F430787

General Info

Members Datasets Scaffolds Average Seq Length
387 255 351 460

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10012390|Ga0075369_100123902
Length 512
Sequence MTASHSSLSLSQQLLRRRPVAGAPVAHGASDHLKRSIGTFQLTLFGVGATVGTGIFFVLSAAVPEAGPAVLVSFVLAAIAAGLSAICYAEMASSVPVSGSTYSYAYTTMGEFVAMGVAACLLLEYGVSISAVAVGWSGYLNKLLDNLFGWQLPQSLTAAPWDASPGIVNLPAVLLIVMCMLLLIRGASESAMVNTVMVLIKLGVLSMFIIIALTAFNADHFHGFWDKGMGGITTAASMIFFSFIGLDAVSTAGDEVKNPQKTMPRAIIAALIVVTTFYILVAFAGLGTQDAAEFGSDEQAEAGLSVILEKITGGTWASTLLAAGAVISIFSVTLVVMYGQTRILFAMGRDGLLPSMFAKVNPRSMTPVGNTVIVAVATGILAGFIPLNWLLDAVSIGTLVAFITVSVGVIILRVREPNLERPFKVPGYPVTPVLSVLACAAVLYGLRWQTWLVFGGCVGLVLLFYLFWGRRHSALNDGGDGYIPTAVPGDDDVMVVGEPADHHFVSPPKEPQ

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221566 Microbacterium sp. Root166 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
12 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
15 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
16 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
17 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
22 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
23 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
24 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
25 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
26 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
27 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
28 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
29 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
30 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
31 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
32 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
33 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
34 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
35 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
36 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
41 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
42 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.7
Metatranscriptomes 0
Isolates 9.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 19.64
Nodule 0
Rhizoplane 8.27
Rhizosphere 59.17
Stem 0
Stem Tuber 0
Unclassified 12.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10025396 3300001979 Bacteria 1997
2 JGI24737J22298_10016879 3300001990 Bacteria 2355
3 JGI24735J21928_10006158 3300002067 Bacteria 3961
4 JGI24745J21846_1000230 3300002073 Bacteria 4594
5 JGI24745J21846_1001128 3300002073 Bacteria 2538
6 JGI24744J21845_10003542 3300002077 Bacteria 3212
7 JGI24751J29686_10013500 3300002459 Bacteria 1686
8 Ga0055524_1003107 3300003775 Bacteria 8196
9 Ga0055536_1001392 3300003781 Bacteria 14629
10 Ga0055528_1006777 3300003790 Bacteria 5151
11 Ga0055530_10005206 3300003791 Bacteria 6309
12 Ga0055540_1003275 3300003792 Bacteria 7920
13 Ga0055540_1003882 3300003792 Bacteria 7018
14 Ga0055540_1005570 3300003792 Bacteria 5251
15 Ga0065165_1001692 3300005262 Bacteria 22261
16 Ga0068869_100095662 3300005334 Bacteria 2241
17 Ga0068868_100036503 3300005338 Bacteria 3804
18 Ga0070660_100040436 3300005339 Bacteria 3548
19 Ga0070692_10036468 3300005345 Bacteria 2495
20 Ga0070668_100021995 3300005347 Bacteria 4819
21 Ga0070668_100038264 3300005347 Bacteria 3666
22 Ga0070668_100050429 3300005347 Bacteria 3204
23 Ga0070669_100000944 3300005353 Bacteria 21209
24 Ga0070675_100065280 3300005354 Bacteria 3009
25 Ga0070671_100002004 3300005355 Bacteria 15647
26 Ga0070673_100033633 3300005364 Bacteria 3874
27 Ga0070673_100139086 3300005364 Bacteria 2046
28 Ga0070667_100000182 3300005367 Bacteria 75588
29 Ga0070667_100155748 3300005367 Bacteria 2009
30 Ga0070700_100013557 3300005441 Bacteria 4580
31 Ga0070678_100030599 3300005456 Bacteria 3702
32 Ga0070662_100088523 3300005457 Bacteria 2320
33 Ga0068853_100034081 3300005539 Bacteria 4321
34 Ga0070686_100041716 3300005544 Bacteria 2870
35 Ga0070686_100060514 3300005544 Bacteria 2444
36 Ga0070665_100008095 3300005548 Bacteria 10641
37 Ga0068852_100009440 3300005616 Bacteria 7246
38 Ga0068864_100035390 3300005618 Bacteria 4251
39 Ga0068861_100100305 3300005719 Bacteria 2301
40 Ga0068861_100105878 3300005719 Bacteria 2246
41 Ga0068863_100012289 3300005841 Bacteria 8265
42 Ga0068863_100014842 3300005841 Bacteria 7486
43 Ga0068863_100103518 3300005841 Bacteria 2708
44 Ga0068858_100039299 3300005842 Bacteria 4389
45 Ga0068858_100079883 3300005842 Bacteria 3039
46 Ga0068860_100000374 3300005843 Bacteria 58635
47 Ga0068860_100011490 3300005843 Bacteria 8725
48 Ga0068862_100000276 3300005844 Bacteria 57404
49 Ga0075365_10000933 3300006038 Bacteria 12363
50 Ga0075365_10064480 3300006038 Bacteria 2454
51 Ga0075368_10013410 3300006042 Bacteria 3010
52 Ga0075363_100000565 3300006048 Bacteria 12113
53 Ga0075363_100001303 3300006048 Bacteria 9309
54 Ga0075364_10005879 3300006051 Bacteria 7167
55 Ga0075364_10010497 3300006051 Bacteria 5596
56 Ga0075364_10011450 3300006051 Bacteria 5389
57 Ga0075364_10043253 3300006051 Bacteria 2928
58 Ga0075364_10061034 3300006051 Bacteria 2472
59 Ga0075367_10003453 3300006178 Bacteria 7539
60 Ga0075367_10032370 3300006178 Bacteria 3009
61 Ga0075369_10011451 3300006186 Bacteria 3490
62 Ga0075369_10012390 3300006186 Bacteria 3370
63 Ga0075369_10015425 3300006186 Bacteria 3066
64 Ga0075369_10035834 3300006186 Bacteria 2110
65 Ga0075370_10002037 3300006353 Bacteria 9171
66 Ga0075370_10010316 3300006353 Bacteria 4880
67 Ga0075370_10065488 3300006353 Bacteria 2072
68 Ga0075370_10080835 3300006353 Bacteria 1868
69 Ga0075428_100001829 3300006844 Bacteria 22768
70 Ga0075430_100061759 3300006846 Bacteria 3148
71 Ga0105250_10014957 3300009092 Bacteria 3182
72 Ga0105245_10036394 3300009098 Bacteria 4373
73 Ga0105245_10121846 3300009098 Bacteria 2437
74 Ga0105245_10153964 3300009098 Bacteria 2176
75 Ga0105247_10000181 3300009101 Bacteria 61066
76 Ga0114129_10231721 3300009147 Bacteria 2487
77 Ga0105243_10086945 3300009148 Bacteria 2565
78 Ga0105248_10000652 3300009177 Bacteria 39387
79 Ga0105237_10003090 3300009545 Bacteria 20059
80 Ga0105237_10102058 3300009545 Bacteria 2860
81 Ga0105237_10206732 3300009545 Bacteria 1963
82 Ga0105237_10295407 3300009545 Bacteria 1623
83 Ga0105249_10000022 3300009553 Bacteria 258377
84 Ga0105249_10114374 3300009553 Bacteria 2555
85 Ga0105239_10001222 3300010375 Bacteria 35019
86 Ga0105246_10104160 3300011119 Bacteria 2072
87 Ga0157373_10034679 3300013100 Bacteria 3625
88 Ga0157370_10269227 3300013104 Bacteria 1574
89 Ga0157374_10027232 3300013296 Bacteria 5153
90 Ga0157374_10067371 3300013296 Bacteria 3366
91 Ga0157378_10218039 3300013297 Bacteria 1813
92 Ga0163162_10035949 3300013306 Bacteria 4935
93 Ga0163162_10060900 3300013306 Bacteria 3811
94 Ga0163162_10081584 3300013306 Bacteria 3305
95 Ga0157372_10247200 3300013307 Bacteria 2070
96 Ga0157375_10072887 3300013308 Bacteria 3452
97 Ga0157375_10103532 3300013308 Bacteria 2934
98 Ga0163163_10018904 3300014325 Bacteria 6464
99 Ga0182008_10001391 3300014497 Bacteria 16347
100 Ga0157379_10086006 3300014968 Bacteria 2819
101 Ga0157376_10253710 3300014969 Bacteria 1644
102 Ga0182006_1000010 3300015261 Bacteria 413414
103 Ga0182007_10000021 3300015262 Bacteria 193408
104 Ga0182005_1000009 3300015265 Bacteria 455334
105 Ga0209565_1000183 3300025263 Bacteria 76983
106 Ga0209673_1001029 3300025273 Bacteria 33050
107 Ga0209675_1009580 3300025291 Bacteria 3405
108 Ga0209676_1000169 3300025292 Bacteria 155600
109 Ga0209564_1010622 3300025295 Bacteria 4216
110 Ga0209758_1011627 3300025297 Bacteria 5066
111 Ga0209050_1000737 3300025298 Bacteria 47468
112 Ga0209050_1026737 3300025298 Bacteria 1923
113 Ga0209256_1003299 3300025299 Bacteria 11507
114 Ga0209256_1004315 3300025299 Bacteria 9044
115 Ga0209256_1013656 3300025299 Bacteria 2998
116 Ga0209051_1001329 3300025303 Bacteria 21504
117 Ga0209051_1001836 3300025303 Bacteria 16785
118 Ga0209051_1003906 3300025303 Bacteria 9508
119 Ga0209051_1003994 3300025303 Bacteria 9366
120 Ga0209257_1000352 3300025304 Bacteria 94530
121 Ga0207710_10000091 3300025900 Bacteria 121330
122 Ga0207688_10000607 3300025901 Bacteria 17637
123 Ga0207688_10018599 3300025901 Bacteria 3780
124 Ga0207688_10039405 3300025901 Bacteria 2624
125 Ga0207647_10057064 3300025904 Bacteria 2394
126 Ga0207645_10020571 3300025907 Bacteria 4318
127 Ga0207662_10029369 3300025918 Bacteria 3185
128 Ga0207657_10031088 3300025919 Bacteria 4840
129 Ga0207681_10001711 3300025923 Bacteria 14112
130 Ga0207687_10019744 3300025927 Bacteria 4467
131 Ga0207644_10005495 3300025931 Bacteria 8254
132 Ga0207644_10048880 3300025931 Bacteria 3026
133 Ga0207644_10086188 3300025931 Bacteria 2332
134 Ga0207706_10024272 3300025933 Bacteria 5435
135 Ga0207706_10073055 3300025933 Bacteria 3016
136 Ga0207711_10000713 3300025941 Bacteria 32689
137 Ga0207689_10021096 3300025942 Bacteria 5475
138 Ga0207712_10000005 3300025961 Bacteria 608697
139 Ga0207712_10034727 3300025961 Bacteria 3419
140 Ga0207668_10079876 3300025972 Bacteria 2368
141 Ga0207668_10148922 3300025972 Bacteria 1809
142 Ga0207658_10000316 3300025986 Bacteria 48662
143 Ga0207658_10037468 3300025986 Bacteria 3485
144 Ga0207677_10012344 3300026023 Bacteria 4907
145 Ga0207677_10029800 3300026023 Bacteria 3474
146 Ga0207703_10031218 3300026035 Bacteria 4211
147 Ga0207703_10169924 3300026035 Bacteria 1917
148 Ga0207639_10050716 3300026041 Bacteria 3152
149 Ga0207678_10081104 3300026067 Bacteria 2777
150 Ga0207708_10007513 3300026075 Bacteria 8058
151 Ga0207641_10003321 3300026088 Bacteria 14315
152 Ga0207641_10011331 3300026088 Bacteria 7318
153 Ga0207648_10030210 3300026089 Bacteria 4801
154 Ga0207674_10094425 3300026116 Bacteria 2977
155 Ga0207675_100006322 3300026118 Bacteria 11235
156 Ga0207683_10139236 3300026121 Bacteria 2186
157 Ga0207698_10154777 3300026142 Bacteria 1995
158 Ga0268266_10004670 3300028379 Bacteria 13049
159 Ga0268266_10052979 3300028379 Bacteria 3485
160 Ga0268265_10000005 3300028380 Bacteria 535350
161 Ga0268264_10000005 3300028381 Bacteria 934972
162 Ga0268264_10010358 3300028381 Bacteria 7711
163 Ga0268264_10072996 3300028381 Bacteria 2911
164 Ga0307515_10040608 3300028794 Bacteria 7351
165 Ga0307408_100000731 3300031548 Bacteria 26605
166 Ga0307410_10006022 3300031852 Bacteria 6501
167 Ga0307409_100017354 3300031995 Bacteria 4795
168 Ga0307415_100141980 3300032126 Bacteria 1836
169 Ga0436365_0107941 3300039437 Bacteria 28327
170 Ga0436365_0548618 3300039437 Bacteria 38439
171 Ga0436365_1573747 3300039437 Bacteria 26695
172 Ga0436361_0011709 3300039447 Bacteria 1544
173 Ga0439466_0014571 3300041411 Bacteria 2861
174 Ga0439465_0001186 3300041413 Bacteria 8384
175 Ga0439465_0001363 3300041413 Bacteria 7873
176 Ga0439465_0001930 3300041413 Bacteria 6796
177 Ga0439465_0002415 3300041413 Bacteria 6118
178 Ga0451789_0474344 3300041443 Bacteria 2567
179 Ga0451853_1486162 3300041512 Bacteria 16111
180 Ga0466969_0022091 3300044656 Bacteria 3288
181 Ga0466972_0048382 3300044658 Bacteria 2054
182 Ga0466965_0003174 3300044683 Bacteria 7178
183 Ga0466966_0008187 3300044684 Bacteria 6929
184 Ga0466966_0012714 3300044684 Bacteria 5579
185 Ga0466966_0034032 3300044684 Bacteria 3297
186 Ga0466966_0040657 3300044684 Bacteria 2992
187 Ga0466961_0000291 3300044693 Bacteria 33308
188 Ga0466961_0017207 3300044693 Bacteria 4644
189 Ga0466963_0041460 3300044694 Bacteria 3020
190 Ga0466963_0141931 3300044694 Bacteria 1664
191 Ga0466968_0004089 3300044735 Bacteria 5431
192 Ga0466970_0008305 3300044765 Bacteria 5222
193 Ga0466970_0014265 3300044765 Bacteria 4076
194 Ga0466957_0055710 3300044842 Bacteria 2416
195 Ga0466957_0059592 3300044842 Bacteria 2340
196 Ga0466960_0002334 3300044901 Bacteria 7129
197 Ga0466959_0004307 3300045049 Bacteria 9502
198 Ga0466959_0009597 3300045049 Bacteria 6885
199 Ga0466959_0032275 3300045049 Bacteria 3876
200 Ga0466958_0016688 3300045836 Bacteria 4232
201 Ga0466958_0018325 3300045836 Bacteria 4062
202 Ga0495627_000654 3300046453 Bacteria 26690
203 Ga0495638_0000230 3300046460 Bacteria 76565
204 Ga0495638_0002617 3300046460 Bacteria 14483
205 Ga0495638_0023892 3300046460 Bacteria 3992
206 Ga0495650_0000207 3300046471 Bacteria 127568
207 Ga0495583_0000025 3300046506 Bacteria 263775
208 Ga0495606_0029333 3300046507 Bacteria 3865
209 Ga0495610_0000794 3300046512 Bacteria 29605
210 Ga0495610_0003341 3300046512 Bacteria 12593
211 Ga0495616_0001257 3300046513 Bacteria 17834
212 Ga0495620_0010973 3300046515 Bacteria 4749
213 Ga0495632_0000545 3300046519 Bacteria 35398
214 Ga0495648_0009985 3300046524 Bacteria 7281
215 Ga0495654_0000016 3300046530 Bacteria 306416
216 Ga0495668_0000040 3300046616 Bacteria 230681
217 Ga0495668_0002079 3300046616 Bacteria 17342
218 Ga0495668_0009708 3300046616 Bacteria 5881
219 Ga0495625_0000043 3300046660 Bacteria 205715
220 Ga0495625_0002055 3300046660 Bacteria 22587
221 Ga0495625_0008772 3300046660 Bacteria 8567
222 Ga0495625_0014285 3300046660 Bacteria 6344
223 Ga0495589_0000982 3300046794 Bacteria 17349
224 Ga0495660_0013397 3300046810 Bacteria 4753
225 Ga0495660_0035390 3300046810 Bacteria 2790
226 Ga0495672_0000014 3300047320 Bacteria 505636
227 Ga0495672_0001651 3300047320 Bacteria 21680
228 Ga0495672_0006505 3300047320 Bacteria 9028
229 Ga0495679_005340 3300047446 Bacteria 5711
230 Ga0495673_0000223 3300047469 Bacteria 84150
231 Ga0495673_0004053 3300047469 Bacteria 9335
232 Ga0495673_0004409 3300047469 Bacteria 8811
233 Ga0495686_0005282 3300047472 Bacteria 10245
234 Ga0495686_0009405 3300047472 Bacteria 7043
235 Ga0495686_0012447 3300047472 Bacteria 5949
236 Ga0495686_0028837 3300047472 Bacteria 3613
237 Ga0496100_0034648 3300048903 Bacteria 3170
238 Ga0496100_0148771 3300048903 Bacteria 1668
239 Ga0496101_0005686 3300048904 Bacteria 7956
240 Ga0496102_0000050 3300048905 Bacteria 179469
241 Ga0496102_0024044 3300048905 Bacteria 5416
242 Ga0496102_0033571 3300048905 Bacteria 4611
243 Ga0496102_0098881 3300048905 Bacteria 2708
244 Ga0496102_0166829 3300048905 Bacteria 2072
245 Ga0496103_0000738 3300048906 Bacteria 24107
246 Ga0496104_0057895 3300048907 Bacteria 3668
247 Ga0496104_0152433 3300048907 Bacteria 2218
248 Ga0496106_0028420 3300048909 Bacteria 4166
249 Ga0496106_0045011 3300048909 Bacteria 3314
250 Ga0496107_0000029 3300048910 Bacteria 102345
251 Ga0496107_0032650 3300048910 Bacteria 3721
252 Ga0496107_0054524 3300048910 Bacteria 2886
253 Ga0496108_0000394 3300048911 Bacteria 36076
254 Ga0496108_0023708 3300048911 Bacteria 5050
255 Ga0496108_0090164 3300048911 Bacteria 2606
256 Ga0496108_0166340 3300048911 Bacteria 1907
257 Ga0496109_0008395 3300048912 Bacteria 8780
258 Ga0496109_0022968 3300048912 Bacteria 5530
259 Ga0496110_0200701 3300048913 Bacteria 1812
260 Ga0496111_0088071 3300048914 Bacteria 2273
261 Ga0496112_0008930 3300048915 Bacteria 8997
262 Ga0496112_0013620 3300048915 Bacteria 7515
263 Ga0496113_0008581 3300048916 Bacteria 6666
264 Ga0496113_0026894 3300048916 Bacteria 4118
265 Ga0496113_0033593 3300048916 Bacteria 3737
266 Ga0496115_0002259 3300048918 Bacteria 13788
267 Ga0496116_0014608 3300048919 Bacteria 6259
268 Ga0496116_0027386 3300048919 Bacteria 4151
269 Ga0496117_0000010 3300048920 Bacteria 611954
270 Ga0496118_0000009 3300048921 Bacteria 611954
271 Ga0496118_0000256 3300048921 Bacteria 94056
272 Ga0496118_0001032 3300048921 Bacteria 43337
273 Ga0496119_0021912 3300048922 Bacteria 4595
274 Ga0496120_0007390 3300048923 Bacteria 8184
275 Ga0496121_0002142 3300048924 Bacteria 31007
276 Ga0496121_0010034 3300048924 Bacteria 10753
277 Ga0496121_0072978 3300048924 Bacteria 2752
278 Ga0496122_0000112 3300048925 Bacteria 187099
279 Ga0496122_0001806 3300048925 Bacteria 32791
280 Ga0496122_0116034 3300048925 Bacteria 1742
281 Ga0496123_0004642 3300048926 Bacteria 14267
282 Ga0496123_0023558 3300048926 Bacteria 4708
283 Ga0496124_0024037 3300048927 Bacteria 5548
284 Ga0496124_0092350 3300048927 Bacteria 2465
285 Ga0496124_0120161 3300048927 Bacteria 2101
286 Ga0496124_0129621 3300048927 Bacteria 2005
287 Ga0496125_0035389 3300048928 Bacteria 4381
288 Ga0496126_0002750 3300048929 Bacteria 23226
289 Ga0496126_0007007 3300048929 Bacteria 12447
290 Ga0496126_0036098 3300048929 Bacteria 4625
291 Ga0496126_0051261 3300048929 Bacteria 3758
292 Ga0501031_0010523 3300049568 Bacteria 6023
293 Ga0501032_0002631 3300049569 Bacteria 14022
294 Ga0501032_0011527 3300049569 Bacteria 6350
295 Ga0501034_0029412 3300049571 Bacteria 5583
296 Ga0501036_0009975 3300049572 Bacteria 7820
297 Ga0501038_0012818 3300049574 Bacteria 7656
298 Ga0501039_0024262 3300049575 Bacteria 4657
299 Ga0501040_0008485 3300049576 Bacteria 6672
300 Ga0501042_0003709 3300049578 Bacteria 9649
301 Ga0501047_0004486 3300049581 Bacteria 13134
302 Ga0501048_0026527 3300049582 Bacteria 4218
303 Ga0501071_0046627 3300049587 Bacteria 3112
304 Ga0501072_0035538 3300049588 Bacteria 3903
305 Ga0501074_0014770 3300049590 Bacteria 5681
306 Ga0501075_0018921 3300049591 Bacteria 4992
307 Ga0501076_0017277 3300049592 Bacteria 5480
308 Ga0501080_0010341 3300049742 Bacteria 8535
309 Ga0501081_0132183 3300049743 Bacteria 1784
310 Ga0501035_0004606 3300049822 Bacteria 13077
311 Ga0501044_0000388 3300049823 Bacteria 54487
312 Ga0501045_0007986 3300049824 Bacteria 7371
313 nmdc:mga03683_17240_c1 3300050489 Bacteria 2730
314 nmdc:mga03n38_15375_c1 3300050490 Bacteria 2954
315 nmdc:mga03n38_29673_c1 3300050490 Bacteria 2292
316 nmdc:mga00v17_115628_c1 3300050491 Bacteria 1705
317 nmdc:mga00v17_28551_c1 3300050491 Bacteria 3268
318 nmdc:mga00v17_9653_c1 3300050491 Bacteria 5234
319 nmdc:mga0yw44_22141_c1 3300050492 Bacteria 3558
320 nmdc:mga0yw44_37393_c1 3300050492 Bacteria 2866
321 nmdc:mga0yw44_93345_c1 3300050492 Bacteria 1906
322 nmdc:mga0k408_13689_c1 3300050493 Bacteria 4454
323 nmdc:mga06z11_17946_c1 3300050494 Bacteria 3223
324 nmdc:mga07m45_48852_c1 3300050496 Bacteria 2380
325 nmdc:mga05p37_50718_c2 3300050507 Bacteria 3644
326 nmdc:mga0qj67_121272_c1 3300050509 Bacteria 2115
327 nmdc:mga06r32_151334_c1 3300050510 Bacteria 2299
328 nmdc:mga08y16_168803_c1 3300050511 Bacteria 2273
329 nmdc:mga0sz30_1132_c1 3300050516 Bacteria 9563
330 nmdc:mga0sz30_18220_c2 3300050516 Bacteria 1957
331 nmdc:mga0sz30_20587_c2 3300050516 Bacteria 2305
332 nmdc:mga0sz30_2466_c1 3300050516 Bacteria 6585
333 nmdc:mga0sz30_4383_c1 3300050516 Bacteria 4627
334 Ga0500643_004723 3300053087 Bacteria 6056
335 Ga0500643_009535 3300053087 Bacteria 3700
336 Ga0500556_0049467 3300053104 Bacteria 1515
337 Ga0500608_001004 3300053122 Bacteria 10128
338 Ga0500618_000022 3300053125 Bacteria 157907
339 Ga0500642_0004128 3300053130 Bacteria 4495
340 Ga0500652_000187 3300053131 Bacteria 23997
341 Ga0500559_0000054 3300053136 Bacteria 90695
342 Ga0500559_0038526 3300053136 Bacteria 2076
343 Ga0500616_0018233 3300053153 Bacteria 3971
344 Ga0500622_0006217 3300053156 Bacteria 6987
345 Ga0500622_0022007 3300053156 Bacteria 3382
346 Ga0500645_000323 3300053730 Bacteria 33881
347 Ga0500645_000893 3300053730 Bacteria 17254
348 Ga0500645_004862 3300053730 Bacteria 5062
349 Ga0501084_0018957 3300054114 Bacteria 5728
350 Ga0501082_0023714 3300060353 Bacteria 5291
351 Ga0530510_0075150 3300061734 Bacteria 2454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0038526 Ga0500559_0038526_14_1300 356
2 3300048910 Ga0496107_0054524 Ga0496107_0054524_1573_2865 371
3 3300039437 Ga0436365_0107941 Ga0436365_0107941_14755_16080 380
4 3300005354 Ga0070675_100065280 Ga0070675_1000652801 381
5 3300014969 Ga0157376_10253710 Ga0157376_102537101 381
6 3300025918 Ga0207662_10029369 Ga0207662_100293692 381
7 3300025942 Ga0207689_10021096 Ga0207689_100210964 381
8 3300026089 Ga0207648_10030210 Ga0207648_100302103 381
9 3300050511 nmdc:mga08y16_168803_c1 nmdc:mga08y16_168803_c1_16_1467 381
10 3300025299 Ga0209256_1003299 Ga0209256_10032994 382
11 3300013306 Ga0163162_10081584 Ga0163162_100815842 385
12 3300050516 nmdc:mga0sz30_1132_c1 nmdc:mga0sz30_1132_c1_1569_2975 385
13 3300003781 Ga0055536_1001392 Ga0055536_100139213 386
14 3300003791 Ga0055530_10005206 Ga0055530_100052064 386
15 3300025292 Ga0209676_1000169 Ga0209676_1000169151 386
16 3300025298 Ga0209050_1000737 Ga0209050_100073739 386
17 3300025303 Ga0209051_1001836 Ga0209051_10018364 386
18 3300048927 Ga0496124_0024037 Ga0496124_0024037_870_2279 386
19 3300053122 Ga0500608_001004 Ga0500608_001004_8544_9947 388
20 3300053156 Ga0500622_0022007 Ga0500622_0022007_92_1492 388
21 3300046616 Ga0495668_0000040 Ga0495668_0000040_184810_186210 389
22 3300013104 Ga0157370_10269227 Ga0157370_102692271 390
23 3300048925 Ga0496122_0000112 Ga0496122_0000112_145631_147001 390
24 3300048928 Ga0496125_0035389 Ga0496125_0035389_2490_3890 390
25 3300048929 Ga0496126_0036098 Ga0496126_0036098_2703_4103 390
26 3300046453 Ga0495627_000654 Ga0495627_000654_4856_6265 391
27 3300053104 Ga0500556_0049467 Ga0500556_0049467_47_1471 391
28 3300053730 Ga0500645_000893 Ga0500645_000893_15788_17212 391
29 3300025304 Ga0209257_1000352 Ga0209257_100035285 392
30 3300006353 Ga0075370_10065488 Ga0075370_100654881 393
31 3300028794 Ga0307515_10040608 Ga0307515_100406084 393
32 3300046660 Ga0495625_0000043 Ga0495625_0000043_10594_12006 393
33 3300046794 Ga0495589_0000982 Ga0495589_0000982_5054_6469 393
34 3300046810 Ga0495660_0013397 Ga0495660_0013397_534_1961 393
35 3300046810 Ga0495660_0035390 Ga0495660_0035390_638_2053 393
36 3300047472 Ga0495686_0005282 Ga0495686_0005282_8757_10169 393
37 3300053156 Ga0500622_0006217 Ga0500622_0006217_4149_5561 393
38 3300025297 Ga0209758_1011627 Ga0209758_10116272 394
39 3300046460 Ga0495638_0023892 Ga0495638_0023892_2550_3965 394
40 3300046506 Ga0495583_0000025 Ga0495583_0000025_247670_249082 394
41 3300046507 Ga0495606_0029333 Ga0495606_0029333_1645_3060 394
42 3300046512 Ga0495610_0000794 Ga0495610_0000794_23720_25147 394
43 3300046660 Ga0495625_0008772 Ga0495625_0008772_4833_6260 394
44 3300047320 Ga0495672_0001651 Ga0495672_0001651_11743_13158 394
45 3300048909 Ga0496106_0045011 Ga0496106_0045011_799_2214 394
46 3300048910 Ga0496107_0000029 Ga0496107_0000029_12765_14180 394
47 3300048924 Ga0496121_0002142 Ga0496121_0002142_24320_25735 394
48 3300003775 Ga0055524_1003107 Ga0055524_10031073 395
49 3300003790 Ga0055528_1006777 Ga0055528_10067774 395
50 3300025263 Ga0209565_1000183 Ga0209565_10001838 395
51 3300025273 Ga0209673_1001029 Ga0209673_100102925 395
52 3300025291 Ga0209675_1009580 Ga0209675_10095803 395
53 3300025298 Ga0209050_1026737 Ga0209050_10267371 395
54 3300025299 Ga0209256_1004315 Ga0209256_10043153 395
55 3300025299 Ga0209256_1013656 Ga0209256_10136563 395
56 3300046460 Ga0495638_0000230 Ga0495638_0000230_42900_44315 395
57 3300046460 Ga0495638_0002617 Ga0495638_0002617_28_1446 395
58 3300046471 Ga0495650_0000207 Ga0495650_0000207_83501_84919 395
59 3300046513 Ga0495616_0001257 Ga0495616_0001257_3080_4510 395
60 3300046515 Ga0495620_0010973 Ga0495620_0010973_1289_2719 395
61 3300046519 Ga0495632_0000545 Ga0495632_0000545_14872_16302 395
62 3300046530 Ga0495654_0000016 Ga0495654_0000016_222461_223879 395
63 3300046616 Ga0495668_0002079 Ga0495668_0002079_6631_8061 395
64 3300046660 Ga0495625_0002055 Ga0495625_0002055_6532_7950 395
65 3300046660 Ga0495625_0014285 Ga0495625_0014285_2700_4130 395
66 3300047446 Ga0495679_005340 Ga0495679_005340_2366_3784 395
67 3300047469 Ga0495673_0000223 Ga0495673_0000223_32715_34136 395
68 3300047469 Ga0495673_0004053 Ga0495673_0004053_2570_3988 395
69 3300048918 Ga0496115_0002259 Ga0496115_0002259_4785_6203 395
70 3300053125 Ga0500618_000022 Ga0500618_000022_11543_12961 395
71 3300005262 Ga0065165_1001692 Ga0065165_100169210 396
72 3300025295 Ga0209564_1010622 Ga0209564_10106222 396
73 3300046512 Ga0495610_0003341 Ga0495610_0003341_9697_11118 396
74 3300048914 Ga0496111_0088071 Ga0496111_0088071_819_2219 400
75 3300050491 nmdc:mga00v17_115628_c1 nmdc:mga00v17_115628_c1_21_1502 401
76 3300050489 nmdc:mga03683_17240_c1 nmdc:mga03683_17240_c1_43_1524 402
77 3300009101 Ga0105247_10000181 Ga0105247_1000018130 405
78 3300009553 Ga0105249_10000022 Ga0105249_10000022225 405
79 3300048903 Ga0496100_0148771 Ga0496100_0148771_177_1637 405
80 3300048904 Ga0496101_0005686 Ga0496101_0005686_6129_7589 405
81 3300048905 Ga0496102_0000050 Ga0496102_0000050_30739_32199 405
82 3300048906 Ga0496103_0000738 Ga0496103_0000738_19846_21306 405
83 3300048919 Ga0496116_0014608 Ga0496116_0014608_169_1629 405
84 3300048921 Ga0496118_0001032 Ga0496118_0001032_27575_29035 405
85 3300048922 Ga0496119_0021912 Ga0496119_0021912_1074_2534 405
86 3300048923 Ga0496120_0007390 Ga0496120_0007390_503_1963 405
87 3300048924 Ga0496121_0072978 Ga0496121_0072978_1075_2535 405
88 3300048927 Ga0496124_0092350 Ga0496124_0092350_597_2057 405
89 3300048929 Ga0496126_0007007 Ga0496126_0007007_8730_10190 405
90 3300053087 Ga0500643_009535 Ga0500643_009535_328_1842 406
91 3300053136 Ga0500559_0000054 Ga0500559_0000054_35604_37019 408
92 3300039437 Ga0436365_0548618 Ga0436365_0548618_5663_7060 410
93 3300001990 JGI24737J22298_10016879 JGI24737J22298_100168792 411
94 3300002067 JGI24735J21928_10006158 JGI24735J21928_100061582 411
95 3300002073 JGI24745J21846_1000230 JGI24745J21846_10002304 411
96 3300005339 Ga0070660_100040436 Ga0070660_1000404363 411
97 3300005345 Ga0070692_10036468 Ga0070692_100364682 411
98 3300005347 Ga0070668_100050429 Ga0070668_1000504292 411
99 3300005364 Ga0070673_100139086 Ga0070673_1001390862 411
100 3300005367 Ga0070667_100155748 Ga0070667_1001557482 411
101 3300005441 Ga0070700_100013557 Ga0070700_1000135572 411
102 3300005457 Ga0070662_100088523 Ga0070662_1000885232 411
103 3300005544 Ga0070686_100060514 Ga0070686_1000605142 411
104 3300005616 Ga0068852_100009440 Ga0068852_1000094404 411
105 3300005618 Ga0068864_100035390 Ga0068864_1000353903 411
106 3300009545 Ga0105237_10206732 Ga0105237_102067322 411
107 3300011119 Ga0105246_10104160 Ga0105246_101041602 411
108 3300013100 Ga0157373_10034679 Ga0157373_100346793 411
109 3300013296 Ga0157374_10067371 Ga0157374_100673712 411
110 3300013307 Ga0157372_10247200 Ga0157372_102472001 411
111 3300025901 Ga0207688_10000607 Ga0207688_100006074 411
112 3300025904 Ga0207647_10057064 Ga0207647_100570642 411
113 3300025907 Ga0207645_10020571 Ga0207645_100205714 411
114 3300025919 Ga0207657_10031088 Ga0207657_100310882 411
115 3300025931 Ga0207644_10086188 Ga0207644_100861882 411
116 3300025933 Ga0207706_10024272 Ga0207706_100242723 411
117 3300025933 Ga0207706_10073055 Ga0207706_100730554 411
118 3300025972 Ga0207668_10148922 Ga0207668_101489222 411
119 3300026023 Ga0207677_10029800 Ga0207677_100298003 411
120 3300026075 Ga0207708_10007513 Ga0207708_100075134 411
121 3300026116 Ga0207674_10094425 Ga0207674_100944252 411
122 3300026118 Ga0207675_100006322 Ga0207675_1000063229 411
123 3300048905 Ga0496102_0098881 Ga0496102_0098881_360_1811 411
124 3300006051 Ga0075364_10043253 Ga0075364_100432532 412
125 3300003792 Ga0055540_1003275 Ga0055540_10032753 413
126 3300006048 Ga0075363_100000565 Ga0075363_1000005658 413
127 3300006051 Ga0075364_10005879 Ga0075364_100058795 413
128 3300006186 Ga0075369_10011451 Ga0075369_100114511 413
129 3300006353 Ga0075370_10010316 Ga0075370_100103163 413
130 3300025303 Ga0209051_1003906 Ga0209051_10039062 413
131 3300050491 nmdc:mga00v17_28551_c1 nmdc:mga00v17_28551_c1_962_2476 413
132 3300050516 nmdc:mga0sz30_4383_c1 nmdc:mga0sz30_4383_c1_35_1534 413
133 3300053153 Ga0500616_0018233 Ga0500616_0018233_1121_2632 415
134 3300005353 Ga0070669_100000944 Ga0070669_10000094418 416
135 3300005367 Ga0070667_100000182 Ga0070667_10000018229 416
136 3300005841 Ga0068863_100014842 Ga0068863_1000148425 416
137 3300005843 Ga0068860_100000374 Ga0068860_10000037430 416
138 3300005844 Ga0068862_100000276 Ga0068862_10000027632 416
139 3300009177 Ga0105248_10000652 Ga0105248_100006528 416
140 3300013306 Ga0163162_10060900 Ga0163162_100609002 416
141 3300014325 Ga0163163_10018904 Ga0163163_100189046 416
142 3300014968 Ga0157379_10086006 Ga0157379_100860062 416
143 3300025900 Ga0207710_10000091 Ga0207710_1000009130 416
144 3300025923 Ga0207681_10001711 Ga0207681_1000171114 416
145 3300025941 Ga0207711_10000713 Ga0207711_1000071330 416
146 3300025961 Ga0207712_10000005 Ga0207712_10000005227 416
147 3300025986 Ga0207658_10000316 Ga0207658_1000031621 416
148 3300026088 Ga0207641_10003321 Ga0207641_1000332112 416
149 3300028379 Ga0268266_10052979 Ga0268266_100529793 416
150 3300028380 Ga0268265_10000005 Ga0268265_10000005519 416
151 3300028381 Ga0268264_10000005 Ga0268264_10000005226 416
152 3300041443 Ga0451789_0474344 Ga0451789_0474344_522_1988 418
153 3300041512 Ga0451853_1486162 Ga0451853_1486162_7382_8812 418
154 3300048905 Ga0496102_0024044 Ga0496102_0024044_2174_3571 418
155 3300048921 Ga0496118_0000256 Ga0496118_0000256_52043_53440 418
156 3300044656 Ga0466969_0022091 Ga0466969_0022091_782_2275 419
157 3300044684 Ga0466966_0034032 Ga0466966_0034032_1271_2764 419
158 3300044694 Ga0466963_0041460 Ga0466963_0041460_1166_2659 419
159 3300044842 Ga0466957_0055710 Ga0466957_0055710_631_2124 419
160 3300045049 Ga0466959_0032275 Ga0466959_0032275_707_2200 419
161 3300045836 Ga0466958_0018325 Ga0466958_0018325_1149_2642 419
162 3300046524 Ga0495648_0009985 Ga0495648_0009985_4686_6239 419
163 3300046616 Ga0495668_0009708 Ga0495668_0009708_3902_5455 419
164 3300047320 Ga0495672_0006505 Ga0495672_0006505_6486_8039 419
165 3300047469 Ga0495673_0004409 Ga0495673_0004409_6198_7751 419
166 3300047472 Ga0495686_0012447 Ga0495686_0012447_3745_5190 421
167 3300013308 Ga0157375_10103532 Ga0157375_101035322 422
168 3300025901 Ga0207688_10039405 Ga0207688_100394053 422
169 3300048911 Ga0496108_0166340 Ga0496108_0166340_251_1768 422
170 3300009148 Ga0105243_10086945 Ga0105243_100869453 424
171 3300053131 Ga0500652_000187 Ga0500652_000187_2904_4415 425
172 3300048924 Ga0496121_0010034 Ga0496121_0010034_2963_4441 426
173 3300048929 Ga0496126_0051261 Ga0496126_0051261_2230_3687 427
174 3300045049 Ga0466959_0009597 Ga0466959_0009597_4254_5675 428
175 3300048916 Ga0496113_0008581 Ga0496113_0008581_5116_6612 429
176 3300048925 Ga0496122_0116034 Ga0496122_0116034_192_1688 429
177 3300048926 Ga0496123_0023558 Ga0496123_0023558_1313_2809 429
178 3300048929 Ga0496126_0002750 Ga0496126_0002750_12602_14098 429
179 3300047472 Ga0495686_0009405 Ga0495686_0009405_4056_5537 430
180 3300044694 Ga0466963_0141931 Ga0466963_0141931_66_1556 431
181 3300048905 Ga0496102_0033571 Ga0496102_0033571_604_2016 431
182 3300048907 Ga0496104_0152433 Ga0496104_0152433_381_1793 431
183 3300049568 Ga0501031_0010523 Ga0501031_0010523_3149_4594 432
184 3300049569 Ga0501032_0011527 Ga0501032_0011527_628_2073 432
185 3300049572 Ga0501036_0009975 Ga0501036_0009975_2168_3613 432
186 3300049574 Ga0501038_0012818 Ga0501038_0012818_406_1851 432
187 3300049575 Ga0501039_0024262 Ga0501039_0024262_1671_3116 432
188 3300049576 Ga0501040_0008485 Ga0501040_0008485_4559_6004 432
189 3300049578 Ga0501042_0003709 Ga0501042_0003709_5360_6805 432
190 3300049582 Ga0501048_0026527 Ga0501048_0026527_2222_3667 432
191 3300049587 Ga0501071_0046627 Ga0501071_0046627_444_1889 432
192 3300049588 Ga0501072_0035538 Ga0501072_0035538_294_1739 432
193 3300049590 Ga0501074_0014770 Ga0501074_0014770_1116_2561 432
194 3300049591 Ga0501075_0018921 Ga0501075_0018921_288_1733 432
195 3300049592 Ga0501076_0017277 Ga0501076_0017277_3294_4739 432
196 3300049742 Ga0501080_0010341 Ga0501080_0010341_5024_6469 432
197 3300049824 Ga0501045_0007986 Ga0501045_0007986_1572_3017 432
198 3300054114 Ga0501084_0018957 Ga0501084_0018957_450_1895 432
199 3300061734 Ga0530510_0075150 Ga0530510_0075150_331_1776 432
200 iso_pu_bacteria 2857504554 2857505916 433
201 3300005539 Ga0068853_100034081 Ga0068853_1000340812 434
202 3300026041 Ga0207639_10050716 Ga0207639_100507163 434
203 3300050516 nmdc:mga0sz30_2466_c1 nmdc:mga0sz30_2466_c1_2603_4048 435
204 3300009545 Ga0105237_10003090 Ga0105237_1000309014 436
205 3300031548 Ga0307408_100000731 Ga0307408_10000073114 436
206 iso_pu_bacteria 2928531327 2928531977 436
207 3300039437 Ga0436365_1573747 Ga0436365_1573747_8189_9619 437
208 3300003792 Ga0055540_1005570 Ga0055540_10055705 438
209 3300025303 Ga0209051_1003994 Ga0209051_10039945 438
210 3300047320 Ga0495672_0000014 Ga0495672_0000014_65441_66949 438
211 iso_pu_bacteria 2582581279 2585150172 438
212 3300005347 Ga0070668_100021995 Ga0070668_1000219952 439
213 3300005843 Ga0068860_100011490 Ga0068860_1000114908 439
214 3300025931 Ga0207644_10048880 Ga0207644_100488801 439
215 3300028381 Ga0268264_10010358 Ga0268264_100103587 439
216 iso_pu_bacteria 2643221583 2643926950 439
217 iso_pu_bacteria 2818991435 2819538341 439
218 iso_pu_bacteria 2818991454 2819649409 439
219 iso_pu_bacteria 2643221545 2643750371 440
220 iso_pu_bacteria 2643221691 2644507260 440
221 3300009098 Ga0105245_10036394 Ga0105245_100363942 441
222 3300009545 Ga0105237_10295407 Ga0105237_102954071 441
223 3300013296 Ga0157374_10027232 Ga0157374_100272324 441
224 3300013297 Ga0157378_10218039 Ga0157378_102180392 441
225 3300013306 Ga0163162_10035949 Ga0163162_100359493 441
226 3300013308 Ga0157375_10072887 Ga0157375_100728873 441
227 3300044684 Ga0466966_0008187 Ga0466966_0008187_2396_3856 441
228 3300044693 Ga0466961_0000291 Ga0466961_0000291_5789_7249 441
229 3300048911 Ga0496108_0000394 Ga0496108_0000394_9739_11220 441
230 3300048912 Ga0496109_0008395 Ga0496109_0008395_5422_6903 441
231 3300048916 Ga0496113_0026894 Ga0496113_0026894_647_2128 441
232 iso_pu_bacteria 2510917020 2511122318 441
233 iso_pu_bacteria 2582581280 2585154549 441
234 iso_pu_bacteria 2582581293 2585198562 441
235 iso_pu_bacteria 2643221552 2643780451 441
236 iso_pu_bacteria 2643221584 2643932146 441
237 3300009545 Ga0105237_10102058 Ga0105237_101020583 444
238 3300010375 Ga0105239_10001222 Ga0105239_1000122237 445
239 3300047472 Ga0495686_0028837 Ga0495686_0028837_880_2352 445
240 3300006186 Ga0075369_10015425 Ga0075369_100154253 447
241 3300048903 Ga0496100_0034648 Ga0496100_0034648_796_2256 447
242 3300048909 Ga0496106_0028420 Ga0496106_0028420_887_2347 447
243 3300048910 Ga0496107_0032650 Ga0496107_0032650_324_1784 447
244 iso_pu_bacteria 2915358134 2915362317 447
245 3300026067 Ga0207678_10081104 Ga0207678_100811042 448
246 3300032126 Ga0307415_100141980 Ga0307415_1001419802 448
247 3300053130 Ga0500642_0004128 Ga0500642_0004128_2043_3497 448
248 iso_pu_bacteria 2600255292 2601666756 448
249 iso_pu_bacteria 2857547612 2857548522 448
250 iso_pu_bacteria 2885080285 2885081045 448
251 iso_pu_bacteria 2904765812 2904766232 448
252 iso_pu_bacteria 2904770941 2904772297 448
253 iso_pu_bacteria 2908811453 2908812005 448
254 iso_pu_bacteria 2919420072 2919421342 448
255 iso_pu_bacteria 2919432681 2919432900 448
256 3300006038 Ga0075365_10064480 Ga0075365_100644802 449
257 3300006051 Ga0075364_10061034 Ga0075364_100610342 449
258 3300049569 Ga0501032_0002631 Ga0501032_0002631_5563_7029 449
259 3300049571 Ga0501034_0029412 Ga0501034_0029412_236_1702 449
260 3300049581 Ga0501047_0004486 Ga0501047_0004486_562_2028 449
261 3300049822 Ga0501035_0004606 Ga0501035_0004606_11061_12527 449
262 3300049823 Ga0501044_0000388 Ga0501044_0000388_48221_49687 449
263 3300050492 nmdc:mga0yw44_93345_c1 nmdc:mga0yw44_93345_c1_89_1534 449
264 3300006353 Ga0075370_10080835 Ga0075370_100808351 450
265 3300044684 Ga0466966_0012714 Ga0466966_0012714_593_2062 450
266 3300044735 Ga0466968_0004089 Ga0466968_0004089_1166_2635 450
267 3300044765 Ga0466970_0014265 Ga0466970_0014265_2125_3594 450
268 3300044842 Ga0466957_0059592 Ga0466957_0059592_120_1589 450
269 3300045049 Ga0466959_0004307 Ga0466959_0004307_4430_5899 450
270 3300048927 Ga0496124_0120161 Ga0496124_0120161_390_1835 450
271 3300053730 Ga0500645_004862 Ga0500645_004862_277_1812 451
272 3300009098 Ga0105245_10153964 Ga0105245_101539642 452
273 3300014497 Ga0182008_10001391 Ga0182008_100013912 452
274 3300015261 Ga0182006_1000010 Ga0182006_1000010331 452
275 3300015262 Ga0182007_10000021 Ga0182007_10000021120 452
276 3300015265 Ga0182005_1000009 Ga0182005_100000952 452
277 3300048911 Ga0496108_0090164 Ga0496108_0090164_844_2346 452
278 3300048913 Ga0496110_0200701 Ga0496110_0200701_160_1662 452
279 3300048919 Ga0496116_0027386 Ga0496116_0027386_2241_3713 452
280 3300048920 Ga0496117_0000010 Ga0496117_0000010_549831_551303 452
281 3300048921 Ga0496118_0000009 Ga0496118_0000009_60652_62124 452
282 3300003792 Ga0055540_1003882 Ga0055540_10038826 453
283 3300025303 Ga0209051_1001329 Ga0209051_10013297 453
284 3300048905 Ga0496102_0166829 Ga0496102_0166829_573_2054 453
285 3300049743 Ga0501081_0132183 Ga0501081_0132183_10_1455 453
286 3300050496 nmdc:mga07m45_48852_c1 nmdc:mga07m45_48852_c1_844_2325 453
287 3300060353 Ga0501082_0023714 Ga0501082_0023714_3156_4601 453
288 iso_pu_bacteria 2643221566 2643848103 453
289 3300006051 Ga0075364_10011450 Ga0075364_100114505 454
290 3300039447 Ga0436361_0011709 Ga0436361_0011709_61_1530 454
291 3300048925 Ga0496122_0001806 Ga0496122_0001806_7020_8498 454
292 3300048926 Ga0496123_0004642 Ga0496123_0004642_612_2090 454
293 3300048927 Ga0496124_0129621 Ga0496124_0129621_346_1824 454
294 3300050491 nmdc:mga00v17_9653_c1 nmdc:mga00v17_9653_c1_533_2068 454
295 3300050516 nmdc:mga0sz30_18220_c2 nmdc:mga0sz30_18220_c2_360_1895 454
296 iso_pu_bacteria 2932410948 2932413116 454
297 iso_pu_bacteria 2932416698 2932420631 454
298 3300009098 Ga0105245_10121846 Ga0105245_101218462 455
299 3300009553 Ga0105249_10114374 Ga0105249_101143741 455
300 3300025972 Ga0207668_10079876 Ga0207668_100798762 455
301 3300026142 Ga0207698_10154777 Ga0207698_101547772 455
302 3300048915 Ga0496112_0008930 Ga0496112_0008930_3924_5429 455
303 3300005334 Ga0068869_100095662 Ga0068869_1000956621 456
304 3300005842 Ga0068858_100079883 Ga0068858_1000798833 456
305 3300044683 Ga0466965_0003174 Ga0466965_0003174_3502_4986 457
306 3300044901 Ga0466960_0002334 Ga0466960_0002334_3911_5395 457
307 iso_pu_bacteria 2984576629 2984578016 457
308 iso_pu_bacteria 2990256926 2990257530 457
309 3300006846 Ga0075430_100061759 Ga0075430_1000617593 458
310 3300050509 nmdc:mga0qj67_121272_c1 nmdc:mga0qj67_121272_c1_474_2009 458
311 3300002073 JGI24745J21846_1001128 JGI24745J21846_10011282 459
312 3300002077 JGI24744J21845_10003542 JGI24744J21845_100035423 459
313 3300005338 Ga0068868_100036503 Ga0068868_1000365032 459
314 3300005364 Ga0070673_100033633 Ga0070673_1000336332 459
315 3300005456 Ga0070678_100030599 Ga0070678_1000305993 459
316 3300005719 Ga0068861_100105878 Ga0068861_1001058782 459
317 3300005842 Ga0068858_100039299 Ga0068858_1000392993 459
318 3300025901 Ga0207688_10018599 Ga0207688_100185992 459
319 3300025927 Ga0207687_10019744 Ga0207687_100197443 459
320 3300026023 Ga0207677_10012344 Ga0207677_100123443 459
321 3300026035 Ga0207703_10031218 Ga0207703_100312184 459
322 3300026121 Ga0207683_10139236 Ga0207683_101392362 459
323 3300050493 nmdc:mga0k408_13689_c1 nmdc:mga0k408_13689_c1_1373_2848 459
324 iso_pu_bacteria 2643221690 2644505872 459
325 iso_pu_bacteria 2643221694 2644524298 459
326 iso_pu_bacteria 2643221722 2644668398 459
327 3300053087 Ga0500643_004723 Ga0500643_004723_425_1960 461
328 iso_pu_bacteria 2884994152 2884995297 461
329 iso_pu_bacteria 2643221687 2644490116 465
330 iso_pu_bacteria 2902837492 2902841745 465
331 iso_pu_bacteria 2939582691 2939586660 466
332 iso_pu_bacteria 2738541274 2738704744 467
333 iso_pu_bacteria 2738543028 2739329913 467
334 3300041413 Ga0439465_0001186 Ga0439465_0001186_693_2195 469
335 3300005347 Ga0070668_100038264 Ga0070668_1000382643 470
336 3300005355 Ga0070671_100002004 Ga0070671_10000200414 470
337 3300005719 Ga0068861_100100305 Ga0068861_1001003051 470
338 3300005841 Ga0068863_100103518 Ga0068863_1001035182 470
339 3300006038 Ga0075365_10000933 Ga0075365_100009332 470
340 3300006042 Ga0075368_10013410 Ga0075368_100134102 470
341 3300006048 Ga0075363_100001303 Ga0075363_1000013036 470
342 3300006178 Ga0075367_10003453 Ga0075367_100034533 470
343 3300006178 Ga0075367_10032370 Ga0075367_100323703 470
344 3300006353 Ga0075370_10002037 Ga0075370_100020375 470
345 3300009092 Ga0105250_10014957 Ga0105250_100149572 470
346 3300025961 Ga0207712_10034727 Ga0207712_100347273 470
347 3300028381 Ga0268264_10072996 Ga0268264_100729962 470
348 3300031852 Ga0307410_10006022 Ga0307410_100060222 470
349 3300031995 Ga0307409_100017354 Ga0307409_1000173545 470
350 3300041411 Ga0439466_0014571 Ga0439466_0014571_27_1532 470
351 3300041413 Ga0439465_0001363 Ga0439465_0001363_31_1536 470
352 3300041413 Ga0439465_0001930 Ga0439465_0001930_383_1888 470
353 3300041413 Ga0439465_0002415 Ga0439465_0002415_997_2502 470
354 3300044658 Ga0466972_0048382 Ga0466972_0048382_127_1626 470
355 3300044684 Ga0466966_0040657 Ga0466966_0040657_412_1911 470
356 3300044693 Ga0466961_0017207 Ga0466961_0017207_2344_3843 470
357 3300044765 Ga0466970_0008305 Ga0466970_0008305_3397_4896 470
358 3300045836 Ga0466958_0016688 Ga0466958_0016688_1632_3131 470
359 3300048907 Ga0496104_0057895 Ga0496104_0057895_1846_3381 470
360 3300048911 Ga0496108_0023708 Ga0496108_0023708_899_2434 470
361 3300048912 Ga0496109_0022968 Ga0496109_0022968_2198_3733 470
362 3300048915 Ga0496112_0013620 Ga0496112_0013620_3404_4939 470
363 3300048916 Ga0496113_0033593 Ga0496113_0033593_580_2115 470
364 3300050490 nmdc:mga03n38_29673_c1 nmdc:mga03n38_29673_c1_500_2008 470
365 3300050492 nmdc:mga0yw44_22141_c1 nmdc:mga0yw44_22141_c1_500_2008 470
366 3300050494 nmdc:mga06z11_17946_c1 nmdc:mga06z11_17946_c1_479_1987 470
367 3300002459 JGI24751J29686_10013500 JGI24751J29686_100135001 471
368 3300005544 Ga0070686_100041716 Ga0070686_1000417162 471
369 3300005548 Ga0070665_100008095 Ga0070665_10000809512 471
370 3300005841 Ga0068863_100012289 Ga0068863_1000122893 471
371 3300006051 Ga0075364_10010497 Ga0075364_100104973 471
372 3300006186 Ga0075369_10035834 Ga0075369_100358341 471
373 3300006844 Ga0075428_100001829 Ga0075428_10000182912 471
374 3300009147 Ga0114129_10231721 Ga0114129_102317212 471
375 3300025931 Ga0207644_10005495 Ga0207644_100054952 471
376 3300025986 Ga0207658_10037468 Ga0207658_100374682 471
377 3300026035 Ga0207703_10169924 Ga0207703_101699241 471
378 3300026088 Ga0207641_10011331 Ga0207641_100113314 471
379 3300028379 Ga0268266_10004670 Ga0268266_1000467014 471
380 3300050490 nmdc:mga03n38_15375_c1 nmdc:mga03n38_15375_c1_350_1885 471
381 3300050492 nmdc:mga0yw44_37393_c1 nmdc:mga0yw44_37393_c1_192_1727 471
382 3300050507 nmdc:mga05p37_50718_c2 nmdc:mga05p37_50718_c2_1546_3081 471
383 3300050510 nmdc:mga06r32_151334_c1 nmdc:mga06r32_151334_c1_186_1721 471
384 3300050516 nmdc:mga0sz30_20587_c2 nmdc:mga0sz30_20587_c2_78_1613 471
385 3300053730 Ga0500645_000323 Ga0500645_000323_23244_24779 471
386 3300006186 Ga0075369_10012390 Ga0075369_100123902 472
387 3300001979 JGI24740J21852_10025396 JGI24740J21852_100253962 481

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13906

AA_permease_C

C-terminus of AA_permease

423

473

0.99

PF13520

AA_permease_2

Amino acid permease

37

473

0.88

PF00324

AA_permease

Amino acid permease

41

467

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8328 32 460
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.8228 32 460
3gi9-assembly1.cif.gz_C crystal structure of apct transporter bound to 7f11 monoclonal fab fragment 0.81 29 462
3gi8-assembly1.cif.gz_C crystal structure of apct k158a transporter bound to 7f11 monoclonal fab fragment 0.8092 29 462
3gia-assembly1.cif.gz_A crystal structure of apct transporter 0.8045 32 462
ID Description Score Start End Superfamily
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8907 31 461 1.20.1740.10
af_Q09143_27_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8833 31 413 1.20.1740.10
af_Q9VWD3_53_450_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.876 32 413 1.20.1740.10
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8616 31 461 1.20.1740.10
af_Q4CYX3_37_503_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8548 33 461 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A4U3B1Y3-F1-model_v4 deleted 0.9308 93 380
AF-A0A2T5G635-F1-model_v4 Amino acid permease-associated region 0.9208 28 454 GO:0015171
GO:0016020
AF-A0A4U3B1Y3-F1-model_v4 deleted 0.9086 93 380
AF-A0A2V8E837-F1-model_v4 Amino acid permease 0.9035 31 331 GO:0015171
GO:0016020
AF-A0A819BK17-F1-model_v4 tRNA-5-taurinomethyluridine 2-sulfurtransferase (EC 2.8.1.14) 0.8925 32 463 GO:0000049
GO:0005524
GO:0008033
GO:0015171
GO:0016020
GO:0016783

Feature Viewer

pLDDT pTM Quality
75.36 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map