F430824

General Info

Members Datasets Scaffolds Average Seq Length
387 209 774 339

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10104913|Ga0163163_101049132
Length 373
Sequence LAGLISCPKGSTVPGFVIDPSRRRASTGGKVKLEGIMKHWIKGAALGFAAPALAQKAKVTIYTSLENDQLGPFKQAIEAAVPEAEVVWVRDSTGVITARFLAEKDNPRADMVLGHAATALLLFEKMGLLETYKPAGVDALKPVFRDSSEPYTWTGMDAYLGVICYNTAEAGKLSGVKAPTAWKDLLNPAYKGKLVMPHPASSGTGYLMVGAWLQMWGEAEAWKFMDALHENIAVYTHSGSAPCVQAARGERVAGIALDMRGASEKTKGAPLEVIIPAEGTGWEMEASGIVKGTKNLAAAKKISDWVATKAANELYSKTYAVVALPGVENYPPNYPKTAEKLMIKNDFVWMAENREKILAEWTKRYESKAAPKN

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 2643221733 Bosea sp. Root381 Isolate Unclassified
203 2643221734 Bosea sp. Root670 Isolate Unclassified
204 2643221736 Bosea sp. Root483D1 Isolate Unclassified
205 2818991467 Bosea vestrisii 3192 Isolate Unclassified
206 2842694124 Methylopila sp. R-72369 Isolate Unclassified
207 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
208 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
209 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.18
Nodule 0.26
Rhizoplane 5.94
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10104913 3300014325 Bacteria 2852
2 JGI24742J22300_10019431 3300002244 Bacteria 1153
3 JGI25159J45721_1004331 3300002987 Bacteria 4736
4 JGI25151J46595_10000079 3300003187 Bacteria 132415
5 Ga0055526_1002088 3300003771 Bacteria 13714
6 Ga0055524_1000147 3300003775 Bacteria 83426
7 Ga0065165_1000410 3300005262 Bacteria 68475
8 Ga0070676_10042914 3300005328 Bacteria 2627
9 Ga0070683_100228658 3300005329 Bacteria 1768
10 Ga0070690_100047380 3300005330 Bacteria 2735
11 Ga0070690_100113085 3300005330 Bacteria 1814
12 Ga0070670_100007871 3300005331 Bacteria 9066
13 Ga0070670_100020639 3300005331 Bacteria 5667
14 Ga0070677_10149921 3300005333 Bacteria 1084
15 Ga0070689_100050335 3300005340 Bacteria 3218
16 Ga0070689_100224008 3300005340 Bacteria 1544
17 Ga0070687_100134117 3300005343 Bacteria 1433
18 Ga0070668_100034291 3300005347 Bacteria 3867
19 Ga0070668_100036645 3300005347 Bacteria 3744
20 Ga0070668_100064449 3300005347 Bacteria 2840
21 Ga0070669_100204930 3300005353 Bacteria 1553
22 Ga0070675_100097682 3300005354 Bacteria 2469
23 Ga0070675_100119315 3300005354 Bacteria 2240
24 Ga0070671_100175806 3300005355 Bacteria 1811
25 Ga0070674_100003062 3300005356 Bacteria 9303
26 Ga0070674_100070680 3300005356 Bacteria 2467
27 Ga0070673_100026031 3300005364 Bacteria 4315
28 Ga0070673_100175816 3300005364 Bacteria 1830
29 Ga0070673_100182069 3300005364 Bacteria 1799
30 Ga0070688_100095356 3300005365 Bacteria 1952
31 Ga0070667_100094997 3300005367 Bacteria 2569
32 Ga0070700_100037118 3300005441 Bacteria 2961
33 Ga0070694_100160689 3300005444 Bacteria 1648
34 Ga0070678_100022272 3300005456 Bacteria 4194
35 Ga0070662_100028847 3300005457 Bacteria 3867
36 Ga0068853_100332638 3300005539 Bacteria 1410
37 Ga0070672_100028339 3300005543 Bacteria 4188
38 Ga0070686_100149483 3300005544 Bacteria 1634
39 Ga0070695_100002350 3300005545 Bacteria 10848
40 Ga0070695_100072088 3300005545 Bacteria 2264
41 Ga0070665_100033318 3300005548 Bacteria 5184
42 Ga0070665_100216745 3300005548 Bacteria 1915
43 Ga0070704_100086506 3300005549 Bacteria 2323
44 Ga0070704_100164878 3300005549 Bacteria 1756
45 Ga0070704_100206514 3300005549 Bacteria 1589
46 Ga0068854_100107385 3300005578 Bacteria 2101
47 Ga0068864_100004476 3300005618 Bacteria 11487
48 Ga0068864_100039015 3300005618 Bacteria 4058
49 Ga0068861_100019505 3300005719 Bacteria 4844
50 Ga0068861_100074088 3300005719 Bacteria 2647
51 Ga0068861_100081770 3300005719 Bacteria 2530
52 Ga0068861_100213722 3300005719 Bacteria 1626
53 Ga0068863_100039461 3300005841 Bacteria 4491
54 Ga0068863_100132512 3300005841 Bacteria 2379
55 Ga0068858_100012466 3300005842 Bacteria 8017
56 Ga0068858_100169586 3300005842 Bacteria 2058
57 Ga0068860_100044744 3300005843 Bacteria 4218
58 Ga0068860_100391574 3300005843 Bacteria 1373
59 Ga0081455_10000161 3300005937 Bacteria 82092
60 Ga0081455_10123503 3300005937 Bacteria 2036
61 Ga0081540_1000367 3300005983 Bacteria 45207
62 Ga0081540_1105007 3300005983 Bacteria 1207
63 Ga0081539_10004830 3300005985 Bacteria 14449
64 Ga0081539_10011167 3300005985 Bacteria 7156
65 Ga0081539_10042655 3300005985 Bacteria 2640
66 Ga0075368_10000769 3300006042 Bacteria 9849
67 Ga0075368_10004533 3300006042 Bacteria 4721
68 Ga0075368_10026888 3300006042 Bacteria 2215
69 Ga0075363_100014826 3300006048 Bacteria 3820
70 Ga0075363_100019930 3300006048 Bacteria 3358
71 Ga0075363_100030451 3300006048 Bacteria 2794
72 Ga0075363_100042468 3300006048 Bacteria 2403
73 Ga0075364_10003387 3300006051 Bacteria 9057
74 Ga0075364_10012355 3300006051 Bacteria 5220
75 Ga0070716_100096515 3300006173 Bacteria 1802
76 Ga0075362_10085276 3300006177 Bacteria 1460
77 Ga0075367_10000480 3300006178 Bacteria 14936
78 Ga0075367_10008620 3300006178 Bacteria 5290
79 Ga0075367_10009209 3300006178 Bacteria 5152
80 Ga0075366_10003504 3300006195 Bacteria 8288
81 Ga0097621_100001441 3300006237 Bacteria 16326
82 Ga0075370_10070312 3300006353 Bacteria 2002
83 Ga0068871_100020218 3300006358 Bacteria 5097
84 Ga0068871_100035258 3300006358 Bacteria 3974
85 Ga0075428_100005597 3300006844 Bacteria 13953
86 Ga0075428_100015079 3300006844 Bacteria 8585
87 Ga0075428_100039005 3300006844 Bacteria 5227
88 Ga0075428_100046267 3300006844 Bacteria 4780
89 Ga0075428_100074600 3300006844 Bacteria 3705
90 Ga0075428_100234087 3300006844 Bacteria 1982
91 Ga0075428_100282057 3300006844 Bacteria 1787
92 Ga0075430_100010065 3300006846 Bacteria 7998
93 Ga0075430_100074953 3300006846 Bacteria 2837
94 Ga0075430_100081700 3300006846 Bacteria 2707
95 Ga0075430_100124179 3300006846 Bacteria 2152
96 Ga0075431_100000020 3300006847 Bacteria 82958
97 Ga0075431_100000448 3300006847 Bacteria 33819
98 Ga0075431_100148501 3300006847 Bacteria 2414
99 Ga0075431_100160702 3300006847 Bacteria 2310
100 Ga0075431_100569859 3300006847 Bacteria 1118
101 Ga0075431_100622154 3300006847 Bacteria 1062
102 Ga0075433_10000949 3300006852 Bacteria 20473
103 Ga0075433_10001455 3300006852 Bacteria 17491
104 Ga0075433_10229554 3300006852 Bacteria 1648
105 Ga0075433_10462859 3300006852 Bacteria 1117
106 Ga0075434_100004955 3300006871 Bacteria 12073
107 Ga0075434_100005316 3300006871 Bacteria 11710
108 Ga0075429_100031117 3300006880 Bacteria 4639
109 Ga0075429_100081976 3300006880 Bacteria 2812
110 Ga0075429_100128452 3300006880 Bacteria 2217
111 Ga0075429_100168373 3300006880 Bacteria 1919
112 Ga0068865_100206644 3300006881 Bacteria 1527
113 Ga0075436_100095842 3300006914 Bacteria 2064
114 Ga0075436_100183764 3300006914 Bacteria 1478
115 Ga0075435_100022498 3300007076 Plasmid 4865
116 Ga0105240_10471986 3300009093 Bacteria 1400
117 Ga0111539_10001004 3300009094 Bacteria 36978
118 Ga0111539_10006302 3300009094 Bacteria 15310
119 Ga0111539_10188108 3300009094 Bacteria 2410
120 Ga0111539_10210269 3300009094 Bacteria 2267
121 Ga0111539_10289137 3300009094 Bacteria 1907
122 Ga0111539_10325215 3300009094 Bacteria 1790
123 Ga0105245_10132108 3300009098 Bacteria 2343
124 Ga0105245_10141821 3300009098 Bacteria 2264
125 Ga0114129_10000717 3300009147 Bacteria 41954
126 Ga0114129_10119013 3300009147 Bacteria 3638
127 Ga0114129_10224574 3300009147 Bacteria 2532
128 Ga0114129_10380408 3300009147 Bacteria 1864
129 Ga0105243_10151468 3300009148 Bacteria 1990
130 Ga0105243_10160386 3300009148 Bacteria 1938
131 Ga0105242_10019248 3300009176 Bacteria 5349
132 Ga0105248_10059488 3300009177 Bacteria 4292
133 Ga0105248_10189598 3300009177 Bacteria 2317
134 Ga0105237_10146224 3300009545 Bacteria 2359
135 Ga0105249_10218443 3300009553 Bacteria 1874
136 Ga0105249_10383573 3300009553 Bacteria 1432
137 Ga0157374_10438091 3300013296 Bacteria 1307
138 Ga0157378_10013687 3300013297 Bacteria 7095
139 Ga0157378_10597678 3300013297 Bacteria 1114
140 Ga0163162_10035982 3300013306 Bacteria 4932
141 Ga0163162_10039588 3300013306 Bacteria 4711
142 Ga0157372_10055618 3300013307 Bacteria 4420
143 Ga0157375_10054145 3300013308 Bacteria 3951
144 Ga0157375_10057647 3300013308 Bacteria 3840
145 Ga0157375_10086346 3300013308 Bacteria 3188
146 Ga0157375_10427427 3300013308 Bacteria 1491
147 Ga0163163_10063032 3300014325 Bacteria 3675
148 Ga0163163_10246415 3300014325 Bacteria 1837
149 Ga0157380_10059001 3300014326 Bacteria 3061
150 Ga0157380_10064284 3300014326 Bacteria 2945
151 Ga0157380_10067165 3300014326 Bacteria 2887
152 Ga0157380_10260623 3300014326 Bacteria 1574
153 Ga0157377_10142821 3300014745 Bacteria 1473
154 Ga0157379_10186477 3300014968 Bacteria 1875
155 Ga0157376_10041280 3300014969 Bacteria 3776
156 Ga0157376_10475747 3300014969 Bacteria 1223
157 Ga0163161_10038108 3300017792 Bacteria 3447
158 Ga0213876_10047305 3300021384 Bacteria 2274
159 Ga0209130_1000130 3300025284 Bacteria 121749
160 Ga0209675_1001117 3300025291 Bacteria 16355
161 Ga0209025_1000014 3300025294 Bacteria 865448
162 Ga0209025_1001216 3300025294 Bacteria 35947
163 Ga0209564_1000179 3300025295 Bacteria 151032
164 Ga0209256_1000055 3300025299 Bacteria 295530
165 Ga0207426_1016392 3300025302 Bacteria 2661
166 Ga0207697_10006760 3300025315 Bacteria 5159
167 Ga0207682_10010742 3300025893 Bacteria 3584
168 Ga0207688_10099133 3300025901 Bacteria 1681
169 Ga0207688_10125364 3300025901 Bacteria 1501
170 Ga0207645_10041924 3300025907 Bacteria 2929
171 Ga0207643_10063205 3300025908 Bacteria 2116
172 Ga0207643_10063529 3300025908 Bacteria 2111
173 Ga0207671_10092259 3300025914 Bacteria 2283
174 Ga0207662_10094869 3300025918 Bacteria 1841
175 Ga0207650_10014681 3300025925 Bacteria 5442
176 Ga0207650_10039238 3300025925 Bacteria 3461
177 Ga0207650_10095321 3300025925 Bacteria 2281
178 Ga0207650_10216170 3300025925 Bacteria 1541
179 Ga0207659_10018200 3300025926 Bacteria 4602
180 Ga0207659_10027227 3300025926 Bacteria 3867
181 Ga0207659_10153927 3300025926 Bacteria 1798
182 Ga0207644_10019424 3300025931 Bacteria 4610
183 Ga0207644_10067162 3300025931 Bacteria 2613
184 Ga0207706_10027563 3300025933 Bacteria 5079
185 Ga0207686_10149009 3300025934 Bacteria 1626
186 Ga0207709_10042646 3300025935 Bacteria 2731
187 Ga0207709_10179615 3300025935 Bacteria 1493
188 Ga0207670_10125482 3300025936 Bacteria 1872
189 Ga0207669_10189604 3300025937 Bacteria 1482
190 Ga0207669_10292365 3300025937 Bacteria 1234
191 Ga0207704_10031764 3300025938 Bacteria 2979
192 Ga0207691_10011076 3300025940 Bacteria 8655
193 Ga0207691_10022385 3300025940 Bacteria 5960
194 Ga0207691_10038467 3300025940 Bacteria 4427
195 Ga0207689_10060995 3300025942 Bacteria 3101
196 Ga0207689_10136783 3300025942 Bacteria 2018
197 Ga0207679_10068337 3300025945 Bacteria 2669
198 Ga0207651_10037775 3300025960 Bacteria 3166
199 Ga0207651_10353986 3300025960 Bacteria 1237
200 Ga0207640_10085136 3300025981 Bacteria 2173
201 Ga0207658_10041039 3300025986 Bacteria 3349
202 Ga0207658_10350256 3300025986 Bacteria 1286
203 Ga0207677_10110809 3300026023 Bacteria 2044
204 Ga0207703_10038223 3300026035 Bacteria 3829
205 Ga0207708_10050208 3300026075 Bacteria 3176
206 Ga0207708_10074916 3300026075 Bacteria 2595
207 Ga0207641_10138664 3300026088 Bacteria 2191
208 Ga0207648_10019932 3300026089 Bacteria 6052
209 Ga0207648_10125511 3300026089 Bacteria 2258
210 Ga0207676_10005172 3300026095 Bacteria 9230
211 Ga0207676_10010506 3300026095 Bacteria 6595
212 Ga0207676_10141861 3300026095 Bacteria 2058
213 Ga0207674_10205058 3300026116 Bacteria 1921
214 Ga0207675_100017832 3300026118 Bacteria 6624
215 Ga0207675_100103326 3300026118 Bacteria 2685
216 Ga0207675_100159542 3300026118 Bacteria 2151
217 Ga0207675_100230932 3300026118 Bacteria 1785
218 Ga0207675_100296280 3300026118 Bacteria 1574
219 Ga0207683_10013730 3300026121 Bacteria 6904
220 Ga0207683_10082837 3300026121 Bacteria 2850
221 Ga0207683_10086221 3300026121 Bacteria 2791
222 Ga0209813_10000724 3300027866 Bacteria 7530
223 Ga0209813_10008616 3300027866 Bacteria 2583
224 Ga0209813_10008995 3300027866 Bacteria 2541
225 Ga0209813_10020665 3300027866 Bacteria 1844
226 Ga0207428_10001431 3300027907 Bacteria 25080
227 Ga0207428_10002846 3300027907 Bacteria 17181
228 Ga0207428_10047370 3300027907 Bacteria 3452
229 Ga0207428_10086529 3300027907 Bacteria 2440
230 Ga0207428_10104655 3300027907 Bacteria 2184
231 Ga0268266_10038313 3300028379 Bacteria 4081
232 Ga0268266_10231854 3300028379 Bacteria 1701
233 Ga0268265_10156312 3300028380 Bacteria 1930
234 Ga0268264_10176844 3300028381 Bacteria 1935
235 Ga0268264_10335786 3300028381 Bacteria 1434
236 Ga0265318_10003450 3300028577 Bacteria 7936
237 Ga0265318_10005578 3300028577 Bacteria 5899
238 Ga0265330_10029391 3300031235 Bacteria 2472
239 Ga0265332_10036796 3300031238 Bacteria 2124
240 Ga0265320_10011403 3300031240 Bacteria 5230
241 Ga0265320_10139865 3300031240 Bacteria 1097
242 Ga0265325_10028559 3300031241 Bacteria 3005
243 Ga0265329_10017718 3300031242 Bacteria 2444
244 Ga0265340_10010903 3300031247 Bacteria 4848
245 Ga0265340_10020337 3300031247 Bacteria 3412
246 Ga0265340_10027788 3300031247 Bacteria 2850
247 Ga0265331_10006565 3300031250 Bacteria 6859
248 Ga0265316_10031752 3300031344 Bacteria 4316
249 Ga0265316_10037873 3300031344 Bacteria 3888
250 Ga0265316_10095145 3300031344 Bacteria 2269
251 Ga0265313_10013386 3300031595 Bacteria 4925
252 Ga0265314_10094532 3300031711 Bacteria 1937
253 Ga0265342_10032702 3300031712 Bacteria 3206
254 Ga0373950_0004723 3300034818 Bacteria 2005
255 Ga0373938_0003338 3300034957 Unclassified 2627
256 Ga0373938_0004778 3300034957 Bacteria 2274
257 Ga0373928_0020569 3300035084 Bacteria 1384
258 Ga0373940_0006623 3300035088 Bacteria 2580
259 Ga0373949_0024600 3300035090 Unclassified 1401
260 Ga0373932_0026752 3300035112 Unclassified 1572
261 Ga0373941_0003648 3300035115 Bacteria 3509
262 Ga0373942_0011470 3300035207 Bacteria 2102
263 Ga0373961_0028371 3300035241 Unclassified 1543
264 Ga0373931_0000565 3300035691 Bacteria 15284
265 Ga0373931_0007365 3300035691 Bacteria 5180
266 Ga0373931_0095934 3300035691 Unclassified 1660
267 Ga0373931_0157268 3300035691 Bacteria 1329
268 Ga0373927_0037654 3300035695 Bacteria 3143
269 Ga0373927_0130076 3300035695 Bacteria 1644
270 Ga0439443_000595 3300042003 Bacteria 3371
271 Ga0439435_0029903 3300042436 Bacteria 1473
272 Ga0439464_0018724 3300042439 Bacteria 1886
273 Ga0451577_0108561 3300042876 Bacteria 2481
274 Ga0453684_0376780 3300044712 Bacteria 1594
275 Ga0495603_0176700 3300046455 Bacteria 1236
276 Ga0495598_0031829 3300046537 Bacteria 1487
277 Ga0495621_0006959 3300046539 Bacteria 3328
278 Ga0495658_0241575 3300046683 Bacteria 1134
279 Ga0496102_0113174 3300048905 Bacteria 2531
280 Ga0496102_0348594 3300048905 Bacteria 1394
281 Ga0496104_0000583 3300048907 Bacteria 31105
282 Ga0496104_0008521 3300048907 Bacteria 9115
283 Ga0496104_0096046 3300048907 Bacteria 2835
284 Ga0496105_0014412 3300048908 Bacteria 6293
285 Ga0496105_0292396 3300048908 Bacteria 1311
286 Ga0496108_0004663 3300048911 Bacteria 11049
287 Ga0496109_0006248 3300048912 Bacteria 10020
288 Ga0496109_0043134 3300048912 Bacteria 4088
289 Ga0496110_0005099 3300048913 Bacteria 10263
290 Ga0496110_0007124 3300048913 Bacteria 8901
291 Ga0496110_0018426 3300048913 Bacteria 5855
292 Ga0496111_0016528 3300048914 Bacteria 5086
293 Ga0496111_0039698 3300048914 Bacteria 3377
294 Ga0496111_0135149 3300048914 Bacteria 1826
295 Ga0496111_0140252 3300048914 Bacteria 1791
296 Ga0496112_0258034 3300048915 Bacteria 1693
297 Ga0496112_0277206 3300048915 Bacteria 1625
298 Ga0496113_0011508 3300048916 Bacteria 5907
299 Ga0496113_0054628 3300048916 Bacteria 2990
300 Ga0496113_0100052 3300048916 Bacteria 2246
301 Ga0496115_0069365 3300048918 Bacteria 2855
302 Ga0496122_0151068 3300048925 Bacteria 1433
303 Ga0496123_0053802 3300048926 Bacteria 2656
304 Ga0496123_0152144 3300048926 Bacteria 1246
305 Ga0496126_0093580 3300048929 Bacteria 2639
306 Ga0501033_0094814 3300049570 Bacteria 2182
307 Ga0501034_0033163 3300049571 Bacteria 5241
308 Ga0501034_0164226 3300049571 Bacteria 2190
309 Ga0501036_0085110 3300049572 Bacteria 2673
310 Ga0501043_0058695 3300049579 Bacteria 3020
311 Ga0501047_0005397 3300049581 Bacteria 12017
312 Ga0501070_0012718 3300049586 Bacteria 7098
313 Ga0501070_0098403 3300049586 Bacteria 2420
314 Ga0501072_0003806 3300049588 Bacteria 11392
315 Ga0501073_0015899 3300049589 Bacteria 5453
316 Ga0501074_0143729 3300049590 Bacteria 1706
317 Ga0501075_0245818 3300049591 Bacteria 1364
318 Ga0501079_0177331 3300049741 Bacteria 1662
319 Ga0501080_0054408 3300049742 Bacteria 3727
320 Ga0501080_0109479 3300049742 Bacteria 2561
321 Ga0501083_0016357 3300049744 Bacteria 5193
322 Ga0501083_0030243 3300049744 Bacteria 3721
323 Ga0501083_0174970 3300049744 Bacteria 1403
324 Ga0501035_0031823 3300049822 Bacteria 4805
325 nmdc:mga03683_51732_c1 3300050489 Bacteria 1716
326 nmdc:mga03683_94623_c1 3300050489 Bacteria 1306
327 nmdc:mga03n38_12882_c1 3300050490 Bacteria 3161
328 nmdc:mga03n38_22283_c1 3300050490 Bacteria 2562
329 nmdc:mga03n38_30272_c1 3300050490 Bacteria 2274
330 nmdc:mga00v17_12640_c1 3300050491 Bacteria 4662
331 nmdc:mga00v17_70440_c1 3300050491 Bacteria 2166
332 nmdc:mga0yw44_10720_c1 3300050492 Bacteria 4695
333 nmdc:mga0yw44_131688_c1 3300050492 Bacteria 1619
334 nmdc:mga0yw44_80419_c1 3300050492 Bacteria 2041
335 nmdc:mga0k408_12272_c2 3300050493 Bacteria 3561
336 nmdc:mga06z11_1379_c1 3300050494 Bacteria 9000
337 nmdc:mga06z11_23527_c1 3300050494 Bacteria 2896
338 nmdc:mga06z11_277_c1 3300050494 Bacteria 20024
339 nmdc:mga04h51_10196_c1 3300050495 Bacteria 2574
340 nmdc:mga04h51_24411_c1 3300050495 Bacteria 1851
341 nmdc:mga04h51_6301_c1 3300050495 Bacteria 3069
342 nmdc:mga04h51_942_c1 3300050495 Bacteria 6718
343 nmdc:mga07m45_53019_c1 3300050496 Bacteria 2291
344 nmdc:mga05p37_1262_c1 3300050507 Bacteria 29338
345 nmdc:mga05p37_138271_c1 3300050507 Bacteria 2985
346 nmdc:mga05p37_218965_c1 3300050507 Bacteria 2298
347 nmdc:mga05p37_26188_c2 3300050507 Bacteria 3637
348 nmdc:mga05p37_542853_c1 3300050507 Bacteria 1325
349 nmdc:mga09592_309_c1 3300050508 Bacteria 35745
350 nmdc:mga09592_67111_c1 3300050508 Bacteria 3042
351 nmdc:mga09592_71486_c1 3300050508 Bacteria 2945
352 nmdc:mga0qj67_186577_c1 3300050509 Bacteria 1685
353 nmdc:mga0qj67_29403_c2 3300050509 Bacteria 3598
354 nmdc:mga0qj67_34992_c1 3300050509 Bacteria 3926
355 nmdc:mga0qj67_43094_c1 3300050509 Bacteria 3554
356 nmdc:mga06r32_12859_c1 3300050510 Bacteria 7566
357 nmdc:mga06r32_162773_c1 3300050510 Bacteria 2213
358 nmdc:mga06r32_180960_c1 3300050510 Bacteria 2094
359 nmdc:mga06r32_296_c1 3300050510 Bacteria 41448
360 nmdc:mga06r32_43763_c1 3300050510 Bacteria 4261
361 nmdc:mga06r32_99619_c1 3300050510 Bacteria 2851
362 nmdc:mga08y16_1223_c1 3300050511 Bacteria 25402
363 nmdc:mga08y16_138531_c1 3300050511 Bacteria 2530
364 nmdc:mga08y16_36391_c1 3300050511 Bacteria 5170
365 nmdc:mga08y16_5620_c1 3300050511 Bacteria 13133
366 nmdc:mga08y16_573426_c1 3300050511 Bacteria 1140
367 nmdc:mga0n895_1411_c1 3300050512 Bacteria 17935
368 nmdc:mga0n895_276691_c1 3300050512 Bacteria 1702
369 nmdc:mga0n895_312597_c1 3300050512 Bacteria 1592
370 nmdc:mga0n895_3470_c1 3300050512 Bacteria 12717
371 nmdc:mga0n895_3594_c1 3300050512 Bacteria 12539
372 nmdc:mga08x19_124243_c1 3300050514 Bacteria 1732
373 nmdc:mga0a205_443_c1 3300050515 Bacteria 31988
374 nmdc:mga0a205_456_c1 3300050515 Bacteria 31691
375 Ga0500646_0021716 3300053090 Bacteria 1712
376 Ga0501084_0175895 3300054114 Bacteria 1807
377 Ga0501082_0000106 3300060353 Bacteria 65983
378 Ga0501082_0008374 3300060353 Bacteria 8919
379 Ga0530510_0320238 3300061734 Bacteria 1162
380 2644729794 2643221733 Bacteria 5690728
381 2644736029 2643221734 Bacteria 5365412
382 2644746401 2643221736 Bacteria 6608466
383 2819721820 2818991467 Bacteria 5893227
384 2842695203 2842694124 Bacteria 4063419
385 2842699031 2842698319 Bacteria 5190321
386 2894777195 2894772417 Bacteria 5305674
387 8057529704 8057529695 Bacteria 6306553
388 Ga0163163_10104913
389 JGI24742J22300_10019431
390 JGI25159J45721_1004331
391 JGI25151J46595_10000079
392 Ga0055526_1002088
393 Ga0055524_1000147
394 Ga0065165_1000410
395 Ga0070676_10042914
396 Ga0070683_100228658
397 Ga0070690_100047380
398 Ga0070690_100113085
399 Ga0070670_100007871
400 Ga0070670_100020639
401 Ga0070677_10149921
402 Ga0070689_100050335
403 Ga0070689_100224008
404 Ga0070687_100134117
405 Ga0070668_100034291
406 Ga0070668_100036645
407 Ga0070668_100064449
408 Ga0070669_100204930
409 Ga0070675_100097682
410 Ga0070675_100119315
411 Ga0070671_100175806
412 Ga0070674_100003062
413 Ga0070674_100070680
414 Ga0070673_100026031
415 Ga0070673_100175816
416 Ga0070673_100182069
417 Ga0070688_100095356
418 Ga0070667_100094997
419 Ga0070700_100037118
420 Ga0070694_100160689
421 Ga0070678_100022272
422 Ga0070662_100028847
423 Ga0068853_100332638
424 Ga0070672_100028339
425 Ga0070686_100149483
426 Ga0070695_100002350
427 Ga0070695_100072088
428 Ga0070665_100033318
429 Ga0070665_100216745
430 Ga0070704_100086506
431 Ga0070704_100164878
432 Ga0070704_100206514
433 Ga0068854_100107385
434 Ga0068864_100004476
435 Ga0068864_100039015
436 Ga0068861_100019505
437 Ga0068861_100074088
438 Ga0068861_100081770
439 Ga0068861_100213722
440 Ga0068863_100039461
441 Ga0068863_100132512
442 Ga0068858_100012466
443 Ga0068858_100169586
444 Ga0068860_100044744
445 Ga0068860_100391574
446 Ga0081455_10000161
447 Ga0081455_10123503
448 Ga0081540_1000367
449 Ga0081540_1105007
450 Ga0081539_10004830
451 Ga0081539_10011167
452 Ga0081539_10042655
453 Ga0075368_10000769
454 Ga0075368_10004533
455 Ga0075368_10026888
456 Ga0075363_100014826
457 Ga0075363_100019930
458 Ga0075363_100030451
459 Ga0075363_100042468
460 Ga0075364_10003387
461 Ga0075364_10012355
462 Ga0070716_100096515
463 Ga0075362_10085276
464 Ga0075367_10000480
465 Ga0075367_10008620
466 Ga0075367_10009209
467 Ga0075366_10003504
468 Ga0097621_100001441
469 Ga0075370_10070312
470 Ga0068871_100020218
471 Ga0068871_100035258
472 Ga0075428_100005597
473 Ga0075428_100015079
474 Ga0075428_100039005
475 Ga0075428_100046267
476 Ga0075428_100074600
477 Ga0075428_100234087
478 Ga0075428_100282057
479 Ga0075430_100010065
480 Ga0075430_100074953
481 Ga0075430_100081700
482 Ga0075430_100124179
483 Ga0075431_100000020
484 Ga0075431_100000448
485 Ga0075431_100148501
486 Ga0075431_100160702
487 Ga0075431_100569859
488 Ga0075431_100622154
489 Ga0075433_10000949
490 Ga0075433_10001455
491 Ga0075433_10229554
492 Ga0075433_10462859
493 Ga0075434_100004955
494 Ga0075434_100005316
495 Ga0075429_100031117
496 Ga0075429_100081976
497 Ga0075429_100128452
498 Ga0075429_100168373
499 Ga0068865_100206644
500 Ga0075436_100095842
501 Ga0075436_100183764
502 Ga0075435_100022498
503 Ga0105240_10471986
504 Ga0111539_10001004
505 Ga0111539_10006302
506 Ga0111539_10188108
507 Ga0111539_10210269
508 Ga0111539_10289137
509 Ga0111539_10325215
510 Ga0105245_10132108
511 Ga0105245_10141821
512 Ga0114129_10000717
513 Ga0114129_10119013
514 Ga0114129_10224574
515 Ga0114129_10380408
516 Ga0105243_10151468
517 Ga0105243_10160386
518 Ga0105242_10019248
519 Ga0105248_10059488
520 Ga0105248_10189598
521 Ga0105237_10146224
522 Ga0105249_10218443
523 Ga0105249_10383573
524 Ga0157374_10438091
525 Ga0157378_10013687
526 Ga0157378_10597678
527 Ga0163162_10035982
528 Ga0163162_10039588
529 Ga0157372_10055618
530 Ga0157375_10054145
531 Ga0157375_10057647
532 Ga0157375_10086346
533 Ga0157375_10427427
534 Ga0163163_10063032
535 Ga0163163_10246415
536 Ga0157380_10059001
537 Ga0157380_10064284
538 Ga0157380_10067165
539 Ga0157380_10260623
540 Ga0157377_10142821
541 Ga0157379_10186477
542 Ga0157376_10041280
543 Ga0157376_10475747
544 Ga0163161_10038108
545 Ga0213876_10047305
546 Ga0209130_1000130
547 Ga0209675_1001117
548 Ga0209025_1000014
549 Ga0209025_1001216
550 Ga0209564_1000179
551 Ga0209256_1000055
552 Ga0207426_1016392
553 Ga0207697_10006760
554 Ga0207682_10010742
555 Ga0207688_10099133
556 Ga0207688_10125364
557 Ga0207645_10041924
558 Ga0207643_10063205
559 Ga0207643_10063529
560 Ga0207671_10092259
561 Ga0207662_10094869
562 Ga0207650_10014681
563 Ga0207650_10039238
564 Ga0207650_10095321
565 Ga0207650_10216170
566 Ga0207659_10018200
567 Ga0207659_10027227
568 Ga0207659_10153927
569 Ga0207644_10019424
570 Ga0207644_10067162
571 Ga0207706_10027563
572 Ga0207686_10149009
573 Ga0207709_10042646
574 Ga0207709_10179615
575 Ga0207670_10125482
576 Ga0207669_10189604
577 Ga0207669_10292365
578 Ga0207704_10031764
579 Ga0207691_10011076
580 Ga0207691_10022385
581 Ga0207691_10038467
582 Ga0207689_10060995
583 Ga0207689_10136783
584 Ga0207679_10068337
585 Ga0207651_10037775
586 Ga0207651_10353986
587 Ga0207640_10085136
588 Ga0207658_10041039
589 Ga0207658_10350256
590 Ga0207677_10110809
591 Ga0207703_10038223
592 Ga0207708_10050208
593 Ga0207708_10074916
594 Ga0207641_10138664
595 Ga0207648_10019932
596 Ga0207648_10125511
597 Ga0207676_10005172
598 Ga0207676_10010506
599 Ga0207676_10141861
600 Ga0207674_10205058
601 Ga0207675_100017832
602 Ga0207675_100103326
603 Ga0207675_100159542
604 Ga0207675_100230932
605 Ga0207675_100296280
606 Ga0207683_10013730
607 Ga0207683_10082837
608 Ga0207683_10086221
609 Ga0209813_10000724
610 Ga0209813_10008616
611 Ga0209813_10008995
612 Ga0209813_10020665
613 Ga0207428_10001431
614 Ga0207428_10002846
615 Ga0207428_10047370
616 Ga0207428_10086529
617 Ga0207428_10104655
618 Ga0268266_10038313
619 Ga0268266_10231854
620 Ga0268265_10156312
621 Ga0268264_10176844
622 Ga0268264_10335786
623 Ga0265318_10003450
624 Ga0265318_10005578
625 Ga0265330_10029391
626 Ga0265332_10036796
627 Ga0265320_10011403
628 Ga0265320_10139865
629 Ga0265325_10028559
630 Ga0265329_10017718
631 Ga0265340_10010903
632 Ga0265340_10020337
633 Ga0265340_10027788
634 Ga0265331_10006565
635 Ga0265316_10031752
636 Ga0265316_10037873
637 Ga0265316_10095145
638 Ga0265313_10013386
639 Ga0265314_10094532
640 Ga0265342_10032702
641 Ga0373950_0004723
642 Ga0373938_0003338
643 Ga0373938_0004778
644 Ga0373928_0020569
645 Ga0373940_0006623
646 Ga0373949_0024600
647 Ga0373932_0026752
648 Ga0373941_0003648
649 Ga0373942_0011470
650 Ga0373961_0028371
651 Ga0373931_0000565
652 Ga0373931_0007365
653 Ga0373931_0095934
654 Ga0373931_0157268
655 Ga0373927_0037654
656 Ga0373927_0130076
657 Ga0439443_000595
658 Ga0439435_0029903
659 Ga0439464_0018724
660 Ga0451577_0108561
661 Ga0453684_0376780
662 Ga0495603_0176700
663 Ga0495598_0031829
664 Ga0495621_0006959
665 Ga0495658_0241575
666 Ga0496102_0113174
667 Ga0496102_0348594
668 Ga0496104_0000583
669 Ga0496104_0008521
670 Ga0496104_0096046
671 Ga0496105_0014412
672 Ga0496105_0292396
673 Ga0496108_0004663
674 Ga0496109_0006248
675 Ga0496109_0043134
676 Ga0496110_0005099
677 Ga0496110_0007124
678 Ga0496110_0018426
679 Ga0496111_0016528
680 Ga0496111_0039698
681 Ga0496111_0135149
682 Ga0496111_0140252
683 Ga0496112_0258034
684 Ga0496112_0277206
685 Ga0496113_0011508
686 Ga0496113_0054628
687 Ga0496113_0100052
688 Ga0496115_0069365
689 Ga0496122_0151068
690 Ga0496123_0053802
691 Ga0496123_0152144
692 Ga0496126_0093580
693 Ga0501033_0094814
694 Ga0501034_0033163
695 Ga0501034_0164226
696 Ga0501036_0085110
697 Ga0501043_0058695
698 Ga0501047_0005397
699 Ga0501070_0012718
700 Ga0501070_0098403
701 Ga0501072_0003806
702 Ga0501073_0015899
703 Ga0501074_0143729
704 Ga0501075_0245818
705 Ga0501079_0177331
706 Ga0501080_0054408
707 Ga0501080_0109479
708 Ga0501083_0016357
709 Ga0501083_0030243
710 Ga0501083_0174970
711 Ga0501035_0031823
712 nmdc:mga03683_51732_c1
713 nmdc:mga03683_94623_c1
714 nmdc:mga03n38_12882_c1
715 nmdc:mga03n38_22283_c1
716 nmdc:mga03n38_30272_c1
717 nmdc:mga00v17_12640_c1
718 nmdc:mga00v17_70440_c1
719 nmdc:mga0yw44_10720_c1
720 nmdc:mga0yw44_131688_c1
721 nmdc:mga0yw44_80419_c1
722 nmdc:mga0k408_12272_c2
723 nmdc:mga06z11_1379_c1
724 nmdc:mga06z11_23527_c1
725 nmdc:mga06z11_277_c1
726 nmdc:mga04h51_10196_c1
727 nmdc:mga04h51_24411_c1
728 nmdc:mga04h51_6301_c1
729 nmdc:mga04h51_942_c1
730 nmdc:mga07m45_53019_c1
731 nmdc:mga05p37_1262_c1
732 nmdc:mga05p37_138271_c1
733 nmdc:mga05p37_218965_c1
734 nmdc:mga05p37_26188_c2
735 nmdc:mga05p37_542853_c1
736 nmdc:mga09592_309_c1
737 nmdc:mga09592_67111_c1
738 nmdc:mga09592_71486_c1
739 nmdc:mga0qj67_186577_c1
740 nmdc:mga0qj67_29403_c2
741 nmdc:mga0qj67_34992_c1
742 nmdc:mga0qj67_43094_c1
743 nmdc:mga06r32_12859_c1
744 nmdc:mga06r32_162773_c1
745 nmdc:mga06r32_180960_c1
746 nmdc:mga06r32_296_c1
747 nmdc:mga06r32_43763_c1
748 nmdc:mga06r32_99619_c1
749 nmdc:mga08y16_1223_c1
750 nmdc:mga08y16_138531_c1
751 nmdc:mga08y16_36391_c1
752 nmdc:mga08y16_5620_c1
753 nmdc:mga08y16_573426_c1
754 nmdc:mga0n895_1411_c1
755 nmdc:mga0n895_276691_c1
756 nmdc:mga0n895_312597_c1
757 nmdc:mga0n895_3470_c1
758 nmdc:mga0n895_3594_c1
759 nmdc:mga08x19_124243_c1
760 nmdc:mga0a205_443_c1
761 nmdc:mga0a205_456_c1
762 Ga0500646_0021716
763 Ga0501084_0175895
764 Ga0501082_0000106
765 Ga0501082_0008374
766 Ga0530510_0320238
767 2644729794
768 2644736029
769 2644746401
770 2819721820
771 2842695203
772 2842699031
773 2894777195
774 8057529704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

106

351

0.85

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

74

343

0.82

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

58

313

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9326 17 327
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.9129 18 326
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9074 17 327
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8964 18 326
2qry-assembly1.cif.gz_A periplasmic thiamin binding protein 0.8359 18 326
ID Description Score Start End Superfamily
4r74A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.915 124 327 3.40.190.10
4r74A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8921 124 327 3.40.190.10
af_Q2G1D9_30_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8809 20 305 3.40.190.10
af_Q2G1D9_30_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8635 20 305 3.40.190.10
3tyhC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.856 20 118 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0B8P3Z4-F1-model_v4 Ferric iron ABC transporter, iron-binding protein 0.983 125 238 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A221BTQ5-F1-model_v4 deleted 0.968 19 334
AF-A0A1Y5EC47-F1-model_v4 Putative 2-aminoethylphosphonate ABC transporter substrate-binding protein 0.9651 5 333 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-X1RAC7-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9633 60 285 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A1Y5EC47-F1-model_v4 Putative 2-aminoethylphosphonate ABC transporter substrate-binding protein 0.9621 5 333 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Map