899_0470850
679 Ga0395899_0566903
680 Ga0395900_0000855
681 Ga0395900_0003422
682 Ga0395900_0007276
683 Ga0395900_0033072
684 Ga0395900_0089885
685 Ga0395900_0115130
686 Ga0395900_0345072
687 Ga0395900_0612389
688 Ga0395900_0893318
689 Ga0395900_0937266
690 Ga0395900_1005706
691 Ga0395898_0014896
692 Ga0395898_0091397
693 Ga0395898_0312841
694 Ga0395905_0048281
695 Ga0395905_0054447
696 Ga0395905_0072192
697 Ga0395905_0078158
698 Ga0395905_0124059
699 Ga0395905_0412398
700 Ga0395905_0476408
701 Ga0395905_0480702
702 Ga0395905_0667739
703 Ga0395905_1022643
704 Ga0395905_1027188
705 Ga0395905_1181612
706 Ga0395905_1471548
707 Ga0395901_0000310
708 Ga0395901_0096595
709 Ga0395901_0251996
710 Ga0395901_0366966
711 Ga0395901_0479686
712 Ga0395901_0856781
713 Ga0395901_1763029
714 Ga0436365_0493406
715 Ga0436365_1238093
716 Ga0436363_0890308
717 Ga0439465_0055695
718 Ga0439432_059336
719 Ga0439449_0009417
720 Ga0466966_0039798
721 Ga0466961_0018579
722 Ga0466961_0326371
723 Ga0466963_0012411
724 Ga0466963_0038088
725 Ga0466963_0086114
726 Ga0466963_0230884
727 Ga0466964_0090765
728 Ga0466971_0023230
729 Ga0466968_0022075
730 Ga0466970_0070350
731 Ga0466957_0073105
732 Ga0466957_0087650
733 Ga0466958_0039140
734 Ga0466958_0181090
735 Ga0466967_0003789
736 Ga0466967_0006341
737 Ga0466967_0043673
738 Ga0466967_0069529
739 Ga0466967_0082319
740 Ga0466967_0208452
741 Ga0466967_0612255
742 Ga0495669_0163540
743 Ga0496100_0027118
744 Ga0496100_0305809
745 Ga0496101_0040144
746 Ga0496101_0064807
747 Ga0496102_0025255
748 Ga0496103_0231174
749 Ga0496103_0648185
750 Ga0496105_0200802
751 Ga0496106_0087658
752 Ga0496106_0637767
753 Ga0496107_0005457
754 Ga0496107_0018513
755 Ga0496107_0042088
756 Ga0496108_0014672
757 Ga0496108_0274947
758 Ga0496109_0155425
759 Ga0496109_0557007
760 Ga0496109_0761061
761 Ga0496109_1007898
762 Ga0496110_0043768
763 Ga0496111_0072176
764 Ga0496111_0154574
765 Ga0496112_0070741
766 Ga0496112_0330354
767 Ga0496113_0028691
768 Ga0496113_0164223
769 Ga0496114_0348087
770 Ga0496115_0027802
771 Ga0501199_019995
772 Ga0501259_023208
773 Ga0501262_001643
774 Ga0501268_003036
775 Ga0501272_023407
776 Ga0466962_0501053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

22

176

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l3f-assembly1.cif.gz_A solution nmr structure of a putative uracil dna glycosylase from methanosarcina acetivorans, northeast structural genomics consortium target mvr76 0.8758 2 153
2l3f-assembly1.cif.gz_A solution nmr structure of a putative uracil dna glycosylase from methanosarcina acetivorans, northeast structural genomics consortium target mvr76 0.8208 2 153
1wyw-assembly1.cif.gz_A crystal structure of sumo1-conjugated thymine dna glycosylase 0.7619 2 152
3uo7-assembly1.cif.gz_B crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine 0.7442 2 152
5cys-assembly1.cif.gz_A structure of the enzyme-product complex resulting from tdg action on a gcac mismatch 0.7393 2 152
ID Description Score Start End Superfamily
2l3fA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8758 2 153 3.40.470.10
2l3fA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8208 2 153 3.40.470.10
af_A4I7J6_7_234_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7718 2 152 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7624 2 152 3.40.470.10
2d07A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7253 2 152 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7X5Y5W9-F1-model_v4 Hypoxanthine-DNA glycosylase 0.9428 2 155
AF-A0A3A1P671-F1-model_v4 DNA-deoxyinosine glycosylase (EC 3.2.2.15) 0.9427 2 155 GO:0033958
AF-A0A4R6QDN2-F1-model_v4 G/U mismatch-specific uracil-DNA glycosylase 0.9426 2 155
AF-A0A7G9KZD4-F1-model_v4 DNA-deoxyinosine glycosylase (EC 3.2.2.15) 0.9407 2 155 GO:0033958
AF-A0A848SFK1-F1-model_v4 DNA-deoxyinosine glycosylase (EC 3.2.2.15) 0.9401 2 155 GO:0016798

Map